1PZYB

W314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
TACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGAGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LACTALBUMIN
publication title The Role of Tryptophan 314 in the Conformational Changes of beta 1,4-Galactosyltransferase-I
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase activator/transferase
total genus 91
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1pzyB00
3ZLKA 1GWWA 4G87A 1VICA 4AC3A 5CMHA 4FRQA 4CVHA 3CU0A 4G3QA 5IFYA 1INJA 3V0MA 2X65A 3T7OA 1MP3A 1JV3A 3PNNA 2WVLA 1GX0A 5J49A 1ZCYA 4IRPA 4Y64A 3U2UA 1K4VA 2FYAA 2BO7A 3OH0A 1FOAA 1FZWA 4EEMA 3I0JA 3U2VA 5IDSA 4EE4A 3SXAA 3I0CA 1LZJA 3U0YA 4G3SA 1GWVA 4Y6UA 4FRLA 2DPWA 3RMWA 4FQWA 3SXDA 3HL3A 3CKJA 1R7UA 4FRMA 5C4EA 3TQDA 1W77A 3ZGFA 3V0QA 2AM3A 5C3DA 4YS8A 2V0HA 1TW1A 3JUKA 5JQQA 4FRDA 2X5SA 1H7LA 1EZIA 2RJ1A 4LW6A 4JD0A 2JCLA 3CKOA 1VM8A 2RJ6A 1H5RB 1IIMA 1I52A 4KNRA 2OI7A 3SXBA 1JYKA 4NALA 4KC2A 4ARWA 3PKPA 3SX8A 2X5ZA 1FO8A 4Y7VA 2AH9A 1HM9A 2Z86A 2WE9A 4AYLA 2ZU8A 1VH1A 4EEOA 3D8VA 1ZJ1A 1KWSA 4B4GA 2GGOA 3JUJA 5CQLX 3V0PA 3OKRA 3D5NA 3I0DA 4FCUA 4R7PA 4DECA 5CQOA 3I0KA 1MP4A 4FRHA 3NGWA 2V0IA 2Y4MA 1H4DA 2P73A 5AJNA 1H5RA 1FXJA 1ON6A 4FRPA 3I0GA 2BO4A 5IDTA 2VS5A 4HOCA 3V90A 1JVDA 2VS4A 4P00A 2X60A 2YQCA 3E25A 1ZCVA 4KC4A 1ZI1A 2AM4A 1FWYA 4HG6A 1G95A 2O1HA 1WVCA 3BRKX 2APCA 1FR8A 4HO3A 1H7TA 1PZTA 5FV9A 1JVGA 1H5TB 1JYLA 1ZI5A 1FO9A 1LL2A 5DDTA 5FTSA 2W0VA 2AGDA 2PGYA 4HCQA 4HO8A 3T7MA 3CGXA 3SXCA 3USQA 3V8YA 4Y7UA 4K6RA 4KPXA 5C1GA 3I0IX 3QVBA 2RIYA 4Y9XA 1ON8A 2V0KA 2Y4LA 3I0FA 5DDVA 2I7BA 4BMAA 5C4CA 4Y62A 2RJ9A 4MNDA 1H4EA 2YQJA 5CQMX 1ZCUA 1ZJPA 4D0TA 1G93A 1QG8A 2CU2A 2VFZA 2V0JA 1GQ9A 4B42A 4KNXA 1E5KA 1H5TA 1Z90A 4ECMA 2Y7AA 2V0LA 4M28A 4D48A 3D98A 3POLA 4ASYA 1MC3A 2BO6A 2RITA 1VGTA 3U2TA 2E3DA 1ZIZA 3Q7UA 4FCEA 1H5SB 3ZGGA 3U0XA 1HM0A 3EE5A 1NMMB 3RMVA 3OGZA 2VXMA 3K8DA 5C3AA 2FYCB 2ICYA 1INIA 1R80A 5HS2A 1H3MA 1LZ0A 2RJ4A 5C4DA 5C1HA 4NANA 4FREA 2RIXA 2AESA 2JCOA 4B4MA 1R7YA 3I0EA 2GGQA 2FFUA 2Q4JA 3OAMA 3CKNA 1ZI4A 2Y4JA 1EYRA 1WT1A 1LL0A 1WT2A 1ZDGA 4HO4A 1VZTA 1H7EA 4HO6A 4Y7GA 4KXOA 1WSZA 1H5SA 1XHBA 3TZTA 1V82A 2MZBA 1O7OA 3R3IA 4HO0A 1FR9A 2QKXA 4KC1A 1NQIB 1NF5B 4MYBA 1GA8A 1WT0A 4Y63A 5CMFX 3BCVA 4J18A 1ZDFA 4ZDQA 5FUHA 2D0JA 4AAWA 2UX8A 3CKVA 4EEGA 1G23A 2W0WA 1W55A 4M4KA 3ST8A 2OEGA 2YC5A 2VSIA 2ICXA 1R7XA 4D11A 4FROA 1PZYB 3SXEA 4DDZA 5AJPA 4JISA 1O0RA 3OC9A 4KQLA 2QGIA 1JV1A 2I5KA 3ZLLA 2ZU9A 5CQPA 1GX4A 4IRQA 5FYEA 3FWWA 4AYJA 1R82A 4FRAA 3V0LA 1VPAA 1G8OA 1R81A 3E26A 5C1LA 2YCMA 3LW6A 3KIAA 2WVMA 1H7FA 1V83A 1VZUA 5L6SA 3Q4SA 4EEAA 4Y7FA 3CKQA 2FYBA 3DJ4A 2Z87A 3V91A 1HJJA 4LW3A 5I1FA 5FTVA 1H4CA 3DUVA 3SPTA 2XWMA 2RJ7A 2VSHA 1LZ7A 1FG5N 2AECA 3U2WA 5C49A 4C2SA 1HJLA 3IOIA 2RJ5A 3O3PA 2D7IA 3I0HA 1LZIA 4CJCA 1IINA 4M2AA 3I0LA 4XWIA 4B2XA 1VGUA 4FRBA 2A8UA 4Y7TA 1QWJA 2FYDB 1G97A 4M2BA 5C4BA 3IOJA 5EJ1A 1ZJ0A 1OMXA 5CMIA 5FU8A 2RJ0A 2D7RA 3T7NA 5BXCA 2XMEA 2JCJA 2PX7A 3OH1A 3RSBA 1ZCTA 1NWGB 4B2WA 3SX7A 2QH5A 1QGSA 1WT3A 2VS3A 5C3BA 1TZFA 2PA4A 1SS9A 5C4FA 3IOHA 2WAWA 3V0NA 4EVWA 2O1FA 2WEEA 5CQNX 3V8ZA 2FFVA 2WVKA 4B3UA 2AM5A 5FU0A 5AJOA 4HO9A 1H7HA 4B4BA 3K8EA 2E8BA 3GUEA 4HO2A 4GBPA 4KRVA 2YC3A 2YESA 2I5EA 4B5BA 1FGGA 4E1KA 4CJBA 2NXVA 1VGWA 1S4PA 3F1YA 4NAIA 1ZJ3A 2XWNA 1LVWA 4EE3A 2Y6PA 3OH2A 3R2WA 5C47A 2Y4KA 1S4OA 3F1CA 1NHEB 2RJ8A 4EE5A 4KT7A 4DE7A 1HV9A 2XWLA 1G3LA 1VH3A 4G3PA 3SX3A 5C38A 2PGVA 2OEFA 3U2XA 2OI5A 2RIZA 