1PZYB

W314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
TACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGAGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords ALPHA-LACTALBUMIN
publication title The Role of Tryptophan 314 in the Conformational Changes of beta 1,4-Galactosyltransferase-I
pubmed doi rcsb
source organism Mus musculus
total genus 91
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1pzyB00
4M4KA 1ZI1A 5C48A 2V0HA 2XWMA 4K6RA 1OMZA 1G0RA 2GGQA 1G93A 5HS2A 5CQMX 4UEGA 4Y7TA 5C47A 1WVCA 5IFYA 5C1HA 1FZWA 3SX8A 1QG8A 2QH5A 2YQJA 1MC3A 5CQOA 4R7PA 1H5SB 4MNDA 3ZF8A 2OEGA 4HO4A 2JCOA 5CQPA 3K8DA 3T7OA 5DDTA 5C3AA 1VH3A 3QVBA 2AM3A 1EZIA 1FO9A 3OAMA 3OH1A 5FU0A 1H7TA 4LW6A 2YQHA 3D8VA 2FFVA 3I0KA 1QGQA 5IDSA 4D0TA 2I7BA 1WT2A 3Q4SA 5C49A 3U2UA 4FRPA 2D0JA 2V0KA 2D7RA 3CU0A 2VD4A 4FREA 1H5SA 4HO5A 1LL0A 4G3SA 1ON8A 4EEAA 2Y4MA 1H7HA 5C1GA 2V0LA 2FYBA 4NAIA 2APCA 2CU2A 3PNNA 1H5RB 1FGGA 1OQMB 4EEGA 4ARWA 4FCEA 2RJ5A 4Y7VA 1ZHJA 3SX3A 1H7GA 3R3IA 2I5KA 2V0IA 3DUVA 1YP3A 5C1LA 4FROA 2BO7A 2FFUA 2FY7A 3R2WA 2JCJA 5C4EA 3SXEA 3V90A 1O7OA 2X5SA 2XMHA 4EE4A 1LZIA 3Q80A 5C4CA 3USQA 5C4FA 1G8OA 4J18A 3KIAA 3CKNA 4NANA 5CMIA 4E1KA 5L6SA 1H5RA 3V91A 1FG5N 3E26A 1TZFA 1O0RA 1H3MA 2BO6A 1WSZA 3IOHA 1VZUA 2Y7AA 2YQCA 4XWIA 1YROB 1FR9A 3SPTA 5CMHA 3DK5A 3LW6A 4Y7FA 1G9RA 4B2XA 4BQHA 1H4CA 1ZJPA 3RSBA 3V0LA 3ZGGA 1HJJA 2RJ1A 2Z87A 5C3BA 1GA8A 3I0DA 2ZU7A 1ZDGA 1VM8A 1VGZA 2VS5A 2AESA 4Y63A 1ZJ3A 5FTVA 1MP4A 3IOJA 5C4DA 1VICA 1XZ6A 5EJZA 1NWGB 2WVKA 3OC9A 2VSIA 2AECA 5CMGX 1GQCA 1VGUA 1ZJ1A 2P6WA 2VS3A 2YC3A 4FRQA 2JCKA 3E25A 4FCUA 1ON6A 1ZJ0A 1R82A 2WEEA 2XWNA 4B3UA 2X5ZA 1ZI4A 4HO8A 1INIA 1LL3A 1H5SC 4BMAA 3U2VA 4Y6UA 5FTSA 1TVYA 3I0JA 4KC4A 4Y62A 1PZYB 3I0FA 1VGWA 1OMXA 3OH4A 3I0IX 4EE5A 4KQLA 3V0QA 1FWYA 4G3PA 5CQNX 2V0JA 3I0HA 2FYCB 2WVMA 2QKXA 2VXMA 4AAWA 4KC1A 2RIYA 4G87A 1I52A 3SXCA 1TW1A 4FRAA 1INJA 3FOQA 1WT1A 2Y4LA 5L6VA 4KPXA 1H5TA 1ZCVA 1ZCUA 2W0WA 2ICYA 1JVDA 1V82A 1VZXA 1HM0A 2E8BA 1LZ7A 4ASJA 1G97A 4NALA 1H4EA 1GX4A 4B4GA 3SX7A 2Z86A 4P00A 5DDVA 1FO8A 1S4PA 1G95A 3CGXA 3K8EA 3CKOA 2A8UA 3OKRA 1ZJOA 2AM4A 1FXJA 2NXVA 3I0GA 1R7UA 2MZBA 4YS8A 2D7IA 3U2XA 1JVGA 2BO4A 1WT0A 4FRBA 1GQ9A 1NQIB 1W77A 2QGIA 2O1GA 4Y6NA 2OI7A 1IINA 1HM9A 1ZI5A 3BRKX 2O1FA 4KT7A 4D11A 1H7LA 5JQQA 5C38A 1GWVA 4ZDQA 1ZDFA 2FYDB 3GUEA 4D48A 1MP5A 2WGZA 3TZTA 3JUKA 1SS9A 3HL3A 2X65A 1IIMA 3IOIA 2AM5A 4HO2A 4EEMA 4GBPA 4HCQA 3OGZA 4FQWA 4M28A 3JUJA 1WT3A 1ZCTA 1XHBA 3V0OA 4HO3A 1W55A 1YP2A 4DDZA 2VFZA 4DE7A 3D5NA 4C2SA 2YCMA 3SXAA 4CJ8A 1R81A 1H7QA 4AYJA 3SXBA 1GX0A 3OH3A 2UX8A 3U0XA 2O1HA 2Y6PA 4D0ZA 2W0VA 4EE3A 5J49A 2YC5A 4CJBA 3CKVA 4CJCA 3ZGFA 1R7VA 4JD0A 1E5KA 4HO9A 1G1LA 2I5EA 2RJ9A 4L41C 2BO8A 1S4NA 3OH2A 4FRMA 3NGWA 3T7NA 3V0NA 2RIZA 3U2WA 1VPAA 4KXOA 1R7TA 1G23A 1JYLA 3EE5A 4ECMA 3T7MA 2RJ6A 2AGDA 4P02A 5FYEA 1H5TB 4Y9XA 5C8RA 4EVWA 4CVHA 2P73A 3ST8A 1HJLA 3SXGA 4HOCA 5C4BA 1ZCYA 4MYBA 1V84A 1H7EA 3TQDA 5I1FA 2WAWA 1FGXA 4Y7GA 4DECA 5AJNA 1JV1A 3RMVA 2X60A 1JV3A 5AJOA 4G3QA 1TW5A 2Y4JA 4EEOA 4B42A 1VH1A 1ZIZA 1G2VA 5CMJA 2AE7A 5FUHA 4FRDA 2RITA 3SXDA 2PGYA 3V8YA 3PKPA 3O3PA 5FU8A 3JTJA 4KPZA 4B2WA 2AH9A 2RIXA 2Q4JA 1H5SD 1PZTA 2RJ8A 1NF5B 5AJPA 3V0PA 1LVWA 2OI5A 4D11C 2XWLA 4AC3A 2JCLA 3ZLKA 3I0CA 4Y7UA 4HO0A 4M2BA 1FRWA 3FWWA 3ZLLA 1NMMB 2ZU8A 2YESA 3CKQA 2OEFA 1H7FA 3USRA 1ZJ2A 3U0YA 2PX7A 3PKQA 1G3LA 4FRHA 1LL2A 1H4DA 2ICXA 1O23B 3RMWA 3Q7UA 4KRVA 1JYKA 2PA4A 4JISA 4KC2A 2FYAA 1R7YA 3F1YA 