4Y7TA

Structural analysis of muru
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
218
Chain Sequence
MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFLLVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGDFRLVGEQVVDGDDPGTLTFSGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGERAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotidyl transferase
publication title Crystal Structure of the N-Acetylmuramic Acid alpha-1-Phosphate (MurNAc-alpha 1-P) Uridylyltransferase MurU, a Minimal Sugar Nucleotidyltransferase and Potential Drug Target Enzyme in Gram-negative Pathogens.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transferase
total genus 67
structure length 218
sequence length 224
ec nomenclature ec 2.7.7.99: N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y7tA00
2Y7AA 3I0KA 4AC3A 2AE7A 2XMHA 4M28A 1R7VA 1FR9A 2X65A 2XMEA 4NAKA 3OH1A 1H7HA 3ZGGA 4FCEA 2VS4A 2OI6A 4HOCA 2JCLA 2VXLA 4KXOA 2Y4KA 3I0LA 4LW6A 1WSZA 1I52A 3V91A 4B2WA 2APCA 4EE5A 2PGYA 3T7NA 1R81A 1R80A 4Y7VA 2RJ7A 4FRMA 1ZI4A 4B3UA 2RIZA 2FYCB 2AM4A 2A8UA 2W0WA 1IINA 2JCKA 3JTJA 1R7TA 5CMFX 3NGWA 1LL0A 5EJ1A 2FYDB 1H4CA 1MP5A 1QGSA 1ZHJA 2D7IA 3SX7A 3E25A 4EEMA 3I0DA 5AJPA 4EEAA 1FWYA 2AM3A 5C48A 1TW5A 3F1CA 1LL3A 2V0LA 2FFUA 3SX5A 1FXOA 3F1YA 4FQWA 3POLA 1QWJA 3OH2A 1H5TB 4Y9XA 4G3QA 1SS9A 1O23B 4HO5A 1H7TA 2VS5A 5IDTA 2OI5A 1FOAA 4G3SA 1R7YA 3OKRA 2DPWA 3OAMA 3TQDA 3CKQA 2MZBA 3V0PA 3QVBA 5CQPA 1H5TA 1E5KA 1ON8A 4HO8A 3Q4SA 4HO4A 1ZJPA 3N9WA 1O0RA 2YQSA 1ZJOA 1FGXA 4CJ8A 3CKJA 1LL2A 5CQOA 2Z87A 1FG5N 5FTSA 4AAWA 4CJCA 1GWVA 3DK5A 3USRA 2PGVA 1VICA 2OEGA 1FR8A 2YCMA 1VGZA 2O1FA 5C3AA 2RJ1A 4KT7A 3FWWA 2RIYA 5JQQA 2WE9A 2YC5A 1FXJA 2YC3A 1OMZA 2Y6PA 1WT2A 3CKVA 3PKPA 5FV9A 2V0IA 1G9RA 2V0HA 2A8WA 2YQHA 2QKXA 1Z90A 1PZTA 3USQA 1R7UA 3KIAA 4Y6UA 1S4PA 5FU8A 4FRDA 4B2XA 2RJ9A 2YQCA 4ECMA 5C3DA 1ZCVA 5CMHA 3GUEA 5I1FA 5C1LA 2FYBA 5C38A 4KPZA 2AESA 5C1HA 4ASJA 1NHEB 1VGWA 3OC9A 3ZLLA 2WEEA 2BO7A 4D48A 1R7XA 3Q7UA 3I0JA 3T7OA 3V8ZA 3LW6A 4HCQA 1OMXA 5FU0A 3D98A 5HS2A 3I0IX 1ZDGA 1VPAA 3DJ4A 1XHBA 1HM8A 4FRHA 2ZU7A 2RITA 4Y6NA 4JD0A 2RJ0A 3V90A 4G3PA 2Y4LA 4M2BA 1OQMB 1IIMA 2WAWA 1H7GA 4JISA 3PNNA 4Y63A 5CMJA 1G1LA 3R2WA 1G0RA 4BMAA 1QGQA 1W55A 1YROB 4KC2A 3SXEA 3D5NA 3E26A 5C4BA 2PX7A 1V84A 2Y4JA 1JV3A 2RIXA 3U0XA 1ZJ1A 3V0NA 3SX8A 4CVHA 2FY7A 3ZLKA 4KRVA 4KC1A 1G8OA 1GQ9A 1QG8A 2GGQA 3T7MA 4MNDA 3JUJA 2X5ZA 1G95A 1YP2A 5CQMX 5FTVA 1H7QA 4C2SA 4EE3A 1INJA 1H7EA 4B42A 3SXAA 1GX4A 1H4EA 4Y7UA 3SPTA 4ZDQA 4B5BA 1ZJ0A 2XWNA 3SXGA 1FGGA 2P6WA 3CGXA 1MC3A 1VZTA 1GWWA 2BO8A 1TVYA 1JYLA 1ZDFA 1EYRA 5C3BA 1VGTA 3FOQA 3RSBA 1TW1A 1LZ0A 4HO0A 1KWSA 5CQNX 5J49A 1ZI3A 5L6VA 2QH5A 4HO9A 4HG6A 3U2VA 2O1HA 5EJZA 1VGUA 3K8EA 1ZCTA 4GBPA 1FZWA 3U2UA 1JVGA 1ZIZA 5L6SA 1MP4A 2FFVA 4FREA 1S4OA 3V0QA 1ZI1A 2P73A 3V8YA 1GQCA 3I0HA 4D11C 3BRKX 2E8BA 2BO4A 3IOHA 1ZCUA 4ASYA 1GX0A 1NMMB 4FROA 4AYJA 1ZCYA 1JYKA 3U2XA 1VZUA 2GGOA 2Y4MA 5FUHA 5EIYA 5C36A 2V0JA 4D0ZA 1HJLA 4KPXA 5C49A 3CKOA 2W0VA 3PKQA 4YS8A 5C4FA 4D11A 1H5RB 2ZU9A 3OH4A 1WT0A 4DE7A 2VSHA 1EZIA 1H5SD 4R7PA 3IOJA 1S4NA 2OEFA 4Y7FA 4HO3A 2WVMA 5AJOA 1H5RA 4EE4A 3OH0A 3U0YA 1ON6A 2V0KA 1R82A 2P72A 5C47A 2ICXA 5CQLX 3I0GA 2AECA 3TZTA 4B4GA 4FRQA 2X60A 1TZFA 4FCUA 5AJNA 4P02A 1ZI5A 1JVDA 1G23A 5FYEA 1W57A 3V0OA 3V0LA 1H4DA 5C1GA 4K6RA 2WVKA 3O3PA 1H5SC 3Q80A 2VXMA 2FYAA 2D0JA 1VZXA 1G97A 1HM9A 4MYBA 2RJ8A 1H5SB 4XWIA 4IRPA 3CU0A 5IFYA 1VM8A 2VD4A 