2YQHA 1FGXA 1XZ6A 1O23B 2P6WA 1HM8A 1V84A 2O1GA 1FRWA 1S4NA 1R7TA 2FY7A 1LL3A 5CMGX 1H5SC 3V0OA 3OH3A 1NKHB 1ZI3A 4NAKA 1G9RA 2YQSA 3Q80A 4BQHA 1GQCA 1H5SD 1O7QA 4UEGA 1YP2A 1ZJ2A 1H7GA 1OQMB 1ZJOA 4Y6NA 1TW5A 3DK5A 3OH4A 3JTJA 3ZF8A 1G2VA 2WGZA 4D0ZA 3FOQA 4KPZA 2VXLA 5C36A 5EIYA 4D11C 5CMJA 2A8WA 2P72A 2XMHA 1QGQA 1TVYA 1YP3A 4ASJA 4CJ8A 5L6VA 1YROB 5C8RA 4HO5A 1VZXA 2BO8A 3SX5A 2JCKA 1OMZA 5EJZA 3SXGA 1VGZA 5C48A 1G1LA 2ZU7A 1YP4A 3PKQA 1H7QA 4P02A 2AE7A 1R7VA 2VD4A 1G0RA 4L41C 2OI6A 1W57A 1FXOA 1ZHJA 3N9WA 3USRA 1MP5A
chains in the Genus database with same CATH superfamily
3ZLKA 1GWWA 4G87A 1VICA 4Q7CA 4AC3A 5CMHA 4FRQA 4CVHA 3CU0A 4G3QA 5IFYA 1INJA 3V0MA 2X65A 3T7OA 1MP3A 1JV3A 3PNNA 2WVLA 1GX0A 5J49A 1ZCYA 4IRPA 4Y64A 3U2UA 1K4VA 2FYAA 2BO7A 3OH0A 1FOAA 1FZWA 4EEMA 3I0JA 3U2VA 5IDSA 4EE4A 3SXAA 3I0CA 1LZJA 3U0YA 4G3SA 1GWVA 4Y6UA 4FRLA 2DPWA 3RMWA 4FQWA 3SXDA 3HL3A 3CKJA 1R7UA 4FRMA 5C4EA 3TQDA 1W77A 3ZGFA 3V0QA 2AM3A 5C3DA 4YS8A 2V0HA 1TW1A 3JUKA 5JQQA 4FRDA 2X5SA 1H7LA 1EZIA 2RJ1A 4LW6A 4O6MA 4JD0A 4O6NA 2JCLA 3CKOA 1VM8A 2RJ6A 1H5RB 1IIMA 1I52A 4KNRA 2OI7A 3SXBA 1JYKA 4NALA 4KC2A 4ARWA 3PKPA 3SX8A 2X5ZA 1FO8A 4Y7VA 2AH9A 1HM9A 2Z86A 2WE9A 4AYLA 2ZU8A 1VH1A 4EEOA 3D8VA 1ZJ1A 1KWSA 4B4GA 2GGOA 3JUJA 5CQLX 3V0PA 3OKRA 3D5NA 3I0DA 4FCUA 4R7PA 4DECA 5CQOA 3I0KA 1MP4A 4FRHA 3NGWA 2V0IA 2Y4MA 1H4DA 2P73A 5AJNA 1H5RA 1FXJA 1ON6A 4FRPA 3I0GA 2BO4A 5IDTA 2VS5A 4HOCA 3V90A 1JVDA 2VS4A 4P00A 2X60A 2YQCA 3E25A 1ZCVA 4KC4A 1ZI1A 2AM4A 1FWYA 4HG6A 1G95A 2O1HA 1WVCA 3BRKX 2APCA 1FR8A 4HO3A 1H7TA 1PZTA 5FV9A 1JVGA 1H5TB 1JYLA 1ZI5A 1FO9A 1LL2A 5DDTA 5FTSA 2W0VA 2AGDA 2PGYA 4HCQA 4HO8A 3T7MA 3CGXA 3SXCA 3USQA 3V8YA 4Y7UA 4K6RA 4KPXA 5C1GA 3I0IX 3QVBA 2RIYA 4Y9XA 1ON8A 2C0NA 2V0KA 2Y4LA 3I0FA 5DDVA 2I7BA 4BMAA 5C4CA 4Y62A 2RJ9A 4MNDA 1H4EA 2YQJA 5CQMX 1ZCUA 1ZJPA 4D0TA 1G93A 1QG8A 2CU2A 2VFZA 2V0JA 1GQ9A 4B42A 4KNXA 1E5KA 1H5TA 1Z90A 4ECMA 2Y7AA 2V0LA 4M28A 4D48A 3D98A 3POLA 4ASYA 1MC3A 2BO6A 2RITA 1VGTA 3U2TA 2E3DA 1ZIZA 3Q7UA 4FCEA 1H5SB 3ZGGA 3U0XA 1HM0A 3EE5A 1NMMB 3RMVA 3OGZA 2VXMA 3K8DA 5C3AA 2FYCB 2ICYA 1INIA 1R80A 5HS2A 1H3MA 1LZ0A 2RJ4A 5C4DA 5C1HA 4NANA 4FREA 2RIXA 2AESA 2JCOA 4B4MA 1R7YA 3I0EA 2GGQA 2FFUA 2Q4JA 3OAMA 3CKNA 1ZI4A 2Y4JA 1EYRA 1WT1A 1LL0A 1WT2A 1ZDGA 4HO4A 1VZTA 1H7EA 4HO6A 4Y7GA 4KXOA 1WSZA 1H5SA 1XHBA 3TZTA 1V82A 2MZBA 1O7OA 3R3IA 4HO0A 1FR9A 2QKXA 4KC1A 1NQIB 1NF5B 4MYBA 1GA8A 1WT0A 4Y63A 5CMFX 3BCVA 4J18A 1ZDFA 4ZDQA 5FUHA 2D0JA 5D92A 4AAWA 2UX8A 3CKVA 4EEGA 1G23A 2W0WA 1W55A 4M4KA 3ST8A 2OEGA 2YC5A 2VSIA 2ICXA 1R7XA 4D11A 4FROA 1PZYB 2J0BA 3SXEA 5AJPA 4DDZA 4JISA 1O0RA 3OC9A 4KQLA 2QGIA 1JV1A 2I5KA 3ZLLA 2ZU9A 5CQPA 1GX4A 4IRQA 5FYEA 3FWWA 4AYJA 1R82A 2VK9A 4FRAA 3V0LA 1VPAA 1G8OA 1R81A 3E26A 5C1LA 2YCMA 3LW6A 3KIAA 2WVMA 1H7FA 1V83A 1VZUA 5L6SA 3Q4SA 4EEAA 4Y7FA 3CKQA 5D91A 2FYBA 3DJ4A 2Z87A 3V91A 1HJJA 4LW3A 5I1FA 5FTVA 1H4CA 3DUVA 3SPTA 2XWMA 2RJ7A 4FIXA 2VSHA 1LZ7A 1FG5N 2AECA 3U2WA 5C49A 4C2SA 1HJLA 3IOIA 2RJ5A 3O3PA 2D7IA 3I0HA 1LZIA 4CJCA 1IINA 4M2AA 3I0LA 4XWIA 4B2XA 1VGUA 4FRBA 2A8UA 4Y7TA 1QWJA 2FYDB 1G97A 4M2BA 5C4BA 3IOJA 5EJ1A 1ZJ0A 1OMXA 5CMIA 5FU8A 2RJ0A 2D7RA 3T7NA 5BXCA 2XMEA 2JCJA 2PX7A 3OH1A 3RSBA 1ZCTA 1NWGB 4B2WA 3SX7A 2QH5A 1QGSA 1WT3A 2VS3A 5C3BA 1TZFA 2PA4A 4FIYA 1SS9A 5C4FA 3IOHA 2WAWA 3V0NA 4EVWA 2O1FA 2WEEA 5CQNX 3V8ZA 2FFVA 2WVKA 4B3UA 2AM5A 5FU0A 5AJOA 4HO9A 1H7HA 4B4BA 3K8EA 2E8BA 3GUEA 4HO2A 4GBPA 4KRVA 2YC3A 2YESA 2I5EA 4B5BA 1FGGA 4E1KA 4CJBA 2NXVA 