3POLA 3SX5A 2VS4A 2RJ0A 2DPWA 3CKJA 3I0LA 2ZU9A 1FOAA 1VZTA 1YP4A 4ASYA 3D98A 1K4VA 5C3DA 1KWSA 1O7QA 2WVLA 4M2AA 1HV9A 4IRQA 1V83A 3U2TA 1Z90A 1R80A 4KNXA 5CMFX 4B5BA 5EJ1A 3DJ4A 4Y64A 1LZ0A 4B4MA 2OI6A 4AYLA 5EIYA 1NHEB 2P72A 3BCVA 4KNRA 2RJ4A 3V8ZA 5CQLX 5BXCA 1ZI3A 2GGOA 2E3DA 2VSHA 3N9WA 2YQSA 5FV9A 1QGSA 1FR8A 1MP3A 2Y4KA 1LZJA 1VGTA 2XMEA 1W57A 2VXLA 3V0MA 2WE9A 2A8WA 3I0EA 1HM8A 2RJ7A 5C36A 1FXOA 3F1CA 4LW3A 1QWJA 1R7XA 4HO6A 1NKHB 2PGVA 3OH0A 4IRPA 1S4OA 4HG6A 4FRLA 4NAKA 5IDTA 4B4BA 1GWWA 1EYRA
chains in the Genus database with same CATH superfamily
4M4KA 1ZI1A 5C48A 2V0HA 2XWMA 4K6RA 5D92A 1OMZA 1G0RA 2GGQA 1G93A 5HS2A 5CQMX 4UEGA 4Y7TA 5C47A 1WVCA 5IFYA 5C1HA 1FZWA 3SX8A 1QG8A 2QH5A 2YQJA 1MC3A 5CQOA 4R7PA 1H5SB 4MNDA 3ZF8A 2OEGA 4HO4A 2JCOA 5CQPA 3K8DA 3T7OA 5DDTA 5C3AA 1VH3A 3QVBA 2AM3A 1EZIA 1FO9A 3OAMA 3OH1A 5FU0A 1H7TA 4LW6A 2YQHA 3D8VA 2FFVA 3I0KA 1QGQA 5IDSA 4D0TA 2I7BA 1WT2A 3Q4SA 5C49A 3U2UA 4FRPA 2D0JA 2V0KA 2D7RA 3CU0A 2VD4A 4FREA 1H5SA 4HO5A 1LL0A 4G3SA 1ON8A 4EEAA 2Y4MA 1H7HA 5C1GA 2V0LA 2FYBA 4NAIA 2APCA 5D91A 2CU2A 3PNNA 1H5RB 1FGGA 1OQMB 4EEGA 4ARWA 4FCEA 2RJ5A 4Y7VA 1ZHJA 3SX3A 1H7GA 3R3IA 2I5KA 2V0IA 2J0BA 3DUVA 1YP3A 5C1LA 4FROA 2BO7A 2FFUA 2FY7A 3R2WA 2JCJA 5C4EA 3SXEA 3V90A 1O7OA 2X5SA 4O6MA 2XMHA 4EE4A 1LZIA 3Q80A 5C4CA 3USQA 5C4FA 1G8OA 4O6NA 4J18A 3KIAA 3CKNA 4NANA 5CMIA 4E1KA 5L6SA 1H5RA 3V91A 1FG5N 3E26A 1TZFA 1O0RA 1H3MA 2BO6A 1WSZA 3IOHA 1VZUA 2Y7AA 2YQCA 4XWIA 1YROB 2VK9A 1FR9A 3SPTA 5CMHA 3DK5A 3LW6A 4Y7FA 1G9RA 4B2XA 4BQHA 1H4CA 1ZJPA 3RSBA 3V0LA 3ZGGA 1HJJA 2RJ1A 2Z87A 5C3BA 1GA8A 3I0DA 2ZU7A 1ZDGA 1VM8A 1VGZA 2VS5A 2AESA 4Y63A 1ZJ3A 5FTVA 1MP4A 3IOJA 2C0NA 5C4DA 1VICA 1XZ6A 5EJZA 1NWGB 2WVKA 3OC9A 2VSIA 2AECA 5CMGX 1GQCA 1VGUA 1ZJ1A 2P6WA 2VS3A 2YC3A 4FRQA 2JCKA 3E25A 4FCUA 1ON6A 1ZJ0A 1R82A 2WEEA 2XWNA 4B3UA 2X5ZA 1ZI4A 4HO8A 1INIA 1LL3A 1H5SC 4BMAA 3U2VA 4Y6UA 5FTSA 1TVYA 3I0JA 4KC4A 4Y62A 1PZYB 3I0FA 1VGWA 1OMXA 3OH4A 3I0IX 4EE5A 4KQLA 3V0QA 1FWYA 4G3PA 5CQNX 2V0JA 3I0HA 2FYCB 2WVMA 4MIXA 2QKXA 2VXMA 4AAWA 4KC1A 2RIYA 4G87A 1I52A 3SXCA 1TW1A 4FRAA 1INJA 3FOQA 1WT1A 2Y4LA 5L6VA 4KPXA 1H5TA 1ZCVA 1ZCUA 2W0WA 2ICYA 1JVDA 1V82A 1VZXA 1HM0A 2E8BA 1LZ7A 4ASJA 1G97A 4NALA 1H4EA 4FIYA 1GX4A 4B4GA 3SX7A 2Z86A 4P00A 5DDVA 1FO8A 1S4PA 1G95A 3CGXA 3K8EA 3CKOA 2A8UA 3OKRA 1ZJOA 2AM4A 1FXJA 2NXVA 3I0GA 1R7UA 2MZBA 4YS8A 2D7IA 3U2XA 1JVGA 2BO4A 1WT0A 4FRBA 1GQ9A 1NQIB 1W77A 2QGIA 2O1GA 4Y6NA 2OI7A 1IINA 1HM9A 1ZI5A 3BRKX 2O1FA 4KT7A 4D11A 1H7LA 5JQQA 5C38A 1GWVA 4ZDQA 1ZDFA 2FYDB 3GUEA 4D48A 1MP5A 2WGZA 3TZTA 3JUKA 1SS9A 2J0AA 3HL3A 2X65A 1IIMA 3IOIA 2AM5A 4HO2A 4EEMA 4GBPA 4HCQA 3OGZA 4FQWA 4M28A 3JUJA 1WT3A 1ZCTA 1XHBA 3V0OA 4HO3A 1W55A 1YP2A 4DDZA 2VFZA 4DE7A 3D5NA 4C2SA 2YCMA 3SXAA 4CJ8A 1R81A 1H7QA 4AYJA 3SXBA 1GX0A 3OH3A 2UX8A 3U0XA 2O1HA 2Y6PA 4D0ZA 2W0VA 4EE3A 5J49A 2YC5A 4CJBA 3CKVA 4CJCA 3ZGFA 1R7VA 4JD0A 1E5KA 4HO9A 1G1LA 2I5EA 2RJ9A 4L41C 2BO8A 1S4NA 3OH2A 4FRMA 3NGWA 3T7NA 3V0NA 2RIZA 3U2WA 1VPAA 4KXOA 1R7TA 1G23A 1JYLA 3EE5A 4ECMA 3T7MA 2RJ6A 2AGDA 4P02A 5FYEA 1H5TB 4Y9XA 5C8RA 4EVWA 4CVHA 2P73A 3ST8A 1HJLA 3SXGA 4HOCA 5C4BA 1ZCYA 4MYBA 1V84A 1H7EA 3TQDA 5I1FA 2WAWA 1FGXA 4Y7GA 4DECA 5AJNA 1JV1A 3RMVA 2X60A 1JV3A 5AJOA 4G3QA 1TW5A 2Y4JA 4EEOA 4B42A 1VH1A 1ZIZA 1G2VA 5CMJA 2AE7A 5FUHA 4FRDA 2RITA 3SXDA 2PGYA 3V8YA 3PKPA 3O3PA 5FU8A 3JTJA 4KPZA 4B2WA 2AH9A 2RIXA 2Q4JA 1H5SD 1PZTA 2RJ8A 1NF5B 5AJPA 3V0PA 1LVWA 2OI5A 4D11C 2XWLA 4AC3A 2JCLA 3ZLKA 3I0CA 4Y7UA 