2I5EA 1H7LA 4NALA 3CKNA 2I7BA 1H5SA 1NQIB 2ZU8A 4KC4A 2JCJA 3ZF8A 4DECA 2AM5A 1MP3A 4UEGA 1WT3A 2NXVA 3HL3A 2WGZA 2RJ6A 2RJ4A 3I0FA 2AGDA 2RJ5A 3OGZA 5BXCA 1WVCA 2Q4JA 3ZGFA 1ZJ3A 2UX8A 1LZIA 4CJBA 2WVLA 1XZ6A 1VH3A 2AH9A 1NF5B 4M2AA 3RMWA 3RMVA 4ARWA 2QGIA 1GA8A 2E3DA 1G2VA 4G87A 5C4EA 4FRAA 3JUKA 2XWLA 5C4CA 3R3IA 1W77A 1HM0A 4B4BA 1FO9A 4FRLA 5DDVA 4D0TA 1YP4A 3EE5A 4DDZA 1VH1A 2OI7A 2BO6A 1HV9A 5C4DA 1ZJ2A 1K4VA 2JCOA 4E1KA 1O7QA 4NANA 2XWMA 2CU2A 1WT1A 2PA4A 4FRPA 5DDTA 3U2TA 1G93A 3BCVA 4Y7GA 4Y64A 4EEOA 2VS3A 3ST8A 1V82A 5CMGX 4AYLA 4KQLA 1H7FA 3I0EA 4Y7TA 4NAIA 3D8VA 4HO2A 2VFZA 2O1GA 4P00A 1NWGB 4LW3A 3OH3A 5C8RA 4J18A 1FO8A 4EVWA 5IDSA 1PZYB 3SXCA 4M4KA 4Y62A 3SXBA 2ICYA 1V83A 4HO6A 3U2WA 1G3LA 2I5KA 1YP3A 3K8DA 1FRWA 1H3MA 1LVWA 3SX3A 4FRBA 4EEGA 2VSIA 2D7RA 3DUVA 1LZ7A 3I0CA 4L41C 2YESA 1NKHB 4BQHA 1O7OA 4KNRA 3SXDA 4KNXA 4IRQA 3V0MA 1LZJA 2Z86A 3IOIA 1HJJA 4B4MA 5CMIA 2X5SA 1INIA 2YQJA 1JV1A
chains in the Genus database with same CATH superfamily
2Y7AA 3I0KA 4AC3A 2AE7A 2XMHA 4M28A 1R7VA 1FR9A 2X65A 2XMEA 4NAKA 3OH1A 1H7HA 3ZGGA 4FCEA 2VS4A 2OI6A 4HOCA 2JCLA 2VXLA 4KXOA 2C0NA 2Y4KA 3I0LA 4LW6A 1WSZA 1I52A 3V91A 4B2WA 2APCA 4EE5A 2PGYA 3T7NA 1R81A 1R80A 4Y7VA 2RJ7A 4FRMA 1ZI4A 4B3UA 2RIZA 2FYCB 2AM4A 2A8UA 2W0WA 1IINA 2JCKA 3JTJA 1R7TA 5CMFX 3NGWA 1LL0A 5EJ1A 2FYDB 1H4CA 1MP5A 1QGSA 1ZHJA 2D7IA 3SX7A 3E25A 4EEMA 3I0DA 5AJPA 4Q7CA 4EEAA 1FWYA 2AM3A 5C48A 2VK9A 1TW5A 3F1CA 1LL3A 2V0LA 2FFUA 3SX5A 1FXOA 3F1YA 4FQWA 3POLA 1QWJA 3OH2A 1H5TB 4Y9XA 4G3QA 1SS9A 1O23B 4HO5A 1H7TA 2VS5A 5IDTA 2OI5A 1FOAA 4G3SA 1R7YA 3OKRA 2DPWA 3OAMA 3TQDA 3CKQA 2MZBA 3V0PA 3QVBA 5CQPA 1H5TA 1E5KA 1ON8A 4HO8A 3Q4SA 4HO4A 1ZJPA 2J0AA 3N9WA 1O0RA 2YQSA 1ZJOA 1FGXA 4CJ8A 3CKJA 1LL2A 5CQOA 2Z87A 1FG5N 5FTSA 4AAWA 4CJCA 1GWVA 3DK5A 3USRA 4O6MA 2PGVA 1VICA 2OEGA 1FR8A 2YCMA 1VGZA 2O1FA 5C3AA 2RJ1A 4KT7A 3FWWA 2RIYA 5JQQA 2WE9A 2YC5A 1FXJA 2YC3A 1OMZA 2Y6PA 1WT2A 3CKVA 3PKPA 5FV9A 2V0IA 1G9RA 2V0HA 2A8WA 2YQHA 2QKXA 1Z90A 1PZTA 3USQA 1R7UA 3KIAA 4Y6UA 1S4PA 5FU8A 4FRDA 4B2XA 2RJ9A 2YQCA 4ECMA 5C3DA 1ZCVA 5CMHA 3GUEA 5I1FA 5C1LA 2FYBA 5C38A 4KPZA 2AESA 5C1HA 4FIYA 1NHEB 4ASJA 1VGWA 3OC9A 3ZLLA 2WEEA 2BO7A 4D48A 1R7XA 3Q7UA 3I0JA 3T7OA 3V8ZA 3LW6A 4HCQA 1OMXA 5FU0A 3D98A 5HS2A 3I0IX 1ZDGA 1VPAA 3DJ4A 1XHBA 1HM8A 4FRHA 2ZU7A 2RITA 4Y6NA 4JD0A 2RJ0A 3V90A 4G3PA 2Y4LA 4M2BA 1OQMB 1IIMA 2WAWA 1H7GA 4JISA 3PNNA 4Y63A 5CMJA 1G1LA 3R2WA 1G0RA 4BMAA 1QGQA 1W55A 1YROB 4KC2A 3SXEA 3D5NA 3E26A 5C4BA 2PX7A 1V84A 2Y4JA 1JV3A 2RIXA 3U0XA 1ZJ1A 3V0NA 3SX8A 4CVHA 2FY7A 3ZLKA 4KRVA 4KC1A 1G8OA 1GQ9A 1QG8A 2GGQA 3T7MA 4MNDA 3JUJA 2X5ZA 1G95A 1YP2A 5CQMX 5FTVA 1H7QA 4C2SA 4EE3A 1INJA 1H7EA 4B42A 3SXAA 1GX4A 1H4EA 4Y7UA 3SPTA 4ZDQA 4B5BA 1ZJ0A 2XWNA 3SXGA 1FGGA 2P6WA 3CGXA 1MC3A 1VZTA 1GWWA 2BO8A 1TVYA 1JYLA 1ZDFA 5D91A 1EYRA 5C3BA 1VGTA 3FOQA 3RSBA 1TW1A 1LZ0A 4HO0A 1KWSA 5CQNX 5J49A 1ZI3A 4MIXA 5L6VA 2QH5A 4HO9A 4HG6A 3U2VA 2O1HA 5EJZA 1VGUA 3K8EA 1ZCTA 4GBPA 1FZWA 3U2UA 1JVGA 1ZIZA 5L6SA 1MP4A 2FFVA 4FREA 1S4OA 3V0QA 1ZI1A 2P73A 3V8YA 1GQCA 3I0HA 4D11C 3BRKX 2E8BA 2BO4A 3IOHA 1ZCUA 4ASYA 1GX0A 1NMMB 4FROA 4AYJA 1ZCYA 1JYKA 3U2XA 1VZUA 2GGOA 2Y4MA 5FUHA 5EIYA 5C36A 2V0JA 4D0ZA 1HJLA 4KPXA 5C49A 3CKOA 2W0VA 3PKQA 4YS8A 5C4FA 4D11A 1H5RB 2ZU9A 3OH4A 1WT0A 4DE7A 2VSHA 1EZIA 1H5SD 4R7PA 3IOJA 1S4NA 2OEFA 4Y7FA 4HO3A 2WVMA 5AJOA 1H5RA 4EE4A 3OH0A 3U0YA 1ON6A 2V0KA 1R82A 2P72A 5C47A 2ICXA 5CQLX 3I0GA 2AECA 3TZTA 