1VGWA 1S4PA 3F1YA 4NAIA 1ZJ3A 2XWNA 1LVWA 4EE3A 2Y6PA 3OH2A 3R2WA 5C47A 2Y4KA 1S4OA 3F1CA 1NHEB 2RJ8A 4EE5A 4KT7A 4DE7A 1HV9A 2XWLA 1G3LA 1VH3A 4G3PA 3SX3A 5C38A 2PGVA 2OEFA 3U2XA 2OI5A 2RIZA 2YQHA 1FGXA 1XZ6A 1O23B 2P6WA 1HM8A 1V84A 2O1GA 1FRWA 1S4NA 1R7TA 2FY7A 1LL3A 5CMGX 1H5SC 3V0OA 3OH3A 1NKHB 1ZI3A 4NAKA 1G9RA 2YQSA 3Q80A 4BQHA 1GQCA 1H5SD 1O7QA 4UEGA 1YP2A 1ZJ2A 1H7GA 1OQMB 1ZJOA 4Y6NA 1TW5A 3DK5A 3OH4A 3JTJA 3ZF8A 1G2VA 2WGZA 2J0AA 4D0ZA 3FOQA 4KPZA 2VXLA 5C36A 5EIYA 4D11C 5CMJA 2A8WA 2P72A 2XMHA 1QGQA 1TVYA 1YP3A 4ASJA 4CJ8A 5L6VA 1YROB 5C8RA 4HO5A 1VZXA 2BO8A 3SX5A 2JCKA 1OMZA 5EJZA 3SXGA 1VGZA 5C48A 1G1LA 2ZU7A 1YP4A 3PKQA 1H7QA 4P02A 2AE7A 1R7VA 2VD4A 1G0RA 4L41C 2OI6A 1W57A 1FXOA 1ZHJA 3N9WA 3USRA 4MIXA 1MP5A
chains in the Genus database with same CATH topology
3ZLKA 1GWWA 4G87A 1VICA 4Q7CA 4AC3A 5CMHA 4FRQA 4CVHA 3CU0A 4G3QA 5IFYA 1INJA 3V0MA 2X65A 3T7OA 1MP3A 1JV3A 3PNNA 2WVLA 1GX0A 5J49A 1ZCYA 4IRPA 4Y64A 3U2UA 1K4VA 2FYAA 2BO7A 3OH0A 1FOAA 1FZWA 4EEMA 3I0JA 3U2VA 5IDSA 4EE4A 3SXAA 3I0CA 1LZJA 3U0YA 4G3SA 1GWVA 4Y6UA 4FRLA 2DPWA 3RMWA 4FQWA 3SXDA 3HL3A 3CKJA 1R7UA 4FRMA 5C4EA 3TQDA 1W77A 3ZGFA 3V0QA 2AM3A 5C3DA 4YS8A 2V0HA 1TW1A 3JUKA 5JQQA 4FRDA 2X5SA 1H7LA 1EZIA 2RJ1A 4LW6A 4O6MA 4JD0A 4O6NA 2JCLA 3CKOA 1VM8A 2RJ6A 1H5RB 1IIMA 1I52A 4KNRA 2OI7A 3SXBA 1JYKA 4NALA 4KC2A 4ARWA 3PKPA 3SX8A 2X5ZA 1FO8A 4Y7VA 2AH9A 1HM9A 2Z86A 2WE9A 4AYLA 2ZU8A 1VH1A 4EEOA 3D8VA 1ZJ1A 1KWSA 4B4GA 2GGOA 3JUJA 5CQLX 3V0PA 3OKRA 3D5NA 3I0DA 4FCUA 4R7PA 4DECA 5CQOA 3I0KA 1MP4A 4FRHA 3NGWA 2V0IA 2Y4MA 1H4DA 2P73A 5AJNA 1H5RA 1FXJA 1ON6A 4FRPA 3I0GA 2BO4A 5IDTA 2VS5A 4HOCA 3V90A 1JVDA 2VS4A 4P00A 2X60A 2YQCA 3E25A 1ZCVA 4KC4A 1ZI1A 2AM4A 1FWYA 4HG6A 1G95A 2O1HA 1WVCA 3BRKX 2APCA 1FR8A 4HO3A 1H7TA 1PZTA 5FV9A 1JVGA 1H5TB 1JYLA 1ZI5A 1FO9A 1LL2A 5DDTA 5FTSA 2W0VA 2AGDA 2PGYA 4HCQA 4HO8A 3T7MA 3CGXA 3SXCA 3USQA 3V8YA 4Y7UA 4K6RA 4KPXA 5C1GA 3I0IX 3QVBA 2RIYA 4Y9XA 1ON8A 2C0NA 2V0KA 2Y4LA 3I0FA 5DDVA 2I7BA 4BMAA 5C4CA 4Y62A 2RJ9A 4MNDA 1H4EA 2YQJA 5CQMX 1ZCUA 1ZJPA 4D0TA 1G93A 1QG8A 2CU2A 2VFZA 2V0JA 1GQ9A 4B42A 4KNXA 1E5KA 1H5TA 1Z90A 4ECMA 2Y7AA 2V0LA 4M28A 4D48A 3D98A 3POLA 4ASYA 1MC3A 2BO6A 2RITA 1VGTA 3U2TA 2E3DA 1ZIZA 3Q7UA 4FCEA 1H5SB 3ZGGA 3U0XA 1HM0A 3EE5A 1NMMB 3RMVA 3OGZA 2VXMA 3K8DA 5C3AA 2FYCB 2ICYA 1INIA 1R80A 5HS2A 1H3MA 1LZ0A 2RJ4A 5C4DA 5C1HA 4NANA 4FREA 2RIXA 2AESA 2JCOA 4B4MA 1R7YA 3I0EA 2GGQA 2FFUA 2Q4JA 3OAMA 3CKNA 1ZI4A 2Y4JA 1EYRA 1WT1A 1LL0A 1WT2A 1ZDGA 4HO4A 1VZTA 1H7EA 4HO6A 4Y7GA 4KXOA 1WSZA 1H5SA 1XHBA 3TZTA 1V82A 2MZBA 1O7OA 3R3IA 4HO0A 1FR9A 2QKXA 4KC1A 1NQIB 1NF5B 4MYBA 1GA8A 1WT0A 4Y63A 5CMFX 3BCVA 4J18A 1ZDFA 4ZDQA 5FUHA 2D0JA 5D92A 4AAWA 2UX8A 3CKVA 4EEGA 1G23A 2W0WA 1W55A 4M4KA 3ST8A 2OEGA 2YC5A 2VSIA 2ICXA 1R7XA 4D11A 4FROA 1PZYB 2J0BA 3SXEA 5AJPA 4DDZA 4JISA 1O0RA 3OC9A 4KQLA 2QGIA 1JV1A 2I5KA 3ZLLA 2ZU9A 5CQPA 1GX4A 4IRQA 5FYEA 3FWWA 4AYJA 1R82A 2VK9A 4FRAA 3V0LA 1VPAA 1G8OA 1R81A 3E26A 5C1LA 2YCMA 3LW6A 3KIAA 2WVMA 1H7FA 1V83A 1VZUA 5L6SA 3Q4SA 4EEAA 4Y7FA 3CKQA 5D91A 2FYBA 3DJ4A 2Z87A 3V91A 1HJJA 4LW3A 5I1FA 5FTVA 1H4CA 3DUVA 3SPTA 2XWMA 2RJ7A 4FIXA 2VSHA 1LZ7A 1FG5N 2AECA 3U2WA 5C49A 4C2SA 1HJLA 3IOIA 2RJ5A 3O3PA 2D7IA 3I0HA 1LZIA 4CJCA 1IINA 4M2AA 3I0LA 4XWIA 4B2XA 1VGUA 4FRBA 2A8UA 4Y7TA 1QWJA 2FYDB 1G97A 4M2BA 5C4BA 3IOJA 5EJ1A 1ZJ0A 1OMXA 5CMIA 5FU8A 2RJ0A 2D7RA 3T7NA 5BXCA 2XMEA 2JCJA 2PX7A 3OH1A 3RSBA 1ZCTA 1NWGB 4B2WA 3SX7A 2QH5A 1QGSA 1WT3A 2VS3A 5C3BA 1TZFA 2PA4A 4FIYA 