4HO0A 4M2BA 1FRWA 3FWWA 3ZLLA 1NMMB 2ZU8A 2YESA 3CKQA 2OEFA 1H7FA 3USRA 1ZJ2A 3U0YA 2PX7A 3PKQA 1G3LA 4FRHA 1LL2A 1H4DA 2ICXA 1O23B 3RMWA 3Q7UA 4KRVA 1JYKA 2PA4A 4JISA 4KC2A 2FYAA 1R7YA 3F1YA 3POLA 3SX5A 2VS4A 2RJ0A 2DPWA 3CKJA 4Q7CA 3I0LA 2ZU9A 1FOAA 1VZTA 1YP4A 4ASYA 3D98A 1K4VA 5C3DA 1KWSA 1O7QA 2WVLA 4M2AA 1HV9A 4IRQA 1V83A 3U2TA 1Z90A 1R80A 4KNXA 5CMFX 4B5BA 5EJ1A 3DJ4A 4Y64A 1LZ0A 4B4MA 2OI6A 4AYLA 5EIYA 1NHEB 2P72A 3BCVA 4KNRA 2RJ4A 4FIXA 3V8ZA 5CQLX 5BXCA 1ZI3A 2GGOA 2E3DA 2VSHA 3N9WA 2YQSA 5FV9A 1QGSA 1FR8A 1MP3A 2Y4KA 1LZJA 1VGTA 2XMEA 1W57A 2VXLA 3V0MA 2WE9A 2A8WA 3I0EA 1HM8A 2RJ7A 5C36A 1FXOA 3F1CA 4LW3A 1QWJA 1R7XA 4HO6A 1NKHB 2PGVA 3OH0A 4IRPA 1S4OA 4HG6A 4FRLA 4NAKA 5IDTA 4B4BA 1GWWA 1EYRA
chains in the Genus database with same CATH topology
4M4KA 1ZI1A 5C48A 2V0HA 2XWMA 4K6RA 5D92A 1OMZA 1G0RA 2GGQA 1G93A 5HS2A 5CQMX 4UEGA 4Y7TA 5C47A 1WVCA 5IFYA 5C1HA 1FZWA 3SX8A 1QG8A 2QH5A 2YQJA 1MC3A 5CQOA 4R7PA 1H5SB 4MNDA 3ZF8A 2OEGA 4HO4A 2JCOA 5CQPA 3K8DA 3T7OA 5DDTA 5C3AA 1VH3A 3QVBA 2AM3A 1EZIA 1FO9A 3OAMA 3OH1A 5FU0A 1H7TA 4LW6A 2YQHA 3D8VA 2FFVA 3I0KA 1QGQA 5IDSA 4D0TA 2I7BA 1WT2A 3Q4SA 5C49A 3U2UA 4FRPA 2D0JA 2V0KA 2D7RA 3CU0A 2VD4A 4FREA 1H5SA 4HO5A 1LL0A 4G3SA 1ON8A 4EEAA 2Y4MA 1H7HA 5C1GA 2V0LA 2FYBA 4NAIA 2APCA 5D91A 2CU2A 3PNNA 1H5RB 1FGGA 1OQMB 4EEGA 4ARWA 4FCEA 2RJ5A 4Y7VA 1ZHJA 3SX3A 1H7GA 3R3IA 2I5KA 2V0IA 2J0BA 3DUVA 1YP3A 5C1LA 4FROA 2BO7A 2FFUA 2FY7A 3R2WA 2JCJA 5C4EA 3SXEA 3V90A 1O7OA 2X5SA 4O6MA 2XMHA 4EE4A 1LZIA 3Q80A 5C4CA 3USQA 5C4FA 1G8OA 4O6NA 4J18A 3KIAA 3CKNA 4NANA 5CMIA 4E1KA 5L6SA 1H5RA 3V91A 1FG5N 3E26A 1TZFA 1O0RA 1H3MA 2BO6A 1WSZA 3IOHA 1VZUA 2Y7AA 2YQCA 4XWIA 1YROB 2VK9A 1FR9A 3SPTA 5CMHA 3DK5A 3LW6A 4Y7FA 1G9RA 4B2XA 4BQHA 1H4CA 1ZJPA 3RSBA 3V0LA 3ZGGA 1HJJA 2RJ1A 2Z87A 5C3BA 1GA8A 3I0DA 2ZU7A 1ZDGA 1VM8A 1VGZA 2VS5A 2AESA 4Y63A 1ZJ3A 5FTVA 1MP4A 3IOJA 2C0NA 5C4DA 1VICA 1XZ6A 5EJZA 1NWGB 2WVKA 3OC9A 2VSIA 2AECA 5CMGX 1GQCA 1VGUA 1ZJ1A 2P6WA 2VS3A 2YC3A 4FRQA 2JCKA 3E25A 4FCUA 1ON6A 1ZJ0A 1R82A 2WEEA 2XWNA 4B3UA 2X5ZA 1ZI4A 4HO8A 1INIA 1LL3A 1H5SC 4BMAA 3U2VA 4Y6UA 5FTSA 1TVYA 3I0JA 4KC4A 4Y62A 1PZYB 3I0FA 1VGWA 1OMXA 3OH4A 3I0IX 4EE5A 4KQLA 3V0QA 1FWYA 4G3PA 5CQNX 2V0JA 3I0HA 2FYCB 2WVMA 4MIXA 2QKXA 2VXMA 4AAWA 4KC1A 2RIYA 4G87A 1I52A 3SXCA 1TW1A 4FRAA 1INJA 3FOQA 1WT1A 2Y4LA 5L6VA 4KPXA 1H5TA 1ZCVA 1ZCUA 2W0WA 2ICYA 1JVDA 1V82A 1VZXA 1HM0A 2E8BA 1LZ7A 4ASJA 1G97A 4NALA 1H4EA 4FIYA 1GX4A 4B4GA 3SX7A 2Z86A 4P00A 5DDVA 1FO8A 1S4PA 1G95A 3CGXA 3K8EA 3CKOA 2A8UA 3OKRA 1ZJOA 2AM4A 1FXJA 2NXVA 3I0GA 1R7UA 2MZBA 4YS8A 2D7IA 3U2XA 1JVGA 2BO4A 1WT0A 4FRBA 1GQ9A 1NQIB 1W77A 2QGIA 2O1GA 4Y6NA 2OI7A 1IINA 1HM9A 1ZI5A 3BRKX 2O1FA 4KT7A 4D11A 1H7LA 5JQQA 5C38A 1GWVA 4ZDQA 1ZDFA 2FYDB 3GUEA 4D48A 1MP5A 2WGZA 3TZTA 3JUKA 1SS9A 2J0AA 3HL3A 2X65A 1IIMA 3IOIA 2AM5A 4HO2A 4EEMA 4GBPA 4HCQA 3OGZA 4FQWA 4M28A 3JUJA 1WT3A 1ZCTA 1XHBA 3V0OA 4HO3A 1W55A 1YP2A 4DDZA 2VFZA 4DE7A 3D5NA 4C2SA 2YCMA 3SXAA 4CJ8A 1R81A 1H7QA 4AYJA 3SXBA 1GX0A 3OH3A 2UX8A 3U0XA 2O1HA 2Y6PA 4D0ZA 2W0VA 4EE3A 5J49A 2YC5A 4CJBA 3CKVA 4CJCA 3ZGFA 1R7VA 4JD0A 1E5KA 4HO9A 1G1LA 2I5EA 2RJ9A 4L41C 2BO8A 1S4NA 3OH2A 4FRMA 3NGWA 3T7NA 3V0NA 2RIZA 3U2WA 1VPAA 4KXOA 1R7TA 1G23A 1JYLA 3EE5A 4ECMA 3T7MA 2RJ6A 2AGDA 4P02A 5FYEA 1H5TB 4Y9XA 5C8RA 4EVWA 4CVHA 2P73A 3ST8A 1HJLA 3SXGA 4HOCA 5C4BA 1ZCYA 4MYBA 1V84A 1H7EA 3TQDA 5I1FA 2WAWA 1FGXA 4Y7GA 4DECA 5AJNA 1JV1A 3RMVA 2X60A 1JV3A 5AJOA 4G3QA 1TW5A 2Y4JA 4EEOA 4B42A 1VH1A 1ZIZA 