4B4GA 4FRQA 2X60A 1TZFA 4FCUA 5AJNA 4P02A 1ZI5A 1JVDA 1G23A 5FYEA 1W57A 3V0OA 3V0LA 1H4DA 5C1GA 4K6RA 2WVKA 3O3PA 1H5SC 3Q80A 2VXMA 2FYAA 2D0JA 2J0BA 1VZXA 1G97A 1HM9A 4MYBA 2RJ8A 1H5SB 4XWIA 4IRPA 3CU0A 5IFYA 1VM8A 2VD4A 2I5EA 1H7LA 4NALA 3CKNA 2I7BA 1H5SA 1NQIB 2ZU8A 4KC4A 2JCJA 3ZF8A 4DECA 2AM5A 1MP3A 4UEGA 5D92A 1WT3A 2NXVA 3HL3A 2WGZA 2RJ6A 2RJ4A 3I0FA 2AGDA 2RJ5A 3OGZA 5BXCA 1WVCA 2Q4JA 3ZGFA 1ZJ3A 2UX8A 1LZIA 4CJBA 2WVLA 1XZ6A 1VH3A 2AH9A 1NF5B 4M2AA 3RMWA 3RMVA 4ARWA 2QGIA 1GA8A 2E3DA 1G2VA 4G87A 5C4EA 4FRAA 3JUKA 2XWLA 5C4CA 3R3IA 1W77A 1HM0A 4B4BA 1FO9A 4FRLA 5DDVA 4D0TA 1YP4A 3EE5A 4DDZA 1VH1A 2OI7A 2BO6A 1HV9A 5C4DA 1ZJ2A 1K4VA 2JCOA 4E1KA 1O7QA 4NANA 2XWMA 2CU2A 1WT1A 2PA4A 4FRPA 5DDTA 3U2TA 1G93A 3BCVA 4Y7GA 4Y64A 4EEOA 2VS3A 3ST8A 1V82A 5CMGX 4AYLA 4KQLA 1H7FA 3I0EA 4Y7TA 4NAIA 3D8VA 4HO2A 4FIXA 2VFZA 2O1GA 4P00A 1NWGB 4LW3A 3OH3A 5C8RA 4J18A 1FO8A 4EVWA 5IDSA 1PZYB 3SXCA 4M4KA 4Y62A 3SXBA 2ICYA 1V83A 4HO6A 3U2WA 1G3LA 2I5KA 1YP3A 3K8DA 1FRWA 1H3MA 1LVWA 3SX3A 4FRBA 4EEGA 2VSIA 2D7RA 3DUVA 1LZ7A 3I0CA 4L41C 2YESA 1NKHB 4BQHA 1O7OA 4KNRA 3SXDA 4O6NA 4KNXA 4IRQA 3V0MA 1LZJA 2Z86A 3IOIA 1HJJA 4B4MA 5CMIA 2X5SA 1INIA 2YQJA 1JV1A
chains in the Genus database with same CATH topology
2Y7AA 3I0KA 4AC3A 2AE7A 2XMHA 4M28A 1R7VA 1FR9A 2X65A 2XMEA 4NAKA 3OH1A 1H7HA 3ZGGA 4FCEA 2VS4A 2OI6A 4HOCA 2JCLA 2VXLA 4KXOA 2C0NA 2Y4KA 3I0LA 4LW6A 1WSZA 1I52A 3V91A 4B2WA 2APCA 4EE5A 2PGYA 3T7NA 1R81A 1R80A 4Y7VA 2RJ7A 4FRMA 1ZI4A 4B3UA 2RIZA 2FYCB 2AM4A 2A8UA 2W0WA 1IINA 2JCKA 3JTJA 1R7TA 5CMFX 3NGWA 1LL0A 5EJ1A 2FYDB 1H4CA 1MP5A 1QGSA 1ZHJA 2D7IA 3SX7A 3E25A 4EEMA 3I0DA 5AJPA 4Q7CA 4EEAA 1FWYA 2AM3A 5C48A 2VK9A 1TW5A 3F1CA 1LL3A 2V0LA 2FFUA 3SX5A 1FXOA 3F1YA 4FQWA 3POLA 1QWJA 3OH2A 1H5TB 4Y9XA 4G3QA 1SS9A 1O23B 4HO5A 1H7TA 2VS5A 5IDTA 2OI5A 1FOAA 4G3SA 1R7YA 3OKRA 2DPWA 3OAMA 3TQDA 3CKQA 2MZBA 3V0PA 3QVBA 5CQPA 1H5TA 1E5KA 1ON8A 4HO8A 3Q4SA 4HO4A 1ZJPA 2J0AA 3N9WA 1O0RA 2YQSA 1ZJOA 1FGXA 4CJ8A 3CKJA 1LL2A 5CQOA 2Z87A 1FG5N 5FTSA 4AAWA 4CJCA 1GWVA 3DK5A 3USRA 4O6MA 2PGVA 1VICA 2OEGA 1FR8A 2YCMA 1VGZA 2O1FA 5C3AA 2RJ1A 4KT7A 3FWWA 2RIYA 5JQQA 2WE9A 2YC5A 1FXJA 2YC3A 1OMZA 2Y6PA 1WT2A 3CKVA 3PKPA 5FV9A 2V0IA 1G9RA 2V0HA 2A8WA 2YQHA 2QKXA 1Z90A 1PZTA 3USQA 1R7UA 3KIAA 4Y6UA 1S4PA 5FU8A 4FRDA 4B2XA 2RJ9A 2YQCA 4ECMA 5C3DA 1ZCVA 5CMHA 3GUEA 5I1FA 5C1LA 2FYBA 5C38A 4KPZA 2AESA 5C1HA 4FIYA 1NHEB 4ASJA 1VGWA 3OC9A 3ZLLA 2WEEA 2BO7A 4D48A 1R7XA 3Q7UA 3I0JA 3T7OA 3V8ZA 3LW6A 4HCQA 1OMXA 5FU0A 3D98A 5HS2A 3I0IX 1ZDGA 1VPAA 3DJ4A 1XHBA 1HM8A 4FRHA 2ZU7A 2RITA 4Y6NA 4JD0A 2RJ0A 3V90A 4G3PA 2Y4LA 4M2BA 1OQMB 1IIMA 2WAWA 1H7GA 4JISA 3PNNA 4Y63A 5CMJA 1G1LA 3R2WA 1G0RA 4BMAA 1QGQA 1W55A 1YROB 4KC2A 3SXEA 3D5NA 3E26A 5C4BA 2PX7A 1V84A 2Y4JA 1JV3A 2RIXA 3U0XA 1ZJ1A 3V0NA 3SX8A 4CVHA 2FY7A 3ZLKA 4KRVA 4KC1A 1G8OA 1GQ9A 1QG8A 2GGQA 3T7MA 4MNDA 3JUJA 2X5ZA 1G95A 1YP2A 5CQMX 5FTVA 1H7QA 4C2SA 4EE3A 1INJA 1H7EA 4B42A 3SXAA 1GX4A 1H4EA 4Y7UA 3SPTA 4ZDQA 4B5BA 1ZJ0A 2XWNA 3SXGA 1FGGA 2P6WA 3CGXA 1MC3A 1VZTA 1GWWA 2BO8A 1TVYA 1JYLA 1ZDFA 5D91A 1EYRA 5C3BA 1VGTA 3FOQA 3RSBA 1TW1A 1LZ0A 4HO0A 1KWSA 5CQNX 5J49A 1ZI3A 4MIXA 5L6VA 2QH5A 4HO9A 4HG6A 3U2VA 2O1HA 5EJZA 1VGUA 3K8EA 1ZCTA 4GBPA 1FZWA 3U2UA 1JVGA 1ZIZA 5L6SA 1MP4A 2FFVA 4FREA 1S4OA 3V0QA 1ZI1A 2P73A 3V8YA 1GQCA 3I0HA 4D11C 3BRKX 2E8BA 2BO4A 3IOHA 1ZCUA 4ASYA 1GX0A 1NMMB 4FROA 4AYJA 1ZCYA 1JYKA 3U2XA 1VZUA 2GGOA 2Y4MA 5FUHA 5EIYA 5C36A 2V0JA 4D0ZA 