1SS9A 5C4FA 3IOHA 2WAWA 3V0NA 4EVWA 2O1FA 2WEEA 5CQNX 3V8ZA 2FFVA 2WVKA 4B3UA 2AM5A 5FU0A 5AJOA 4HO9A 1H7HA 4B4BA 3K8EA 2E8BA 3GUEA 4HO2A 4GBPA 4KRVA 2YC3A 2YESA 2I5EA 4B5BA 1FGGA 4E1KA 4CJBA 2NXVA 1VGWA 1S4PA 3F1YA 4NAIA 1ZJ3A 2XWNA 1LVWA 4EE3A 2Y6PA 3OH2A 3R2WA 5C47A 2Y4KA 1S4OA 3F1CA 1NHEB 2RJ8A 4EE5A 4KT7A 4DE7A 1HV9A 2XWLA 1G3LA 1VH3A 4G3PA 3SX3A 5C38A 2PGVA 2OEFA 3U2XA 2OI5A 2RIZA 2YQHA 1FGXA 1XZ6A 1O23B 2P6WA 1HM8A 1V84A 2O1GA 1FRWA 1S4NA 1R7TA 2FY7A 1LL3A 5CMGX 1H5SC 3V0OA 3OH3A 1NKHB 1ZI3A 4NAKA 1G9RA 2YQSA 3Q80A 4BQHA 1GQCA 1H5SD 1O7QA 4UEGA 1YP2A 1ZJ2A 1H7GA 1OQMB 1ZJOA 4Y6NA 1TW5A 3DK5A 3OH4A 3JTJA 3ZF8A 1G2VA 2WGZA 2J0AA 4D0ZA 3FOQA 4KPZA 2VXLA 5C36A 5EIYA 4D11C 5CMJA 2A8WA 2P72A 2XMHA 1QGQA 1TVYA 1YP3A 4ASJA 4CJ8A 5L6VA 1YROB 5C8RA 4HO5A 1VZXA 2BO8A 3SX5A 2JCKA 1OMZA 5EJZA 3SXGA 1VGZA 5C48A 1G1LA 2ZU7A 1YP4A 3PKQA 1H7QA 4P02A 2AE7A 1R7VA 2VD4A 1G0RA 4L41C 2OI6A 1W57A 1FXOA 1ZHJA 3N9WA 3USRA 4MIXA 1MP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLK A;  1GWW A;  4G87 A;  1VIC A;  4AC3 A;  5CMH A;  4FRQ A;  4CVH A;  3CU0 A;  4G3Q A;  5IFY A;  1INJ A;  3V0M A;  2X65 A;  3T7O A;  1MP3 A;  1JV3 A;  3PNN A;  2WVL A;  1GX0 A;  5J49 A;  1ZCY A;  4IRP A;  4Y64 A;  3U2U A;  1K4V A;  2FYA A;  2BO7 A;  3OH0 A;  1FOA A;  1FZW A;  4EEM A;  3I0J A;  3U2V A;  5IDS A;  4EE4 A;  3SXA A;  3I0C A;  1LZJ A;  3U0Y A;  4G3S A;  1GWV A;  4Y6U A;  4FRL A;  2DPW A;  3RMW A;  4FQW A;  3SXD A;  3HL3 A;  3CKJ A;  1R7U A;  4FRM A;  5C4E A;  3TQD A;  1W77 A;  3ZGF A;  3V0Q A;  2AM3 A;  5C3D A;  4YS8 A;  2V0H A;  1TW1 A;  3JUK A;  5JQQ A;  4FRD A;  2X5S A;  1H7L A;  1EZI A;  2RJ1 A;  4LW6 A;  4JD0 A;  2JCL A;  3CKO A;  1VM8 A;  2RJ6 A;  1H5R B;  1IIM A;  1I52 A;  4KNR A;  2OI7 A;  3SXB A;  1JYK A;  4NAL A;  4KC2 A;  4ARW A;  3PKP A;  3SX8 A;  2X5Z A;  1FO8 A;  4Y7V A;  2AH9 A;  1HM9 A;  2Z86 A;  2WE9 A;  4AYL A;  2ZU8 A;  1VH1 A;  4EEO A;  3D8V A;  1ZJ1 A;  1KWS A;  4B4G A;  2GGO A;  3JUJ A;  5CQL X;  3V0P A;  3OKR A;  3D5N A;  3I0D A;  4FCU A;  4R7P A;  4DEC A;  5CQO A;  3I0K A;  1MP4 A;  4FRH A;  3NGW A;  2V0I A;  2Y4M A;  1H4D A;  2P73 A;  5AJN A;  1H5R A;  1FXJ A;  1ON6 A;  4FRP A;  3I0G A;  2BO4 A;  5IDT A;  2VS5 A;  4HOC A;  3V90 A;  1JVD A;  2VS4 A;  4P00 A;  2X60 A;  2YQC A;  3E25 A;  1ZCV A;  4KC4 A;  1ZI1 A;  2AM4 A;  1FWY A;  4HG6 A;  1G95 A;  2O1H A;  1WVC A;  3BRK X;  2APC A;  1FR8 A;  4HO3 A;  1H7T A;  1PZT A;  5FV9 A;  1JVG A;  1H5T B;  1JYL A;  1ZI5 A;  1FO9 A;  1LL2 A;  5DDT A;  5FTS A;  2W0V A;  2AGD A;  2PGY A;  4HCQ A;  4HO8 A;  3T7M A;  3CGX A;  3SXC A;  3USQ A;  3V8Y A;  4Y7U A;  4K6R A;  4KPX A;  5C1G A;  3I0I X;  3QVB A;  2RIY A;  4Y9X A;  1ON8 A;  2V0K A;  2Y4L A;  3I0F A;  5DDV A;  2I7B A;  4BMA A;  5C4C A;  4Y62 A;  2RJ9 A;  4MND A;  1H4E A;  2YQJ A;  5CQM X;  1ZCU A;  1ZJP A;  4D0T A;  1G93 A;  1QG8 A;  2CU2 A;  2VFZ A;  2V0J A;  1GQ9 A;  4B42 A;  4KNX A;  1E5K A;  1H5T A;  1Z90 A;  4ECM A;  2Y7A A;  2V0L A;  4M28 A;  4D48 A;  3D98 A;  3POL A;  4ASY A;  1MC3 A;  2BO6 A;  2RIT A;  1VGT A;  3U2T A;  2E3D A;  1ZIZ A;  3Q7U A;  4FCE A;  1H5S B;  3ZGG A;  3U0X A;  1HM0 A;  3EE5 A;  1NMM B;  3RMV A;  3OGZ A;  2VXM A;  3K8D A;  5C3A A;  2FYC B;  2ICY A;  1INI A;  1R80 A;  5HS2 A;  1H3M A;  1LZ0 A;  2RJ4 A;  5C4D A;  5C1H A;  4NAN A;  4FRE A;  2RIX A;  2AES A;  2JCO A;  4B4M A;  1R7Y A;  3I0E A;  2GGQ A;  2FFU A;  2Q4J A;  3OAM A;  3CKN A;  1ZI4 A;  2Y4J A;  1EYR A;  1WT1 A;  1LL0 A;  1WT2 A;  1ZDG