1G2VA 5CMJA 2AE7A 5FUHA 4FRDA 2RITA 3SXDA 2PGYA 3V8YA 3PKPA 3O3PA 5FU8A 3JTJA 4KPZA 4B2WA 2AH9A 2RIXA 2Q4JA 1H5SD 1PZTA 2RJ8A 1NF5B 5AJPA 3V0PA 1LVWA 2OI5A 4D11C 2XWLA 4AC3A 2JCLA 3ZLKA 3I0CA 4Y7UA 4HO0A 4M2BA 1FRWA 3FWWA 3ZLLA 1NMMB 2ZU8A 2YESA 3CKQA 2OEFA 1H7FA 3USRA 1ZJ2A 3U0YA 2PX7A 3PKQA 1G3LA 4FRHA 1LL2A 1H4DA 2ICXA 1O23B 3RMWA 3Q7UA 4KRVA 1JYKA 2PA4A 4JISA 4KC2A 2FYAA 1R7YA 3F1YA 3POLA 3SX5A 2VS4A 2RJ0A 2DPWA 3CKJA 4Q7CA 3I0LA 2ZU9A 1FOAA 1VZTA 1YP4A 4ASYA 3D98A 1K4VA 5C3DA 1KWSA 1O7QA 2WVLA 4M2AA 1HV9A 4IRQA 1V83A 3U2TA 1Z90A 1R80A 4KNXA 5CMFX 4B5BA 5EJ1A 3DJ4A 4Y64A 1LZ0A 4B4MA 2OI6A 4AYLA 5EIYA 1NHEB 2P72A 3BCVA 4KNRA 2RJ4A 4FIXA 3V8ZA 5CQLX 5BXCA 1ZI3A 2GGOA 2E3DA 2VSHA 3N9WA 2YQSA 5FV9A 1QGSA 1FR8A 1MP3A 2Y4KA 1LZJA 1VGTA 2XMEA 1W57A 2VXLA 3V0MA 2WE9A 2A8WA 3I0EA 1HM8A 2RJ7A 5C36A 1FXOA 3F1CA 4LW3A 1QWJA 1R7XA 4HO6A 1NKHB 2PGVA 3OH0A 4IRPA 1S4OA 4HG6A 4FRLA 4NAKA 5IDTA 4B4BA 1GWWA 1EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4K A;  1ZI1 A;  5C48 A;  2V0H A;  2XWM A;  4K6R A;  1OMZ A;  1G0R A;  2GGQ A;  1G93 A;  5HS2 A;  5CQM X;  4UEG A;  4Y7T A;  5C47 A;  1WVC A;  5IFY A;  5C1H A;  1FZW A;  3SX8 A;  1QG8 A;  2QH5 A;  2YQJ A;  1MC3 A;  5CQO A;  4R7P A;  1H5S B;  4MND A;  3ZF8 A;  2OEG A;  4HO4 A;  2JCO A;  5CQP A;  3K8D A;  3T7O A;  5DDT A;  5C3A A;  1VH3 A;  3QVB A;  2AM3 A;  1EZI A;  1FO9 A;  3OAM A;  3OH1 A;  5FU0 A;  1H7T A;  4LW6 A;  2YQH A;  3D8V A;  2FFV A;  3I0K A;  1QGQ A;  5IDS A;  4D0T A;  2I7B A;  1WT2 A;  3Q4S A;  5C49 A;  3U2U A;  4FRP A;  2D0J A;  2V0K A;  2D7R A;  3CU0 A;  2VD4 A;  4FRE A;  1H5S A;  4HO5 A;  1LL0 A;  4G3S A;  1ON8 A;  4EEA A;  2Y4M A;  1H7H A;  5C1G A;  2V0L A;  2FYB A;  4NAI A;  2APC A;  2CU2 A;  3PNN A;  1H5R B;  1FGG A;  1OQM B;  4EEG A;  4ARW A;  4FCE A;  2RJ5 A;  4Y7V A;  1ZHJ A;  3SX3 A;  1H7G A;  3R3I A;  2I5K A;  2V0I A;  3DUV A;  1YP3 A;  5C1L A;  4FRO A;  2BO7 A;  2FFU A;  2FY7 A;  3R2W A;  2JCJ A;  5C4E A;  3SXE A;  3V90 A;  1O7O A;  2X5S A;  2XMH A;  4EE4 A;  1LZI A;  3Q80 A;  5C4C A;  3USQ A;  5C4F A;  1G8O A;  4J18 A;  3KIA A;  3CKN A;  4NAN A;  5CMI A;  4E1K A;  5L6S A;  1H5R A;  3V91 A;  1FG5 N;  3E26 A;  1TZF A;  1O0R A;  1H3M A;  2BO6 A;  1WSZ A;  3IOH A;  1VZU A;  2Y7A A;  2YQC A;  4XWI A;  1YRO B;  1FR9 A;  3SPT A;  5CMH A;  3DK5 A;  3LW6 A;  4Y7F A;  1G9R A;  4B2X A;  4BQH A;  1H4C A;  1ZJP A;  3RSB A;  3V0L A;  3ZGG A;  1HJJ A;  2RJ1 A;  2Z87 A;  5C3B A;  1GA8 A;  3I0D A;  2ZU7 A;  1ZDG A;  1VM8 A;  1VGZ A;  2VS5 A;  2AES A;  4Y63 A;  1ZJ3 A;  5FTV A;  1MP4 A;  3IOJ A;  5C4D A;  1VIC A;  1XZ6 A;  5EJZ A;  1NWG B;  2WVK A;  3OC9 A;  2VSI A;  2AEC A;  5CMG X;  1GQC A;  1VGU A;  1ZJ1 A;  2P6W A;  2VS3 A;  2YC3 A;  4FRQ A;  2JCK A;  3E25 A;  4FCU A;  1ON6 A;  1ZJ0 A;  1R82 A;  2WEE A;  2XWN A;  4B3U A;  2X5Z A;  1ZI4 A;  4HO8 A;  1INI A;  1LL3 A;  1H5S C;  4BMA A;  3U2V A;  4Y6U A;  5FTS A;  1TVY A;  3I0J A;  4KC4 A;  4Y62 A;  1PZY B;  3I0F A;  1VGW A;  1OMX A;  3OH4 A;  3I0I X;  4EE5 A;  4KQL A;  3V0Q A;  1FWY A;  4G3P A;  5CQN X;  2V0J A;  3I0H A;  2FYC B;  2WVM A;  2QKX A;  2VXM A;  4AAW A;  4KC1 A;  2RIY A;  4G87 A;  1I52 A;  3SXC A;  1TW1 A;  4FRA A;  1INJ A;  3FOQ A;  1WT1 A;  2Y4L A;  5L6V A;  4KPX A;  1H5T A;  1ZCV A;  1ZCU A;  2W0W A;  2ICY A;  1JVD A;  1V82 A;  1VZX A;  1HM0 A;  2E8B A;  1LZ7 A;  4ASJ A;  1G97 A;  4NAL A;  1H4E A;  1GX4 A;  4B4G A;  3SX7 A;  2Z86 A;  4P00 A;  5DDV A;  1FO8 A;  1S4P A;  1G95 A;  3CGX