1HJLA 4KPXA 5C49A 3CKOA 2W0VA 3PKQA 4YS8A 5C4FA 4D11A 1H5RB 2ZU9A 3OH4A 1WT0A 4DE7A 2VSHA 1EZIA 1H5SD 4R7PA 3IOJA 1S4NA 2OEFA 4Y7FA 4HO3A 2WVMA 5AJOA 1H5RA 4EE4A 3OH0A 3U0YA 1ON6A 2V0KA 1R82A 2P72A 5C47A 2ICXA 5CQLX 3I0GA 2AECA 3TZTA 4B4GA 4FRQA 2X60A 1TZFA 4FCUA 5AJNA 4P02A 1ZI5A 1JVDA 1G23A 5FYEA 1W57A 3V0OA 3V0LA 1H4DA 5C1GA 4K6RA 2WVKA 3O3PA 1H5SC 3Q80A 2VXMA 2FYAA 2D0JA 2J0BA 1VZXA 1G97A 1HM9A 4MYBA 2RJ8A 1H5SB 4XWIA 4IRPA 3CU0A 5IFYA 1VM8A 2VD4A 2I5EA 1H7LA 4NALA 3CKNA 2I7BA 1H5SA 1NQIB 2ZU8A 4KC4A 2JCJA 3ZF8A 4DECA 2AM5A 1MP3A 4UEGA 5D92A 1WT3A 2NXVA 3HL3A 2WGZA 2RJ6A 2RJ4A 3I0FA 2AGDA 2RJ5A 3OGZA 5BXCA 1WVCA 2Q4JA 3ZGFA 1ZJ3A 2UX8A 1LZIA 4CJBA 2WVLA 1XZ6A 1VH3A 2AH9A 1NF5B 4M2AA 3RMWA 3RMVA 4ARWA 2QGIA 1GA8A 2E3DA 1G2VA 4G87A 5C4EA 4FRAA 3JUKA 2XWLA 5C4CA 3R3IA 1W77A 1HM0A 4B4BA 1FO9A 4FRLA 5DDVA 4D0TA 1YP4A 3EE5A 4DDZA 1VH1A 2OI7A 2BO6A 1HV9A 5C4DA 1ZJ2A 1K4VA 2JCOA 4E1KA 1O7QA 4NANA 2XWMA 2CU2A 1WT1A 2PA4A 4FRPA 5DDTA 3U2TA 1G93A 3BCVA 4Y7GA 4Y64A 4EEOA 2VS3A 3ST8A 1V82A 5CMGX 4AYLA 4KQLA 1H7FA 3I0EA 4Y7TA 4NAIA 3D8VA 4HO2A 4FIXA 2VFZA 2O1GA 4P00A 1NWGB 4LW3A 3OH3A 5C8RA 4J18A 1FO8A 4EVWA 5IDSA 1PZYB 3SXCA 4M4KA 4Y62A 3SXBA 2ICYA 1V83A 4HO6A 3U2WA 1G3LA 2I5KA 1YP3A 3K8DA 1FRWA 1H3MA 1LVWA 3SX3A 4FRBA 4EEGA 2VSIA 2D7RA 3DUVA 1LZ7A 3I0CA 4L41C 2YESA 1NKHB 4BQHA 1O7OA 4KNRA 3SXDA 4O6NA 4KNXA 4IRQA 3V0MA 1LZJA 2Z86A 3IOIA 1HJJA 4B4MA 5CMIA 2X5SA 1INIA 2YQJA 1JV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7A A;  3I0K A;  4AC3 A;  2AE7 A;  2XMH A;  4M28 A;  1R7V A;  1FR9 A;  2X65 A;  2XME A;  4NAK A;  3OH1 A;  1H7H A;  3ZGG A;  4FCE A;  2VS4 A;  2OI6 A;  4HOC A;  2JCL A;  2VXL A;  4KXO A;  2Y4K A;  3I0L A;  4LW6 A;  1WSZ A;  1I52 A;  3V91 A;  4B2W A;  2APC A;  4EE5 A;  2PGY A;  3T7N A;  1R81 A;  1R80 A;  4Y7V A;  2RJ7 A;  4FRM A;  1ZI4 A;  4B3U A;  2RIZ A;  2FYC B;  2AM4 A;  2A8U A;  2W0W A;  1IIN A;  2JCK A;  3JTJ A;  1R7T A;  5CMF X;  3NGW A;  1LL0 A;  5EJ1 A;  2FYD B;  1H4C A;  1MP5 A;  1QGS A;  1ZHJ A;  2D7I A;  3SX7 A;  3E25 A;  4EEM A;  3I0D A;  5AJP A;  4EEA A;  1FWY A;  2AM3 A;  5C48 A;  1TW5 A;  3F1C A;  1LL3 A;  2V0L A;  2FFU A;  3SX5 A;  1FXO A;  3F1Y A;  4FQW A;  3POL A;  1QWJ A;  3OH2 A;  1H5T B;  4Y9X A;  4G3Q A;  1SS9 A;  1O23 B;  4HO5 A;  1H7T A;  2VS5 A;  5IDT A;  2OI5 A;  1FOA A;  4G3S A;  1R7Y A;  3OKR A;  2DPW A;  3OAM A;  3TQD A;  3CKQ A;  2MZB A;  3V0P A;  3QVB A;  5CQP A;  1H5T A;  1E5K A;  1ON8 A;  4HO8 A;  3Q4S A;  4HO4 A;  1ZJP A;  3N9W A;  1O0R A;  2YQS A;  1ZJO A;  1FGX A;  4CJ8 A;  3CKJ A;  1LL2 A;  5CQO A;  2Z87 A;  1FG5 N;  5FTS A;  4AAW A;  4CJC A;  1GWV A;  3DK5 A;  3USR A;  2PGV A;  1VIC A;  2OEG A;  1FR8 A;  2YCM A;  1VGZ A;  2O1F A;  5C3A A;  2RJ1 A;  4KT7 A;  3FWW A;  2RIY A;  5JQQ A;  2WE9 A;  2YC5 A;  1FXJ A;  2YC3 A;  1OMZ A;  2Y6P A;  1WT2 A;  3CKV A;  3PKP A;  5FV9 A;  2V0I A;  1G9R A;  2V0H A;  2A8W A;  2YQH A;  2QKX A;  1Z90 A;  1PZT A;  3USQ A;  1R7U A;  3KIA A;  4Y6U A;  1S4P A;  5FU8 A;  4FRD A;  4B2X A;  2RJ9 A;  2YQC A;  4ECM A;  5C3D A;  1ZCV A;  5CMH A;  3GUE A;  5I1F A;  5C1L A;  2FYB A;  5C38 A;  4KPZ A;  2AES A;  5C1H A;  4ASJ A;  1NHE B;  1VGW A;  3OC9 A;  3ZLL A;  2WEE A;  2BO7 A;  4D48 A;  1R7X A;  3Q7U A;  3I0J A;  3T7O A;  3V8Z A;  3LW6 A;  4HCQ A;  1OMX A;  5FU0 A;  3D98 A;  5HS2 A;  3I0I X;  1ZDG A;  1VPA A;  3DJ4 A;  1XHB A;  1HM8 A;  4FRH A;  2ZU7 A;  2RIT A;  4Y6N A;  4JD0 A;  2RJ0 A;  3V90 A;  