A;  4HO4 A;  1VZT A;  1H7E A;  4HO6 A;  4Y7G A;  4KXO A;  1WSZ A;  1H5S A;  1XHB A;  3TZT A;  1V82 A;  2MZB A;  1O7O A;  3R3I A;  4HO0 A;  1FR9 A;  2QKX A;  4KC1 A;  1NQI B;  1NF5 B;  4MYB A;  1GA8 A;  1WT0 A;  4Y63 A;  5CMF X;  3BCV A;  4J18 A;  1ZDF A;  4ZDQ A;  5FUH A;  2D0J A;  4AAW A;  2UX8 A;  3CKV A;  4EEG A;  1G23 A;  2W0W A;  1W55 A;  4M4K A;  3ST8 A;  2OEG A;  2YC5 A;  2VSI A;  2ICX A;  1R7X A;  4D11 A;  4FRO A;  1PZY B;  3SXE A;  4DDZ A;  5AJP A;  4JIS A;  1O0R A;  3OC9 A;  4KQL A;  2QGI A;  1JV1 A;  2I5K A;  3ZLL A;  2ZU9 A;  5CQP A;  1GX4 A;  4IRQ A;  5FYE A;  3FWW A;  4AYJ A;  1R82 A;  4FRA A;  3V0L A;  1VPA A;  1G8O A;  1R81 A;  3E26 A;  5C1L A;  2YCM A;  3LW6 A;  3KIA A;  2WVM A;  1H7F A;  1V83 A;  1VZU A;  5L6S A;  3Q4S A;  4EEA A;  4Y7F A;  3CKQ A;  2FYB A;  3DJ4 A;  2Z87 A;  3V91 A;  1HJJ A;  4LW3 A;  5I1F A;  5FTV A;  1H4C A;  3DUV A;  3SPT A;  2XWM A;  2RJ7 A;  2VSH A;  1LZ7 A;  1FG5 N;  2AEC A;  3U2W A;  5C49 A;  4C2S A;  1HJL A;  3IOI A;  2RJ5 A;  3O3P A;  2D7I A;  3I0H A;  1LZI A;  4CJC A;  1IIN A;  4M2A A;  3I0L A;  4XWI A;  4B2X A;  1VGU A;  4FRB A;  2A8U A;  4Y7T A;  1QWJ A;  2FYD B;  1G97 A;  4M2B A;  5C4B A;  3IOJ A;  5EJ1 A;  1ZJ0 A;  1OMX A;  5CMI A;  5FU8 A;  2RJ0 A;  2D7R A;  3T7N A;  5BXC A;  2XME A;  2JCJ A;  2PX7 A;  3OH1 A;  3RSB A;  1ZCT A;  1NWG B;  4B2W A;  3SX7 A;  2QH5 A;  1QGS A;  1WT3 A;  2VS3 A;  5C3B A;  1TZF A;  2PA4 A;  1SS9 A;  5C4F A;  3IOH A;  2WAW A;  3V0N A;  4EVW A;  2O1F A;  2WEE A;  5CQN X;  3V8Z A;  2FFV A;  2WVK A;  4B3U A;  2AM5 A;  5FU0 A;  5AJO A;  4HO9 A;  1H7H A;  4B4B A;  3K8E A;  2E8B A;  3GUE A;  4HO2 A;  4GBP A;  4KRV A;  2YC3 A;  2YES A;  2I5E A;  4B5B A;  1FGG A;  4E1K A;  4CJB A;  2NXV A;  1VGW A;  1S4P A;  3F1Y A;  4NAI A;  1ZJ3 A;  2XWN A;  1LVW A;  4EE3 A;  2Y6P A;  3OH2 A;  3R2W A;  5C47 A;  2Y4K A;  1S4O A;  3F1C A;  1NHE B;  2RJ8 A;  4EE5 A;  4KT7 A;  4DE7 A;  1HV9 A;  2XWL A;  1G3L A;  1VH3 A;  4G3P A;  3SX3 A;  5C38 A;  2PGV A;  2OEF A;  3U2X A;  2OI5 A;  2RIZ A;  2YQH A;  1FGX A;  1XZ6 A;  1O23 B;  2P6W A;  1HM8 A;  1V84 A;  2O1G A;  1FRW A;  1S4N A;  1R7T A;  2FY7 A;  1LL3 A;  5CMG X;  1H5S C;  3V0O A;  3OH3 A;  1NKH B;  1ZI3 A;  4NAK A;  1G9R A;  2YQS A;  3Q80 A;  4BQH A;  1GQC A;  1H5S D;  1O7Q A;  4UEG A;  1YP2 A;  1ZJ2 A;  1H7G A;  1OQM B;  1ZJO A;  4Y6N A;  1TW5 A;  3DK5 A;  3OH4 A;  3JTJ A;  3ZF8 A;  1G2V A;  2WGZ A;  4D0Z A;  3FOQ A;  4KPZ A;  2VXL A;  5C36 A;  5EIY A;  4D11 C;  5CMJ A;  2A8W A;  2P72 A;  2XMH A;  1QGQ A;  1TVY A;  1YP3 A;  4ASJ A;  4CJ8 A;  5L6V A;  1YRO B;  5C8R A;  4HO5 A;  1VZX A;  2BO8 A;  3SX5 A;  2JCK A;  1OMZ A;  5EJZ A;  3SXG A;  1VGZ A;  5C48 A;  1G1L A;  2ZU7 A;  1YP4 A;  3PKQ A;  1H7Q A;  4P02 A;  2AE7 A;  1R7V A;  2VD4 A;  1G0R A;  4L41 C;  2OI6 A;  1W57 A;  1FXO A;  1ZHJ A;  3N9W A;  3USR A;  1MP5 A; 
#chains in the Genus database with same CATH topology
 3ZLK A;  1GWW A;  4G87 A;  1VIC A;  4Q7C A;  4AC3 A;  5CMH A;  4FRQ A;  4CVH A;  3CU0 A;  4G3Q A;  5IFY A;  1INJ A;  3V0M A;  2X65 A;  3T7O A;  1MP3 A;  1JV3 A;  3PNN A;  2WVL A;  1GX0 A;  5J49 A;  1ZCY A;  4IRP A;  4Y64 A;  3U2U A;  1K4V A;  2FYA A;  2BO7 A;  3OH0 A;  1FOA A;  1FZW A;  4EEM A;  3I0J A;  3U2V A;  5IDS A;  4EE4 A;  3SXA A;  3I0C A;  1LZJ A;  3U0Y A;  4G3S A;  1GWV A;  4Y6U A;  4FRL A;  2DPW A;  3RMW A;  4FQW A;  3SXD A;  3HL3 A;  3CKJ A;  1R7U A;  4FRM A;  5C4E A;  3TQD A;  1W77 A;  3ZGF A;  3V0Q A;  2AM3 A;  5C3D A;  