A;  3K8E A;  3CKO A;  2A8U A;  3OKR A;  1ZJO A;  2AM4 A;  1FXJ A;  2NXV A;  3I0G A;  1R7U A;  2MZB A;  4YS8 A;  2D7I A;  3U2X A;  1JVG A;  2BO4 A;  1WT0 A;  4FRB A;  1GQ9 A;  1NQI B;  1W77 A;  2QGI A;  2O1G A;  4Y6N A;  2OI7 A;  1IIN A;  1HM9 A;  1ZI5 A;  3BRK X;  2O1F A;  4KT7 A;  4D11 A;  1H7L A;  5JQQ A;  5C38 A;  1GWV A;  4ZDQ A;  1ZDF A;  2FYD B;  3GUE A;  4D48 A;  1MP5 A;  2WGZ A;  3TZT A;  3JUK A;  1SS9 A;  3HL3 A;  2X65 A;  1IIM A;  3IOI A;  2AM5 A;  4HO2 A;  4EEM A;  4GBP A;  4HCQ A;  3OGZ A;  4FQW A;  4M28 A;  3JUJ A;  1WT3 A;  1ZCT A;  1XHB A;  3V0O A;  4HO3 A;  1W55 A;  1YP2 A;  4DDZ A;  2VFZ A;  4DE7 A;  3D5N A;  4C2S A;  2YCM A;  3SXA A;  4CJ8 A;  1R81 A;  1H7Q A;  4AYJ A;  3SXB A;  1GX0 A;  3OH3 A;  2UX8 A;  3U0X A;  2O1H A;  2Y6P A;  4D0Z A;  2W0V A;  4EE3 A;  5J49 A;  2YC5 A;  4CJB A;  3CKV A;  4CJC A;  3ZGF A;  1R7V A;  4JD0 A;  1E5K A;  4HO9 A;  1G1L A;  2I5E A;  2RJ9 A;  4L41 C;  2BO8 A;  1S4N A;  3OH2 A;  4FRM A;  3NGW A;  3T7N A;  3V0N A;  2RIZ A;  3U2W A;  1VPA A;  4KXO A;  1R7T A;  1G23 A;  1JYL A;  3EE5 A;  4ECM A;  3T7M A;  2RJ6 A;  2AGD A;  4P02 A;  5FYE A;  1H5T B;  4Y9X A;  5C8R A;  4EVW A;  4CVH A;  2P73 A;  3ST8 A;  1HJL A;  3SXG A;  4HOC A;  5C4B A;  1ZCY A;  4MYB A;  1V84 A;  1H7E A;  3TQD A;  5I1F A;  2WAW A;  1FGX A;  4Y7G A;  4DEC A;  5AJN A;  1JV1 A;  3RMV A;  2X60 A;  1JV3 A;  5AJO A;  4G3Q A;  1TW5 A;  2Y4J A;  4EEO A;  4B42 A;  1VH1 A;  1ZIZ A;  1G2V A;  5CMJ A;  2AE7 A;  5FUH A;  4FRD A;  2RIT A;  3SXD A;  2PGY A;  3V8Y A;  3PKP A;  3O3P A;  5FU8 A;  3JTJ A;  4KPZ A;  4B2W A;  2AH9 A;  2RIX A;  2Q4J A;  1H5S D;  1PZT A;  2RJ8 A;  1NF5 B;  5AJP A;  3V0P A;  1LVW A;  2OI5 A;  4D11 C;  2XWL A;  4AC3 A;  2JCL A;  3ZLK A;  3I0C A;  4Y7U A;  4HO0 A;  4M2B A;  1FRW A;  3FWW A;  3ZLL A;  1NMM B;  2ZU8 A;  2YES A;  3CKQ A;  2OEF A;  1H7F A;  3USR A;  1ZJ2 A;  3U0Y A;  2PX7 A;  3PKQ A;  1G3L A;  4FRH A;  1LL2 A;  1H4D A;  2ICX A;  1O23 B;  3RMW A;  3Q7U A;  4KRV A;  1JYK A;  2PA4 A;  4JIS A;  4KC2 A;  2FYA A;  1R7Y A;  3F1Y A;  3POL A;  3SX5 A;  2VS4 A;  2RJ0 A;  2DPW A;  3CKJ A;  3I0L A;  2ZU9 A;  1FOA A;  1VZT A;  1YP4 A;  4ASY A;  3D98 A;  1K4V A;  5C3D A;  1KWS A;  1O7Q A;  2WVL A;  4M2A A;  1HV9 A;  4IRQ A;  1V83 A;  3U2T A;  1Z90 A;  1R80 A;  4KNX A;  5CMF X;  4B5B A;  5EJ1 A;  3DJ4 A;  4Y64 A;  1LZ0 A;  4B4M A;  2OI6 A;  4AYL A;  5EIY A;  1NHE B;  2P72 A;  3BCV A;  4KNR A;  2RJ4 A;  3V8Z A;  5CQL X;  5BXC A;  1ZI3 A;  2GGO A;  2E3D A;  2VSH A;  3N9W A;  2YQS A;  5FV9 A;  1QGS A;  1FR8 A;  1MP3 A;  2Y4K A;  1LZJ A;  1VGT A;  2XME A;  1W57 A;  2VXL A;  3V0M A;  2WE9 A;  2A8W A;  3I0E A;  1HM8 A;  2RJ7 A;  5C36 A;  1FXO A;  3F1C A;  4LW3 A;  1QWJ A;  1R7X A;  4HO6 A;  1NKH B;  2PGV A;  3OH0 A;  4IRP A;  1S4O A;  4HG6 A;  4FRL A;  4NAK A;  5IDT A;  4B4B A;  1GWW A;  1EYR A; 
#chains in the Genus database with same CATH topology
 4M4K A;  1ZI1 A;  5C48 A;  2V0H A;  2XWM A;  4K6R A;  5D92 A;  1OMZ A;  1G0R A;  2GGQ A;  1G93 A;  5HS2 A;  5CQM X;  4UEG A;  4Y7T A;  5C47 A;  1WVC A;  5IFY A;  5C1H A;  1FZW A;  3SX8 A;  1QG8 A;  2QH5 A;  2YQJ A;  1MC3 A;  5CQO A;  4R7P A;  1H5S B;  4MND A;  3ZF8 A;  2OEG A;  4HO4 A;  2JCO A;  5CQP A;  3K8D A;  3T7O A;  5DDT A;  5C3A A;  1VH3 A;  3QVB A;  2AM3 A;  1EZI A;  1FO9 A;  3OAM A;  3OH1 A;  5FU0 A;  1H7T A;  4LW6 A;  2YQH A;  3D8V A;  2FFV A;  3I0K A;  1QGQ A;  5IDS A;  4D0T A;  2I7B A;  1WT2 A;  3Q4S A;  5C49 A;  3U2U A;  4FRP A;  