4G3P A;  2Y4L A;  4M2B A;  1OQM B;  1IIM A;  2WAW A;  1H7G A;  4JIS A;  3PNN A;  4Y63 A;  5CMJ A;  1G1L A;  3R2W A;  1G0R A;  4BMA A;  1QGQ A;  1W55 A;  1YRO B;  4KC2 A;  3SXE A;  3D5N A;  3E26 A;  5C4B A;  2PX7 A;  1V84 A;  2Y4J A;  1JV3 A;  2RIX A;  3U0X A;  1ZJ1 A;  3V0N A;  3SX8 A;  4CVH A;  2FY7 A;  3ZLK A;  4KRV A;  4KC1 A;  1G8O A;  1GQ9 A;  1QG8 A;  2GGQ A;  3T7M A;  4MND A;  3JUJ A;  2X5Z A;  1G95 A;  1YP2 A;  5CQM X;  5FTV A;  1H7Q A;  4C2S A;  4EE3 A;  1INJ A;  1H7E A;  4B42 A;  3SXA A;  1GX4 A;  1H4E A;  4Y7U A;  3SPT A;  4ZDQ A;  4B5B A;  1ZJ0 A;  2XWN A;  3SXG A;  1FGG A;  2P6W A;  3CGX A;  1MC3 A;  1VZT A;  1GWW A;  2BO8 A;  1TVY A;  1JYL A;  1ZDF A;  1EYR A;  5C3B A;  1VGT A;  3FOQ A;  3RSB A;  1TW1 A;  1LZ0 A;  4HO0 A;  1KWS A;  5CQN X;  5J49 A;  1ZI3 A;  5L6V A;  2QH5 A;  4HO9 A;  4HG6 A;  3U2V A;  2O1H A;  5EJZ A;  1VGU A;  3K8E A;  1ZCT A;  4GBP A;  1FZW A;  3U2U A;  1JVG A;  1ZIZ A;  5L6S A;  1MP4 A;  2FFV A;  4FRE A;  1S4O A;  3V0Q A;  1ZI1 A;  2P73 A;  3V8Y A;  1GQC A;  3I0H A;  4D11 C;  3BRK X;  2E8B A;  2BO4 A;  3IOH A;  1ZCU A;  4ASY A;  1GX0 A;  1NMM B;  4FRO A;  4AYJ A;  1ZCY A;  1JYK A;  3U2X A;  1VZU A;  2GGO A;  2Y4M A;  5FUH A;  5EIY A;  5C36 A;  2V0J A;  4D0Z A;  1HJL A;  4KPX A;  5C49 A;  3CKO A;  2W0V A;  3PKQ A;  4YS8 A;  5C4F A;  4D11 A;  1H5R B;  2ZU9 A;  3OH4 A;  1WT0 A;  4DE7 A;  2VSH A;  1EZI A;  1H5S D;  4R7P A;  3IOJ A;  1S4N A;  2OEF A;  4Y7F A;  4HO3 A;  2WVM A;  5AJO A;  1H5R A;  4EE4 A;  3OH0 A;  3U0Y A;  1ON6 A;  2V0K A;  1R82 A;  2P72 A;  5C47 A;  2ICX A;  5CQL X;  3I0G A;  2AEC A;  3TZT A;  4B4G A;  4FRQ A;  2X60 A;  1TZF A;  4FCU A;  5AJN A;  4P02 A;  1ZI5 A;  1JVD A;  1G23 A;  5FYE A;  1W57 A;  3V0O A;  3V0L A;  1H4D A;  5C1G A;  4K6R A;  2WVK A;  3O3P A;  1H5S C;  3Q80 A;  2VXM A;  2FYA A;  2D0J A;  1VZX A;  1G97 A;  1HM9 A;  4MYB A;  2RJ8 A;  1H5S B;  4XWI A;  4IRP A;  3CU0 A;  5IFY A;  1VM8 A;  2VD4 A;  2I5E A;  1H7L A;  4NAL A;  3CKN A;  2I7B A;  1H5S A;  1NQI B;  2ZU8 A;  4KC4 A;  2JCJ A;  3ZF8 A;  4DEC A;  2AM5 A;  1MP3 A;  4UEG A;  1WT3 A;  2NXV A;  3HL3 A;  2WGZ A;  2RJ6 A;  2RJ4 A;  3I0F A;  2AGD A;  2RJ5 A;  3OGZ A;  5BXC A;  1WVC A;  2Q4J A;  3ZGF A;  1ZJ3 A;  2UX8 A;  1LZI A;  4CJB A;  2WVL A;  1XZ6 A;  1VH3 A;  2AH9 A;  1NF5 B;  4M2A A;  3RMW A;  3RMV A;  4ARW A;  2QGI A;  1GA8 A;  2E3D A;  1G2V A;  4G87 A;  5C4E A;  4FRA A;  3JUK A;  2XWL A;  5C4C A;  3R3I A;  1W77 A;  1HM0 A;  4B4B A;  1FO9 A;  4FRL A;  5DDV A;  4D0T A;  1YP4 A;  3EE5 A;  4DDZ A;  1VH1 A;  2OI7 A;  2BO6 A;  1HV9 A;  5C4D A;  1ZJ2 A;  1K4V A;  2JCO A;  4E1K A;  1O7Q A;  4NAN A;  2XWM A;  2CU2 A;  1WT1 A;  2PA4 A;  4FRP A;  5DDT A;  3U2T A;  1G93 A;  3BCV A;  4Y7G A;  4Y64 A;  4EEO A;  2VS3 A;  3ST8 A;  1V82 A;  5CMG X;  4AYL A;  4KQL A;  1H7F A;  3I0E A;  4Y7T A;  4NAI A;  3D8V A;  4HO2 A;  2VFZ A;  2O1G A;  4P00 A;  1NWG B;  4LW3 A;  3OH3 A;  5C8R A;  4J18 A;  1FO8 A;  4EVW A;  5IDS A;  1PZY B;  3SXC A;  4M4K A;  4Y62 A;  3SXB A;  2ICY A;  1V83 A;  4HO6 A;  3U2W A;  1G3L A;  2I5K A;  1YP3 A;  3K8D A;  1FRW A;  1H3M A;  1LVW A;  3SX3 A;  4FRB A;  4EEG A;  2VSI A;  2D7R A;  3DUV A;  1LZ7 A;  3I0C A;  4L41 C;  2YES A;  1NKH B;  4BQH A;  1O7O A;  4KNR A;  3SXD A;  4KNX A;  4IRQ A;  3V0M A;  1LZJ A;  2Z86 A;  3IOI A;  1HJJ A;  4B4M A;  5CMI A;  2X5S A;  1INI A;  2YQJ A;  1JV1 A; 
#chains in the Genus database with same CATH topology
 2Y7A A;  3I0K A;  4AC3 A;  2AE7 A;  2XMH A;  4M28 A;  1R7V A;  1FR9 A;  2X65 A;  2XME A;  4NAK A;  3OH1 A;  1H7H A;  3ZGG A;  4FCE A;  2VS4 A;  2OI6 A;  4HOC A;  2JCL A;  2VXL A;  4KXO A;  2C0N A;  2Y4K A;  3I0L A;  4LW6 A;  1WSZ A;  1I52 A;  3V91 A;  4B2W A;  2APC A;  4EE5 A;  2PGY A;  3T7N A;  1R81 A;  1R80 A;  4Y7V A;  2RJ7 A;  4FRM A;  1ZI4 A;  4B3U A;  2RIZ A;  2FYC B;  2AM4 A;  2A8U A;  2W0W A;  1IIN A;  2JCK A;  3JTJ A;  1R7T A;  5CMF X;  3NGW A;  1LL0 A;  5EJ1 A;  2FYD B;  1H4C A;  1MP5 A;  1QGS A;  1ZHJ A;  2D7I A;  3SX7 A;  3E25 A;  4EEM A;  3I0D A;  5AJP A;  4Q7C A;  4EEA A;  1FWY A;  2AM3 A;  5C48 A;  2VK9 A;  1TW5 A;  3F1C A;  1LL3 A;  2V0L A;  2FFU A;  3SX5 A;  1FXO A;  3F1Y A;  4FQW A;  3POL A;  1QWJ A;  3OH2 A;  1H5T B;  4Y9X A;  4G3Q A;  1SS9 A;  1O23 B;  4HO5 A;  1H7T A;  2VS5 A;  5IDT A;  2OI5 A;  1FOA A;  4G3S A;  1R7Y A;  3OKR A;  2DPW A;  3OAM A;  3TQD A;  3CKQ A;  2MZB A;  3V0P A;  3QVB A;  5CQP A;  1H5T A;  1E5K A;  1ON8 A;  4HO8 A;  3Q4S A;  4HO4 A;  1ZJP A;  2J0A A;  3N9W A;  1O0R A;  2YQS A;  1ZJO A;  1FGX A;  4CJ8 A;  3CKJ A;  1LL2 A;  5CQO A;  2Z87 A;  1FG5 N;  5FTS A;  4AAW A;  4CJC A;  1GWV A;  3DK5 A;  3USR A;  4O6M A;  2PGV A;  1VIC A;  2OEG A;  1FR8 A;  2YCM A;  1VGZ A;  2O1F A;  5C3A A;  2RJ1 A;  4KT7 A;  3FWW A;  2RIY A;  5JQQ A;  2WE9 A;  2YC5 A;  1FXJ A;  2YC3 A;  1OMZ A;  2Y6P A;  1WT2 A;  3CKV A;  3PKP A;  5FV9 A;  2V0I A;  1G9R A;  2V0H A;  2A8W A;  2YQH A;  2QKX A;  1Z90 A;  1PZT A;  3USQ A;  1R7U A;  3KIA A;  4Y6U A;  1S4P A;  5FU8 A;  4FRD A;  4B2X A;  2RJ9 A;  2YQC A;  4ECM A;  5C3D A;  1ZCV A;  5CMH A;  3GUE A;  5I1F A;  5C1L A;  2FYB A;  5C38 A;  4KPZ A;  2AES A;  5C1H A;  4FIY A;  1NHE B;  4ASJ A;  1VGW A;  3OC9 A;  3ZLL A;  2WEE A;  2BO7 A;  4D48 A;  1R7X A;  3Q7U A;  3I0J A;  3T7O A;  3V8Z A;  3LW6 A;  4HCQ A;  1OMX A;  5FU0 A;  3D98 A;  5HS2 A;  3I0I X;  1ZDG A;  1VPA A;  3DJ4 A;  1XHB A;  1HM8 A;  4FRH A;  2ZU7 A;  2RIT A;  4Y6N A;  4JD0 A;  2RJ0 A;  3V90 A;  4G3P A;  2Y4L A;  4M2B A;  1OQM B;  1IIM A;  2WAW A;  1H7G A;  4JIS A;  3PNN A;  4Y63 A;  5CMJ A;  1G1L A;  3R2W A;  1G0R A;  4BMA A;  1QGQ A;  1W55 A;  1YRO B;  4KC2 A;  3SXE A;  3D5N A;  3E26 A;  5C4B A;  2PX7 A;  1V84 A;  2Y4J A;  1JV3 A;  2RIX A;  3U0X A;  1ZJ1 A;  3V0N A;  3SX8 A;  4CVH A;  2FY7 A;  3ZLK A;  4KRV A;  4KC1 A;  1G8O A;  1GQ9 A;  1QG8 A;  2GGQ A;  3T7M A;  4MND A;  3JUJ A;  2X5Z A;  1G95 A;  1YP2 A;  5CQM X;  5FTV A;  1H7Q A;  4C2S A;  4EE3 A;  1INJ A;  1H7E A;  4B42 A;  3SXA A;  1GX4 A;  1H4E A;  4Y7U A;  3SPT A;  4ZDQ A;  4B5B A;  1ZJ0 A;  2XWN A;  3SXG A;  1FGG A;  2P6W A;  3CGX A;  1MC3 A;  1VZT A;  1GWW A;  2BO8 A;  1TVY A;  1JYL A;  1ZDF A;  5D91 A;  1EYR A;  5C3B A;  1VGT A;  3FOQ A;  3RSB A;  1TW1 A;  1LZ0 A;  4HO0 A;  1KWS A;  5CQN X;  5J49 A;  1ZI3 A;  4MIX A;  5L6V A;  2QH5 A;  4HO9 A;  4HG6 A;  3U2V A;  2O1H A;  5EJZ A;  1VGU A;  3K8E A;  1ZCT A;  4GBP A;  1FZW A;  3U2U A;  1JVG A;  1ZIZ A;  5L6S A;  1MP4 A;  2FFV A;  4FRE A;  1S4O A;  3V0Q A;  1ZI1 A;  2P73 A;  3V8Y A;  1GQC A;  3I0H A;  4D11 C;  3BRK X;  2E8B A;  2BO4 A;  3IOH A;  1ZCU A;  4ASY A;  1GX0 A;  1NMM B;  4FRO A;  4AYJ A;  1ZCY A;  1JYK A;  3U2X A;  1VZU A;  2GGO A;  2Y4M A;  5FUH A;  5EIY A;  5C36 A;  2V0J A;  4D0Z A;  1HJL A;  4KPX A;  5C49 A;  3CKO A;  2W0V A;  3PKQ A;  4YS8 A;  5C4F A;  4D11 A;  1H5R B;  2ZU9 A;  3OH4 A;  1WT0 A;  4DE7 A;  2VSH A;  1EZI A;  1H5S D;  4R7P