4YS8 A;  2V0H A;  1TW1 A;  3JUK A;  5JQQ A;  4FRD A;  2X5S A;  1H7L A;  1EZI A;  2RJ1 A;  4LW6 A;  4O6M A;  4JD0 A;  4O6N A;  2JCL A;  3CKO A;  1VM8 A;  2RJ6 A;  1H5R B;  1IIM A;  1I52 A;  4KNR A;  2OI7 A;  3SXB A;  1JYK A;  4NAL A;  4KC2 A;  4ARW A;  3PKP A;  3SX8 A;  2X5Z A;  1FO8 A;  4Y7V A;  2AH9 A;  1HM9 A;  2Z86 A;  2WE9 A;  4AYL A;  2ZU8 A;  1VH1 A;  4EEO A;  3D8V A;  1ZJ1 A;  1KWS A;  4B4G A;  2GGO A;  3JUJ A;  5CQL X;  3V0P A;  3OKR A;  3D5N A;  3I0D A;  4FCU A;  4R7P A;  4DEC A;  5CQO A;  3I0K A;  1MP4 A;  4FRH A;  3NGW A;  2V0I A;  2Y4M A;  1H4D A;  2P73 A;  5AJN A;  1H5R A;  1FXJ A;  1ON6 A;  4FRP A;  3I0G A;  2BO4 A;  5IDT A;  2VS5 A;  4HOC A;  3V90 A;  1JVD A;  2VS4 A;  4P00 A;  2X60 A;  2YQC A;  3E25 A;  1ZCV A;  4KC4 A;  1ZI1 A;  2AM4 A;  1FWY A;  4HG6 A;  1G95 A;  2O1H A;  1WVC A;  3BRK X;  2APC A;  1FR8 A;  4HO3 A;  1H7T A;  1PZT A;  5FV9 A;  1JVG A;  1H5T B;  1JYL A;  1ZI5 A;  1FO9 A;  1LL2 A;  5DDT A;  5FTS A;  2W0V A;  2AGD A;  2PGY A;  4HCQ A;  4HO8 A;  3T7M A;  3CGX A;  3SXC A;  3USQ A;  3V8Y A;  4Y7U A;  4K6R A;  4KPX A;  5C1G A;  3I0I X;  3QVB A;  2RIY A;  4Y9X A;  1ON8 A;  2C0N A;  2V0K A;  2Y4L A;  3I0F A;  5DDV A;  2I7B A;  4BMA A;  5C4C A;  4Y62 A;  2RJ9 A;  4MND A;  1H4E A;  2YQJ A;  5CQM X;  1ZCU A;  1ZJP A;  4D0T A;  1G93 A;  1QG8 A;  2CU2 A;  2VFZ A;  2V0J A;  1GQ9 A;  4B42 A;  4KNX A;  1E5K A;  1H5T A;  1Z90 A;  4ECM A;  2Y7A A;  2V0L A;  4M28 A;  4D48 A;  3D98 A;  3POL A;  4ASY A;  1MC3 A;  2BO6 A;  2RIT A;  1VGT A;  3U2T A;  2E3D A;  1ZIZ A;  3Q7U A;  4FCE A;  1H5S B;  3ZGG A;  3U0X A;  1HM0 A;  3EE5 A;  1NMM B;  3RMV A;  3OGZ A;  2VXM A;  3K8D A;  5C3A A;  2FYC B;  2ICY A;  1INI A;  1R80 A;  5HS2 A;  1H3M A;  1LZ0 A;  2RJ4 A;  5C4D A;  5C1H A;  4NAN A;  4FRE A;  2RIX A;  2AES A;  2JCO A;  4B4M A;  1R7Y A;  3I0E A;  2GGQ A;  2FFU A;  2Q4J A;  3OAM A;  3CKN A;  1ZI4 A;  2Y4J A;  1EYR A;  1WT1 A;  1LL0 A;  1WT2 A;  1ZDG A;  4HO4 A;  1VZT A;  1H7E A;  4HO6 A;  4Y7G A;  4KXO A;  1WSZ A;  1H5S A;  1XHB A;  3TZT A;  1V82 A;  2MZB A;  1O7O A;  3R3I A;  4HO0 A;  1FR9 A;  2QKX A;  4KC1 A;  1NQI B;  1NF5 B;  4MYB A;  1GA8 A;  1WT0 A;  4Y63 A;  5CMF X;  3BCV A;  4J18 A;  1ZDF A;  4ZDQ A;  5FUH A;  2D0J A;  5D92 A;  4AAW A;  2UX8 A;  3CKV A;  4EEG A;  1G23 A;  2W0W A;  1W55 A;  4M4K A;  3ST8 A;  2OEG A;  2YC5 A;  2VSI A;  2ICX A;  1R7X A;  4D11 A;  4FRO A;  1PZY B;  2J0B A;  3SXE A;  5AJP A;  4DDZ A;  4JIS A;  1O0R A;  3OC9 A;  4KQL A;  2QGI A;  1JV1 A;  2I5K A;  3ZLL A;  2ZU9 A;  5CQP A;  1GX4 A;  4IRQ A;  5FYE A;  3FWW A;  4AYJ A;  1R82 A;  2VK9 A;  4FRA A;  3V0L A;  1VPA A;  1G8O A;  1R81 A;  3E26 A;  5C1L A;  2YCM A;  3LW6 A;  3KIA A;  2WVM A;  1H7F A;  1V83 A;  1VZU A;  5L6S A;  3Q4S A;  4EEA A;  4Y7F A;  3CKQ A;  5D91 A;  2FYB A;  3DJ4 A;  2Z87 A;  3V91 A;  1HJJ A;  4LW3 A;  5I1F A;  5FTV A;  1H4C A;  3DUV A;  3SPT A;  2XWM A;  2RJ7 A;  4FIX A;  2VSH A;  1LZ7 A;  1FG5 N;  2AEC A;  3U2W A;  5C49 A;  4C2S A;  1HJL A;  3IOI A;  2RJ5 A;  3O3P A;  2D7I A;  3I0H A;  1LZI A;  4CJC A;  1IIN A;  4M2A A;  3I0L A;  4XWI A;  4B2X A;  1VGU A;  4FRB A;  2A8U A;  4Y7T A;  1QWJ A;  2FYD B;  1G97 A;  4M2B A;  5C4B A;  3IOJ A;  5EJ1 A;  1ZJ0 A;  1OMX A;  5CMI A;  5FU8 A;  2RJ0 A;  2D7R A;  3T7N A;  5BXC A;  2XME A;  2JCJ A;  2PX7 A;  3OH1 A;  3RSB A;  1ZCT A;  1NWG B;  4B2W A;  3SX7 A;  2QH5 A;  1QGS A;  1WT3 A;  2VS3 A;  5C3B A;  1TZF A;  2PA4 A;  4FIY A;  1SS9 A;  5C4F A;  3IOH A;  2WAW A;  