2D0J A;  2V0K A;  2D7R A;  3CU0 A;  2VD4 A;  4FRE A;  1H5S A;  4HO5 A;  1LL0 A;  4G3S A;  1ON8 A;  4EEA A;  2Y4M A;  1H7H A;  5C1G A;  2V0L A;  2FYB A;  4NAI A;  2APC A;  5D91 A;  2CU2 A;  3PNN A;  1H5R B;  1FGG A;  1OQM B;  4EEG A;  4ARW A;  4FCE A;  2RJ5 A;  4Y7V A;  1ZHJ A;  3SX3 A;  1H7G A;  3R3I A;  2I5K A;  2V0I A;  2J0B A;  3DUV A;  1YP3 A;  5C1L A;  4FRO A;  2BO7 A;  2FFU A;  2FY7 A;  3R2W A;  2JCJ A;  5C4E A;  3SXE A;  3V90 A;  1O7O A;  2X5S A;  4O6M A;  2XMH A;  4EE4 A;  1LZI A;  3Q80 A;  5C4C A;  3USQ A;  5C4F A;  1G8O A;  4O6N A;  4J18 A;  3KIA A;  3CKN A;  4NAN A;  5CMI A;  4E1K A;  5L6S A;  1H5R A;  3V91 A;  1FG5 N;  3E26 A;  1TZF A;  1O0R A;  1H3M A;  2BO6 A;  1WSZ A;  3IOH A;  1VZU A;  2Y7A A;  2YQC A;  4XWI A;  1YRO B;  2VK9 A;  1FR9 A;  3SPT A;  5CMH A;  3DK5 A;  3LW6 A;  4Y7F A;  1G9R A;  4B2X A;  4BQH A;  1H4C A;  1ZJP A;  3RSB A;  3V0L A;  3ZGG A;  1HJJ A;  2RJ1 A;  2Z87 A;  5C3B A;  1GA8 A;  3I0D A;  2ZU7 A;  1ZDG A;  1VM8 A;  1VGZ A;  2VS5 A;  2AES A;  4Y63 A;  1ZJ3 A;  5FTV A;  1MP4 A;  3IOJ A;  2C0N A;  5C4D A;  1VIC A;  1XZ6 A;  5EJZ A;  1NWG B;  2WVK A;  3OC9 A;  2VSI A;  2AEC A;  5CMG X;  1GQC A;  1VGU A;  1ZJ1 A;  2P6W A;  2VS3 A;  2YC3 A;  4FRQ A;  2JCK A;  3E25 A;  4FCU A;  1ON6 A;  1ZJ0 A;  1R82 A;  2WEE A;  2XWN A;  4B3U A;  2X5Z A;  1ZI4 A;  4HO8 A;  1INI A;  1LL3 A;  1H5S C;  4BMA A;  3U2V A;  4Y6U A;  5FTS A;  1TVY A;  3I0J A;  4KC4 A;  4Y62 A;  1PZY B;  3I0F A;  1VGW A;  1OMX A;  3OH4 A;  3I0I X;  4EE5 A;  4KQL A;  3V0Q A;  1FWY A;  4G3P A;  5CQN X;  2V0J A;  3I0H A;  2FYC B;  2WVM A;  4MIX A;  2QKX A;  2VXM A;  4AAW A;  4KC1 A;  2RIY A;  4G87 A;  1I52 A;  3SXC A;  1TW1 A;  4FRA A;  1INJ A;  3FOQ A;  1WT1 A;  2Y4L A;  5L6V A;  4KPX A;  1H5T A;  1ZCV A;  1ZCU A;  2W0W A;  2ICY A;  1JVD A;  1V82 A;  1VZX A;  1HM0 A;  2E8B A;  1LZ7 A;  4ASJ A;  1G97 A;  4NAL A;  1H4E A;  4FIY A;  1GX4 A;  4B4G A;  3SX7 A;  2Z86 A;  4P00 A;  5DDV A;  1FO8 A;  1S4P A;  1G95 A;  3CGX A;  3K8E A;  3CKO A;  2A8U A;  3OKR A;  1ZJO A;  2AM4 A;  1FXJ A;  2NXV A;  3I0G A;  1R7U A;  2MZB A;  4YS8 A;  2D7I A;  3U2X A;  1JVG A;  2BO4 A;  1WT0 A;  4FRB A;  1GQ9 A;  1NQI B;  1W77 A;  2QGI A;  2O1G A;  4Y6N A;  2OI7 A;  1IIN A;  1HM9 A;  1ZI5 A;  3BRK X;  2O1F A;  4KT7 A;  4D11 A;  1H7L A;  5JQQ A;  5C38 A;  1GWV A;  4ZDQ A;  1ZDF A;  2FYD B;  3GUE A;  4D48 A;  1MP5 A;  2WGZ A;  3TZT A;  3JUK A;  1SS9 A;  2J0A A;  3HL3 A;  2X65 A;  1IIM A;  3IOI A;  2AM5 A;  4HO2 A;  4EEM A;  4GBP A;  4HCQ A;  3OGZ A;  4FQW A;  4M28 A;  3JUJ A;  1WT3 A;  1ZCT A;  1XHB A;  3V0O A;  4HO3 A;  1W55 A;  1YP2 A;  4DDZ A;  2VFZ A;  4DE7 A;  3D5N A;  4C2S A;  2YCM A;  3SXA A;  4CJ8 A;  1R81 A;  1H7Q A;  4AYJ A;  3SXB A;  1GX0 A;  3OH3 A;  2UX8 A;  3U0X A;  2O1H A;  2Y6P A;  4D0Z A;  2W0V A;  4EE3 A;  5J49 A;  2YC5 A;  4CJB A;  3CKV A;  4CJC A;  3ZGF A;  1R7V A;  4JD0 A;  1E5K A;  4HO9 A;  1G1L A;  2I5E A;  2RJ9 A;  4L41 C;  2BO8 A;  1S4N A;  3OH2 A;  4FRM A;  3NGW A;  3T7N A;  3V0N A;  2RIZ A;  3U2W A;  1VPA A;  4KXO A;  1R7T A;  1G23 A;  1JYL A;  3EE5 A;  4ECM A;  3T7M A;  2RJ6 A;  2AGD A;  4P02 A;  5FYE A;  1H5T B;  4Y9X A;  5C8R A;  4EVW A;  4CVH A;  2P73 A;  3ST8 A;  1HJL A;  3SXG A;  4HOC A;  5C4B A;  1ZCY A;  4MYB A;  1V84 A;  1H7E A;  3TQD A;  5I1F A;  2WAW A;  1FGX A;  4Y7G A;  4DEC A;  5AJN A;  1JV1 A;  3RMV A;  2X60 A;  1JV3 A;  5AJO A;  4G3Q A;  1TW5 A;  2Y4J A;  4EEO A;  4B42 A;  1VH1 A;  1ZIZ A;  1G2V A;  5CMJ A;  2AE7 A;  5FUH A;  4FRD A;  2RIT A;  3SXD A;  2PGY A;  3V8Y A;  3PKP A;  3O3P A;  5FU8 A;  3JTJ A;  4KPZ A;  4B2W A;  2AH9 A;  2RIX A;  2Q4J A;  1H5S D;  1PZT A;  2RJ8 A;  1NF5 B;  5AJP A;  3V0P A;  1LVW A;  2OI5 A;  4D11 C;  2XWL A;  4AC3 A;  2JCL A;  3ZLK A;  3I0C A;  4Y7U A;  4HO0 A;  4M2B A;  1FRW A;  3FWW A;  3ZLL A;  1NMM B;  2ZU8 A;  2YES A;  3CKQ A;  2OEF A;  1H7F A;  3USR A;  1ZJ2 A;  3U0Y A;  2PX7 A;  3PKQ A;  1G3L A;  4FRH A;  1LL2 A;  1H4D A;  2ICX A;  1O23 B;  3RMW A;  3Q7U A;  4KRV A;  1JYK A;  2PA4 A;  4JIS A;  4KC2 A;  2FYA A;  1R7Y A;  3F1Y A;  3POL A;  3SX5 A;  2VS4 A;  2RJ0 A;  2DPW A;  3CKJ A;  4Q7C A;  3I0L A;  2ZU9 A;  1FOA A;  1VZT A;  1YP4 A;  4ASY A;  3D98 A;  1K4V A;  5C3D A;  1KWS A;  1O7Q A;  2WVL A;  4M2A A;  1HV9 A;  4IRQ A;  1V83 A;  3U2T A;  1Z90 A;  1R80 A;  4KNX A;  5CMF X;  4B5B A;  5EJ1 A;  3DJ4 A;  4Y64 A;  1LZ0 A;  4B4M A;  2OI6 A;  4AYL A;  5EIY A;  1NHE B;  2P72 A;  3BCV A;  4KNR A;  2RJ4 A;  4FIX A;  3V8Z A;  5CQL X;  5BXC A;  1ZI3 A;  2GGO A;  2E3D A;  2VSH A;  3N9W A;  2YQS A;  5FV9 A;  1QGS A;  1FR8 A;  1MP3 A;  2Y4K A;  1LZJ A;  1VGT A;  2XME A;  1W57 A;  2VXL A;  3V0M A;  2WE9 A;  2A8W A;  3I0E A;  1HM8 A;  2RJ7 A;  5C36 A;  1FXO A;  3F1C A;  4LW3 A;  1QWJ A;  1R7X A;  4HO6 A;  1NKH B;  2PGV A;  3OH0 A;  4IRP A;  1S4O A;  4HG6 A;  4FRL A;  4NAK A;  5IDT A;  4B4B A;  1GWW A;  1EYR A; 
#chains in the Genus database with same CATH homology
 4M4K A;  1ZI1 A;  5C48 A;  2V0H A;  2XWM A;  4K6R A;  5D92 A;  1OMZ A;  1G0R A;  2GGQ A;  1G93 A;  5HS2 A;  5CQM X;  4UEG A;  4Y7T A;  5C47 A;  1WVC A;  5IFY A;  5C1H A;  1FZW A;  3SX8 A;  1QG8 A;  2QH5 A;  2YQJ A;  1MC3 A;  5CQO A;  4R7P A;  1H5S B;  4MND A;  3ZF8 A;  2OEG A;  4HO4 A;  2JCO A;  5CQP A;  3K8D A;  3T7O A;  5DDT A;  5C3A A;  1VH3 A;  3QVB A;  2AM3 A;  1EZI A;  1FO9 A;  3OAM A;  3OH1 A;  5FU0 A;  1H7T A;  4LW6 A;  2YQH A;  3D8V A;  2FFV A;  3I0K A;  1QGQ A;  5IDS A;  4D0T A;  2I7B A;  1WT2 A;  3Q4S A;  5C49 A;  3U2U A;  4FRP A;  2D0J A;  2V0K A;  2D7R A;  3CU0 A;  2VD4 A;  4FRE A;  1H5S A;  4HO5 A;  1LL0 A;  4G3S A;  1ON8 A;  4EEA A;  2Y4M A;  1H7H A;  5C1G A;  2V0L A;  2FYB A;  4NAI A;  2APC A;  5D91 A;  2CU2 A;  3PNN A;  1H5R B;  1FGG A;  1OQM B;  4EEG A;  4ARW A;  4FCE A;  2RJ5 A;  4Y7V A;  1ZHJ A;  3SX3 A;  1H7G A;  3R3I A;  2I5K A;  2V0I A;  2J0B A;  3DUV A;  1YP3 A;  5C1L A;  4FRO A;  2BO7 A;  2FFU A;  2FY7 A;  3R2W A;  2JCJ A;  5C4E A;  3SXE A;  3V90 A;  1O7O A;  2X5S A;  4O6M A;  2XMH A;  4EE4 A;  1LZI A;  3Q80 A;  5C4C A;  3USQ A;  5C4F A;  1G8O A;  4O6N A;  4J18 A;  3KIA A;  3CKN A;  4NAN A;  5CMI A;  4E1K A;  5L6S A;  1H5R A;  3V91 A;  1FG5 N;  3E26 A;  1TZF A;  1O0R A;  1H3M A;  2BO6 A;  1WSZ A;  3IOH A;  1VZU A;  2Y7A A;  2YQC A;  4XWI A;  1YRO B;  2VK9 A;  1FR9 A;  3SPT A;  5CMH A;  3DK5 A;  3LW6 A;  4Y7F A;  1G9R A;  4B2X A;  4BQH A;  1H4C A;  1ZJP A;  3RSB A;  3V0L A;  3ZGG A;  1HJJ A;  2RJ1 A;  2Z87 A;  5C3B A;  1GA8 A;  3I0D A;  2ZU7 A;  1ZDG A;  1VM8 A;  1VGZ A;  2VS5 A;  2AES A;  4Y63 A;  1ZJ3 A;  5FTV A;  1MP4 A;  3IOJ A;  2C0N A;  5C4D A;  1VIC A;  1XZ6 A;  5EJZ A;  1NWG B;  2WVK A;  3OC9 A;  2VSI A;  2AEC A;  5CMG X;  1GQC A;  1VGU A;  1ZJ1 A;  2P6W A;  2VS3 A;  2YC3 A;  4FRQ A;  2JCK A;  3E25 A;  4FCU A;  1ON6 A;  1ZJ0 A;  1R82 A;  2WEE A;  2XWN A;  4B3U A;  2X5Z A;  1ZI4 A;  4HO8 A;  1INI A;  1LL3 A;  1H5S C;  4BMA A;  3U2V A;  4Y6U A;  5FTS A;  1TVY A;  3I0J A;  4KC4 A;  4Y62 A;  