A;  3IOJ A;  1S4N A;  2OEF A;  4Y7F A;  4HO3 A;  2WVM A;  5AJO A;  1H5R A;  4EE4 A;  3OH0 A;  3U0Y A;  1ON6 A;  2V0K A;  1R82 A;  2P72 A;  5C47 A;  2ICX A;  5CQL X;  3I0G A;  2AEC A;  3TZT A;  4B4G A;  4FRQ A;  2X60 A;  1TZF A;  4FCU A;  5AJN A;  4P02 A;  1ZI5 A;  1JVD A;  1G23 A;  5FYE A;  1W57 A;  3V0O A;  3V0L A;  1H4D A;  5C1G A;  4K6R A;  2WVK A;  3O3P A;  1H5S C;  3Q80 A;  2VXM A;  2FYA A;  2D0J A;  2J0B A;  1VZX A;  1G97 A;  1HM9 A;  4MYB A;  2RJ8 A;  1H5S B;  4XWI A;  4IRP A;  3CU0 A;  5IFY A;  1VM8 A;  2VD4 A;  2I5E A;  1H7L A;  4NAL A;  3CKN A;  2I7B A;  1H5S A;  1NQI B;  2ZU8 A;  4KC4 A;  2JCJ A;  3ZF8 A;  4DEC A;  2AM5 A;  1MP3 A;  4UEG A;  5D92 A;  1WT3 A;  2NXV A;  3HL3 A;  2WGZ A;  2RJ6 A;  2RJ4 A;  3I0F A;  2AGD A;  2RJ5 A;  3OGZ A;  5BXC A;  1WVC A;  2Q4J A;  3ZGF A;  1ZJ3 A;  2UX8 A;  1LZI A;  4CJB A;  2WVL A;  1XZ6 A;  1VH3 A;  2AH9 A;  1NF5 B;  4M2A A;  3RMW A;  3RMV A;  4ARW A;  2QGI A;  1GA8 A;  2E3D A;  1G2V A;  4G87 A;  5C4E A;  4FRA A;  3JUK A;  2XWL A;  5C4C A;  3R3I A;  1W77 A;  1HM0 A;  4B4B A;  1FO9 A;  4FRL A;  5DDV A;  4D0T A;  1YP4 A;  3EE5 A;  4DDZ A;  1VH1 A;  2OI7 A;  2BO6 A;  1HV9 A;  5C4D A;  1ZJ2 A;  1K4V A;  2JCO A;  4E1K A;  1O7Q A;  4NAN A;  2XWM A;  2CU2 A;  1WT1 A;  2PA4 A;  4FRP A;  5DDT A;  3U2T A;  1G93 A;  3BCV A;  4Y7G A;  4Y64 A;  4EEO A;  2VS3 A;  3ST8 A;  1V82 A;  5CMG X;  4AYL A;  4KQL A;  1H7F A;  3I0E A;  4Y7T A;  4NAI A;  3D8V A;  4HO2 A;  4FIX A;  2VFZ A;  2O1G A;  4P00 A;  1NWG B;  4LW3 A;  3OH3 A;  5C8R A;  4J18 A;  1FO8 A;  4EVW A;  5IDS A;  1PZY B;  3SXC A;  4M4K A;  4Y62 A;  3SXB A;  2ICY A;  1V83 A;  4HO6 A;  3U2W A;  1G3L A;  2I5K A;  1YP3 A;  3K8D A;  1FRW A;  1H3M A;  1LVW A;  3SX3 A;  4FRB A;  4EEG A;  2VSI A;  2D7R A;  3DUV A;  1LZ7 A;  3I0C A;  4L41 C;  2YES A;  1NKH B;  4BQH A;  1O7O A;  4KNR A;  3SXD A;  4O6N A;  4KNX A;  4IRQ A;  3V0M A;  1LZJ A;  2Z86 A;  3IOI A;  1HJJ A;  4B4M A;  5CMI A;  2X5S A;  1INI A;  2YQJ A;  1JV1 A; 
#chains in the Genus database with same CATH homology
 2Y7A A;  3I0K A;  4AC3 A;  2AE7 A;  2XMH A;  4M28 A;  1R7V A;  1FR9 A;  2X65 A;  2XME A;  4NAK A;  3OH1 A;  1H7H A;  3ZGG A;  4FCE A;  2VS4 A;  2OI6 A;  4HOC A;  2JCL A;  2VXL A;  4KXO A;  2C0N A;  2Y4K A;  3I0L A;  4LW6 A;  1WSZ A;  1I52 A;  3V91 A;  4B2W A;  2APC A;  4EE5 A;  2PGY A;  3T7N A;  1R81 A;  1R80 A;  4Y7V A;  2RJ7 A;  4FRM A;  1ZI4 A;  4B3U A;  2RIZ A;  2FYC B;  2AM4 A;  2A8U A;  2W0W A;  1IIN A;  2JCK A;  3JTJ A;  1R7T A;  5CMF X;  3NGW A;  1LL0 A;  5EJ1 A;  2FYD B;  1H4C A;  1MP5 A;  1QGS A;  1ZHJ A;  2D7I A;  3SX7 A;  3E25 A;  4EEM A;  3I0D A;  5AJP A;  4Q7C A;  4EEA A;  1FWY A;  2AM3 A;  5C48 A;  2VK9 A;  1TW5 A;  3F1C A;  1LL3 A;  2V0L A;  2FFU A;  3SX5 A;  1FXO A;  3F1Y A;  4FQW A;  3POL A;  1QWJ A;  3OH2 A;  1H5T B;  4Y9X A;  4G3Q A;  1SS9 A;  1O23 B;  4HO5 A;  1H7T A;  2VS5 A;  5IDT A;  2OI5 A;  1FOA A;  4G3S A;  1R7Y A;  3OKR A;  2DPW A;  3OAM A;  3TQD A;  3CKQ A;  2MZB A;  3V0P A;  3QVB A;  5CQP A;  1H5T A;  1E5K A;  1ON8 A;  4HO8 A;  3Q4S A;  4HO4 A;  1ZJP A;  2J0A A;  3N9W A;  1O0R A;  2YQS A;  1ZJO A;  1FGX A;  4CJ8 A;  3CKJ A;  1LL2 A;  5CQO A;  2Z87 A;  1FG5 N;  5FTS A;  4AAW A;  4CJC A;  1GWV A;  3DK5 A;  3USR A;  4O6M A;  2PGV A;  1VIC A;  2OEG A;  1FR8 A;  2YCM A;  1VGZ A;  2O1F A;  5C3A A;  2RJ1 A;  4KT7 A;  3FWW A;  2RIY A;  5JQQ A;  2WE9 A;  2YC5 A;  1FXJ A;  2YC3 A;  1OMZ A;  2Y6P A;  1WT2 