3V0N A;  4EVW A;  2O1F A;  2WEE A;  5CQN X;  3V8Z A;  2FFV A;  2WVK A;  4B3U A;  2AM5 A;  5FU0 A;  5AJO A;  4HO9 A;  1H7H A;  4B4B A;  3K8E A;  2E8B A;  3GUE A;  4HO2 A;  4GBP A;  4KRV A;  2YC3 A;  2YES A;  2I5E A;  4B5B A;  1FGG A;  4E1K A;  4CJB A;  2NXV A;  1VGW A;  1S4P A;  3F1Y A;  4NAI A;  1ZJ3 A;  2XWN A;  1LVW A;  4EE3 A;  2Y6P A;  3OH2 A;  3R2W A;  5C47 A;  2Y4K A;  1S4O A;  3F1C A;  1NHE B;  2RJ8 A;  4EE5 A;  4KT7 A;  4DE7 A;  1HV9 A;  2XWL A;  1G3L A;  1VH3 A;  4G3P A;  3SX3 A;  5C38 A;  2PGV A;  2OEF A;  3U2X A;  2OI5 A;  2RIZ A;  2YQH A;  1FGX A;  1XZ6 A;  1O23 B;  2P6W A;  1HM8 A;  1V84 A;  2O1G A;  1FRW A;  1S4N A;  1R7T A;  2FY7 A;  1LL3 A;  5CMG X;  1H5S C;  3V0O A;  3OH3 A;  1NKH B;  1ZI3 A;  4NAK A;  1G9R A;  2YQS A;  3Q80 A;  4BQH A;  1GQC A;  1H5S D;  1O7Q A;  4UEG A;  1YP2 A;  1ZJ2 A;  1H7G A;  1OQM B;  1ZJO A;  4Y6N A;  1TW5 A;  3DK5 A;  3OH4 A;  3JTJ A;  3ZF8 A;  1G2V A;  2WGZ A;  2J0A A;  4D0Z A;  3FOQ A;  4KPZ A;  2VXL A;  5C36 A;  5EIY A;  4D11 C;  5CMJ A;  2A8W A;  2P72 A;  2XMH A;  1QGQ A;  1TVY A;  1YP3 A;  4ASJ A;  4CJ8 A;  5L6V A;  1YRO B;  5C8R A;  4HO5 A;  1VZX A;  2BO8 A;  3SX5 A;  2JCK A;  1OMZ A;  5EJZ A;  3SXG A;  1VGZ A;  5C48 A;  1G1L A;  2ZU7 A;  1YP4 A;  3PKQ A;  1H7Q A;  4P02 A;  2AE7 A;  1R7V A;  2VD4 A;  1G0R A;  4L41 C;  2OI6 A;  1W57 A;  1FXO A;  1ZHJ A;  3N9W A;  3USR A;  4MIX A;  1MP5 A; 
#chains in the Genus database with same CATH homology
 3ZLK A;  1GWW A;  4G87 A;  1VIC A;  4Q7C A;  4AC3 A;  5CMH A;  4FRQ A;  4CVH A;  3CU0 A;  4G3Q A;  5IFY A;  1INJ A;  3V0M A;  2X65 A;  3T7O A;  1MP3 A;  1JV3 A;  3PNN A;  2WVL A;  1GX0 A;  5J49 A;  1ZCY A;  4IRP A;  4Y64 A;  3U2U A;  1K4V A;  2FYA A;  2BO7 A;  3OH0 A;  1FOA A;  1FZW A;  4EEM A;  3I0J A;  3U2V A;  5IDS A;  4EE4 A;  3SXA A;  3I0C A;  1LZJ A;  3U0Y A;  4G3S A;  1GWV A;  4Y6U A;  4FRL A;  2DPW A;  3RMW A;  4FQW A;  3SXD A;  3HL3 A;  3CKJ A;  1R7U A;  4FRM A;  5C4E A;  3TQD A;  1W77 A;  3ZGF A;  3V0Q A;  2AM3 A;  5C3D A;  4YS8 A;  2V0H A;  1TW1 A;  3JUK A;  5JQQ A;  4FRD A;  2X5S A;  1H7L A;  1EZI A;  2RJ1 A;  4LW6 A;  4O6M A;  4JD0 A;  4O6N A;  2JCL A;  3CKO A;  1VM8 A;  2RJ6 A;  1H5R B;  1IIM A;  1I52 A;  4KNR A;  2OI7 A;  3SXB A;  1JYK A;  4NAL A;  4KC2 A;  4ARW A;  3PKP A;  3SX8 A;  2X5Z A;  1FO8 A;  4Y7V A;  2AH9 A;  1HM9 A;  2Z86 A;  2WE9 A;  4AYL A;  2ZU8 A;  1VH1 A;  4EEO A;  3D8V A;  1ZJ1 A;  1KWS A;  4B4G A;  2GGO A;  3JUJ A;  5CQL X;  3V0P A;  3OKR A;  3D5N A;  3I0D A;  4FCU A;  4R7P A;  4DEC A;  5CQO A;  3I0K A;  1MP4 A;  4FRH A;  3NGW A;  2V0I A;  2Y4M A;  1H4D A;  2P73 A;  5AJN A;  1H5R A;  1FXJ A;  1ON6 A;  4FRP A;  3I0G A;  2BO4 A;  5IDT A;  2VS5 A;  4HOC A;  3V90 A;  1JVD A;  2VS4 A;  4P00 A;  2X60 A;  2YQC A;  3E25 A;  1ZCV A;  4KC4 A;  1ZI1 A;  2AM4 A;  1FWY A;  4HG6 A;  1G95 A;  2O1H A;  1WVC A;  3BRK X;  2APC A;  1FR8 A;  4HO3 A;  1H7T A;  1PZT A;  5FV9 A;  1JVG A;  1H5T B;  1JYL A;  1ZI5 A;  1FO9 A;  1LL2 A;  5DDT A;  5FTS A;  2W0V A;  2AGD A;  2PGY A;  4HCQ A;  4HO8 A;  3T7M A;  3CGX A;  3SXC A;  3USQ A;  3V8Y A;  4Y7U A;  4K6R A;  4KPX A;  5C1G A;  3I0I X;  3QVB A;  2RIY A;  4Y9X A;  1ON8 A;  2C0N A;  2V0K A;  2Y4L A;  3I0F A;  5DDV A;  2I7B A;  4BMA A;  5C4C A;  4Y62 A;  2RJ9 A;  4MND A;  1H4E A;  2YQJ A;  5CQM X;  1ZCU A;  1ZJP A;  4D0T A;  1G93 A;  1QG8 A;  2CU2 A;  2VFZ A;  2V0J A;  1GQ9 A;  4B42 A;  4KNX A;  1E5K A;  1H5T A;  1Z90 A;  4ECM A;  2Y7A A;  2V0L A;  4M28 A;  4D48 