1PZY B;  3I0F A;  1VGW A;  1OMX A;  3OH4 A;  3I0I X;  4EE5 A;  4KQL A;  3V0Q A;  1FWY A;  4G3P A;  5CQN X;  2V0J A;  3I0H A;  2FYC B;  2WVM A;  4MIX A;  2QKX A;  2VXM A;  4AAW A;  4KC1 A;  2RIY A;  4G87 A;  1I52 A;  3SXC A;  1TW1 A;  4FRA A;  1INJ A;  3FOQ A;  1WT1 A;  2Y4L A;  5L6V A;  4KPX A;  1H5T A;  1ZCV A;  1ZCU A;  2W0W A;  2ICY A;  1JVD A;  1V82 A;  1VZX A;  1HM0 A;  2E8B A;  1LZ7 A;  4ASJ A;  1G97 A;  4NAL A;  1H4E A;  4FIY A;  1GX4 A;  4B4G A;  3SX7 A;  2Z86 A;  4P00 A;  5DDV A;  1FO8 A;  1S4P A;  1G95 A;  3CGX A;  3K8E A;  3CKO A;  2A8U A;  3OKR A;  1ZJO A;  2AM4 A;  1FXJ A;  2NXV A;  3I0G A;  1R7U A;  2MZB A;  4YS8 A;  2D7I A;  3U2X A;  1JVG A;  2BO4 A;  1WT0 A;  4FRB A;  1GQ9 A;  1NQI B;  1W77 A;  2QGI A;  2O1G A;  4Y6N A;  2OI7 A;  1IIN A;  1HM9 A;  1ZI5 A;  3BRK X;  2O1F A;  4KT7 A;  4D11 A;  1H7L A;  5JQQ A;  5C38 A;  1GWV A;  4ZDQ A;  1ZDF A;  2FYD B;  3GUE A;  4D48 A;  1MP5 A;  2WGZ A;  3TZT A;  3JUK A;  1SS9 A;  2J0A A;  3HL3 A;  2X65 A;  1IIM A;  3IOI A;  2AM5 A;  4HO2 A;  4EEM A;  4GBP A;  4HCQ A;  3OGZ A;  4FQW A;  4M28 A;  3JUJ A;  1WT3 A;  1ZCT A;  1XHB A;  3V0O A;  4HO3 A;  1W55 A;  1YP2 A;  4DDZ A;  2VFZ A;  4DE7 A;  3D5N A;  4C2S A;  2YCM A;  3SXA A;  4CJ8 A;  1R81 A;  1H7Q A;  4AYJ A;  3SXB A;  1GX0 A;  3OH3 A;  2UX8 A;  3U0X A;  2O1H A;  2Y6P A;  4D0Z A;  2W0V A;  4EE3 A;  5J49 A;  2YC5 A;  4CJB A;  3CKV A;  4CJC A;  3ZGF A;  1R7V A;  4JD0 A;  1E5K A;  4HO9 A;  1G1L A;  2I5E A;  2RJ9 A;  4L41 C;  2BO8 A;  1S4N A;  3OH2 A;  4FRM A;  3NGW A;  3T7N A;  3V0N A;  2RIZ A;  3U2W A;  1VPA A;  4KXO A;  1R7T A;  1G23 A;  1JYL A;  3EE5 A;  4ECM A;  3T7M A;  2RJ6 A;  2AGD A;  4P02 A;  5FYE A;  1H5T B;  4Y9X A;  5C8R A;  4EVW A;  4CVH A;  2P73 A;  3ST8 A;  1HJL A;  3SXG A;  4HOC A;  5C4B A;  1ZCY A;  4MYB A;  1V84 A;  1H7E A;  3TQD A;  5I1F A;  2WAW A;  1FGX A;  4Y7G A;  4DEC A;  5AJN A;  1JV1 A;  3RMV A;  2X60 A;  1JV3 A;  5AJO A;  4G3Q A;  1TW5 A;  2Y4J A;  4EEO A;  4B42 A;  1VH1 A;  1ZIZ A;  1G2V A;  5CMJ A;  2AE7 A;  5FUH A;  4FRD A;  2RIT A;  3SXD A;  2PGY A;  3V8Y A;  3PKP A;  3O3P A;  5FU8 A;  3JTJ A;  4KPZ A;  4B2W A;  2AH9 A;  2RIX A;  2Q4J A;  1H5S D;  1PZT A;  2RJ8 A;  1NF5 B;  5AJP A;  3V0P A;  1LVW A;  2OI5 A;  4D11 C;  2XWL A;  4AC3 A;  2JCL A;  3ZLK A;  3I0C A;  4Y7U A;  4HO0 A;  4M2B A;  1FRW A;  3FWW A;  3ZLL A;  1NMM B;  2ZU8 A;  2YES A;  3CKQ A;  2OEF A;  1H7F A;  3USR A;  1ZJ2 A;  3U0Y A;  2PX7 A;  3PKQ A;  1G3L A;  4FRH A;  1LL2 A;  1H4D A;  2ICX A;  1O23 B;  3RMW A;  3Q7U A;  4KRV A;  1JYK A;  2PA4 A;  4JIS A;  4KC2 A;  2FYA A;  1R7Y A;  3F1Y A;  3POL A;  3SX5 A;  2VS4 A;  2RJ0 A;  2DPW A;  3CKJ A;  4Q7C A;  3I0L A;  2ZU9 A;  1FOA A;  1VZT A;  1YP4 A;  4ASY A;  3D98 A;  1K4V A;  5C3D A;  1KWS A;  1O7Q A;  2WVL A;  4M2A A;  1HV9 A;  4IRQ A;  1V83 A;  3U2T A;  1Z90 A;  1R80 A;  4KNX A;  5CMF X;  4B5B A;  5EJ1 A;  3DJ4 A;  4Y64 A;  1LZ0 A;  4B4M A;  2OI6 A;  4AYL A;  5EIY A;  1NHE B;  2P72 A;  3BCV A;  4KNR A;  2RJ4 A;  4FIX A;  3V8Z A;  5CQL X;  5BXC A;  1ZI3 A;  2GGO A;  2E3D A;  2VSH A;  3N9W A;  2YQS A;  5FV9 A;  1QGS A;  1FR8 A;  1MP3 A;  2Y4K A;  1LZJ A;  1VGT A;  2XME A;  1W57 A;  2VXL A;  3V0M A;  2WE9 A;  2A8W A;  3I0E A;  1HM8 A;  2RJ7 A;  5C36 A;  1FXO A;  3F1C A;  4LW3 A;  1QWJ A;  1R7X A;  4HO6 A;  1NKH B;  2PGV A;  3OH0 A;  4IRP A;  1S4O A;  4HG6 A;  4FRL A;  4NAK A;  5IDT A;  4B4B A;  1GWW A;  1EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...