A;  3D98 A;  3POL A;  4ASY A;  1MC3 A;  2BO6 A;  2RIT A;  1VGT A;  3U2T A;  2E3D A;  1ZIZ A;  3Q7U A;  4FCE A;  1H5S B;  3ZGG A;  3U0X A;  1HM0 A;  3EE5 A;  1NMM B;  3RMV A;  3OGZ A;  2VXM A;  3K8D A;  5C3A A;  2FYC B;  2ICY A;  1INI A;  1R80 A;  5HS2 A;  1H3M A;  1LZ0 A;  2RJ4 A;  5C4D A;  5C1H A;  4NAN A;  4FRE A;  2RIX A;  2AES A;  2JCO A;  4B4M A;  1R7Y A;  3I0E A;  2GGQ A;  2FFU A;  2Q4J A;  3OAM A;  3CKN A;  1ZI4 A;  2Y4J A;  1EYR A;  1WT1 A;  1LL0 A;  1WT2 A;  1ZDG A;  4HO4 A;  1VZT A;  1H7E A;  4HO6 A;  4Y7G A;  4KXO A;  1WSZ A;  1H5S A;  1XHB A;  3TZT A;  1V82 A;  2MZB A;  1O7O A;  3R3I A;  4HO0 A;  1FR9 A;  2QKX A;  4KC1 A;  1NQI B;  1NF5 B;  4MYB A;  1GA8 A;  1WT0 A;  4Y63 A;  5CMF X;  3BCV A;  4J18 A;  1ZDF A;  4ZDQ A;  5FUH A;  2D0J A;  5D92 A;  4AAW A;  2UX8 A;  3CKV A;  4EEG A;  1G23 A;  2W0W A;  1W55 A;  4M4K A;  3ST8 A;  2OEG A;  2YC5 A;  2VSI A;  2ICX A;  1R7X A;  4D11 A;  4FRO A;  1PZY B;  2J0B A;  3SXE A;  5AJP A;  4DDZ A;  4JIS A;  1O0R A;  3OC9 A;  4KQL A;  2QGI A;  1JV1 A;  2I5K A;  3ZLL A;  2ZU9 A;  5CQP A;  1GX4 A;  4IRQ A;  5FYE A;  3FWW A;  4AYJ A;  1R82 A;  2VK9 A;  4FRA A;  3V0L A;  1VPA A;  1G8O A;  1R81 A;  3E26 A;  5C1L A;  2YCM A;  3LW6 A;  3KIA A;  2WVM A;  1H7F A;  1V83 A;  1VZU A;  5L6S A;  3Q4S A;  4EEA A;  4Y7F A;  3CKQ A;  5D91 A;  2FYB A;  3DJ4 A;  2Z87 A;  3V91 A;  1HJJ A;  4LW3 A;  5I1F A;  5FTV A;  1H4C A;  3DUV A;  3SPT A;  2XWM A;  2RJ7 A;  4FIX A;  2VSH A;  1LZ7 A;  1FG5 N;  2AEC A;  3U2W A;  5C49 A;  4C2S A;  1HJL A;  3IOI A;  2RJ5 A;  3O3P A;  2D7I A;  3I0H A;  1LZI A;  4CJC A;  1IIN A;  4M2A A;  3I0L A;  4XWI A;  4B2X A;  1VGU A;  4FRB A;  2A8U A;  4Y7T A;  1QWJ A;  2FYD B;  1G97 A;  4M2B A;  5C4B A;  3IOJ A;  5EJ1 A;  1ZJ0 A;  1OMX A;  5CMI A;  5FU8 A;  2RJ0 A;  2D7R A;  3T7N A;  5BXC A;  2XME A;  2JCJ A;  2PX7 A;  3OH1 A;  3RSB A;  1ZCT A;  1NWG B;  4B2W A;  3SX7 A;  2QH5 A;  1QGS A;  1WT3 A;  2VS3 A;  5C3B A;  1TZF A;  2PA4 A;  4FIY A;  1SS9 A;  5C4F A;  3IOH A;  2WAW A;  3V0N A;  4EVW A;  2O1F A;  2WEE A;  5CQN X;  3V8Z A;  2FFV A;  2WVK A;  4B3U A;  2AM5 A;  5FU0 A;  5AJO A;  4HO9 A;  1H7H A;  4B4B A;  3K8E A;  2E8B A;  3GUE A;  4HO2 A;  4GBP A;  4KRV A;  2YC3 A;  2YES A;  2I5E A;  4B5B A;  1FGG A;  4E1K A;  4CJB A;  2NXV A;  1VGW A;  1S4P A;  3F1Y A;  4NAI A;  1ZJ3 A;  2XWN A;  1LVW A;  4EE3 A;  2Y6P A;  3OH2 A;  3R2W A;  5C47 A;  2Y4K A;  1S4O A;  3F1C A;  1NHE B;  2RJ8 A;  4EE5 A;  4KT7 A;  4DE7 A;  1HV9 A;  2XWL A;  1G3L A;  1VH3 A;  4G3P A;  3SX3 A;  5C38 A;  2PGV A;  2OEF A;  3U2X A;  2OI5 A;  2RIZ A;  2YQH A;  1FGX A;  1XZ6 A;  1O23 B;  2P6W A;  1HM8 A;  1V84 A;  2O1G A;  1FRW A;  1S4N A;  1R7T A;  2FY7 A;  1LL3 A;  5CMG X;  1H5S C;  3V0O A;  3OH3 A;  1NKH B;  1ZI3 A;  4NAK A;  1G9R A;  2YQS A;  3Q80 A;  4BQH A;  1GQC A;  1H5S D;  1O7Q A;  4UEG A;  1YP2 A;  1ZJ2 A;  1H7G A;  1OQM B;  1ZJO A;  4Y6N A;  1TW5 A;  3DK5 A;  3OH4 A;  3JTJ A;  3ZF8 A;  1G2V A;  2WGZ A;  2J0A A;  4D0Z A;  3FOQ A;  4KPZ A;  2VXL A;  5C36 A;  5EIY A;  4D11 C;  5CMJ A;  2A8W A;  2P72 A;  2XMH A;  1QGQ A;  1TVY A;  1YP3 A;  4ASJ A;  4CJ8 A;  5L6V A;  1YRO B;  5C8R A;  4HO5 A;  1VZX A;  2BO8 A;  3SX5 A;  2JCK A;  1OMZ A;  5EJZ A;  3SXG A;  1VGZ A;  5C48 A;  1G1L A;  2ZU7 A;  1YP4 A;  3PKQ A;  1H7Q A;  4P02 A;  2AE7 A;  1R7V A;  2VD4 A;  1G0R A;  4L41 C;  2OI6 A;  1W57 A;  1FXO A;  1ZHJ A;  3N9W A;  3USR A;  4MIX A;  1MP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...