A;  3CKV A;  3PKP A;  5FV9 A;  2V0I A;  1G9R A;  2V0H A;  2A8W A;  2YQH A;  2QKX A;  1Z90 A;  1PZT A;  3USQ A;  1R7U A;  3KIA A;  4Y6U A;  1S4P A;  5FU8 A;  4FRD A;  4B2X A;  2RJ9 A;  2YQC A;  4ECM A;  5C3D A;  1ZCV A;  5CMH A;  3GUE A;  5I1F A;  5C1L A;  2FYB A;  5C38 A;  4KPZ A;  2AES A;  5C1H A;  4FIY A;  1NHE B;  4ASJ A;  1VGW A;  3OC9 A;  3ZLL A;  2WEE A;  2BO7 A;  4D48 A;  1R7X A;  3Q7U A;  3I0J A;  3T7O A;  3V8Z A;  3LW6 A;  4HCQ A;  1OMX A;  5FU0 A;  3D98 A;  5HS2 A;  3I0I X;  1ZDG A;  1VPA A;  3DJ4 A;  1XHB A;  1HM8 A;  4FRH A;  2ZU7 A;  2RIT A;  4Y6N A;  4JD0 A;  2RJ0 A;  3V90 A;  4G3P A;  2Y4L A;  4M2B A;  1OQM B;  1IIM A;  2WAW A;  1H7G A;  4JIS A;  3PNN A;  4Y63 A;  5CMJ A;  1G1L A;  3R2W A;  1G0R A;  4BMA A;  1QGQ A;  1W55 A;  1YRO B;  4KC2 A;  3SXE A;  3D5N A;  3E26 A;  5C4B A;  2PX7 A;  1V84 A;  2Y4J A;  1JV3 A;  2RIX A;  3U0X A;  1ZJ1 A;  3V0N A;  3SX8 A;  4CVH A;  2FY7 A;  3ZLK A;  4KRV A;  4KC1 A;  1G8O A;  1GQ9 A;  1QG8 A;  2GGQ A;  3T7M A;  4MND A;  3JUJ A;  2X5Z A;  1G95 A;  1YP2 A;  5CQM X;  5FTV A;  1H7Q A;  4C2S A;  4EE3 A;  1INJ A;  1H7E A;  4B42 A;  3SXA A;  1GX4 A;  1H4E A;  4Y7U A;  3SPT A;  4ZDQ A;  4B5B A;  1ZJ0 A;  2XWN A;  3SXG A;  1FGG A;  2P6W A;  3CGX A;  1MC3 A;  1VZT A;  1GWW A;  2BO8 A;  1TVY A;  1JYL A;  1ZDF A;  5D91 A;  1EYR A;  5C3B A;  1VGT A;  3FOQ A;  3RSB A;  1TW1 A;  1LZ0 A;  4HO0 A;  1KWS A;  5CQN X;  5J49 A;  1ZI3 A;  4MIX A;  5L6V A;  2QH5 A;  4HO9 A;  4HG6 A;  3U2V A;  2O1H A;  5EJZ A;  1VGU A;  3K8E A;  1ZCT A;  4GBP A;  1FZW A;  3U2U A;  1JVG A;  1ZIZ A;  5L6S A;  1MP4 A;  2FFV A;  4FRE A;  1S4O A;  3V0Q A;  1ZI1 A;  2P73 A;  3V8Y A;  1GQC A;  3I0H A;  4D11 C;  3BRK X;  2E8B A;  2BO4 A;  3IOH A;  1ZCU A;  4ASY A;  1GX0 A;  1NMM B;  4FRO A;  4AYJ A;  1ZCY A;  1JYK A;  3U2X A;  1VZU A;  2GGO A;  2Y4M A;  5FUH A;  5EIY A;  5C36 A;  2V0J A;  4D0Z A;  1HJL A;  4KPX A;  5C49 A;  3CKO A;  2W0V A;  3PKQ A;  4YS8 A;  5C4F A;  4D11 A;  1H5R B;  2ZU9 A;  3OH4 A;  1WT0 A;  4DE7 A;  2VSH A;  1EZI A;  1H5S D;  4R7P A;  3IOJ A;  1S4N A;  2OEF A;  4Y7F A;  4HO3 A;  2WVM A;  5AJO A;  1H5R A;  4EE4 A;  3OH0 A;  3U0Y A;  1ON6 A;  2V0K A;  1R82 A;  2P72 A;  5C47 A;  2ICX A;  5CQL X;  3I0G A;  2AEC A;  3TZT A;  4B4G A;  4FRQ A;  2X60 A;  1TZF A;  4FCU A;  5AJN A;  4P02 A;  1ZI5 A;  1JVD A;  1G23 A;  5FYE A;  1W57 A;  3V0O A;  3V0L A;  1H4D A;  5C1G A;  4K6R A;  2WVK A;  3O3P A;  1H5S C;  3Q80 A;  2VXM A;  2FYA A;  2D0J A;  2J0B A;  1VZX A;  1G97 A;  1HM9 A;  4MYB A;  2RJ8 A;  1H5S B;  4XWI A;  4IRP A;  3CU0 A;  5IFY A;  1VM8 A;  2VD4 A;  2I5E A;  1H7L A;  4NAL A;  3CKN A;  2I7B A;  1H5S A;  1NQI B;  2ZU8 A;  4KC4 A;  2JCJ A;  3ZF8 A;  4DEC A;  2AM5 A;  1MP3 A;  4UEG A;  5D92 A;  1WT3 A;  2NXV A;  3HL3 A;  2WGZ A;  2RJ6 A;  2RJ4 A;  3I0F A;  2AGD A;  2RJ5 A;  3OGZ A;  5BXC A;  1WVC A;  2Q4J A;  3ZGF A;  1ZJ3 A;  2UX8 A;  1LZI A;  4CJB A;  2WVL A;  1XZ6 A;  1VH3 A;  2AH9 A;  1NF5 B;  4M2A A;  3RMW A;  3RMV A;  4ARW A;  2QGI A;  1GA8 A;  2E3D A;  1G2V A;  4G87 A;  5C4E A;  4FRA A;  3JUK A;  2XWL A;  5C4C A;  3R3I A;  1W77 A;  1HM0 A;  4B4B A;  1FO9 A;  4FRL A;  5DDV A;  4D0T A;  1YP4 A;  3EE5 A;  4DDZ A;  1VH1 A;  2OI7 A;  2BO6 A;  1HV9 A;  5C4D A;  1ZJ2 A;  1K4V A;  2JCO A;  4E1K A;  1O7Q A;  4NAN A;  2XWM A;  2CU2 A;  1WT1 A;  2PA4 A;  4FRP A;  5DDT A;  3U2T A;  1G93 A;  3BCV A;  4Y7G A;  4Y64 A;  4EEO A;  2VS3 A;  3ST8 A;  1V82 A;  5CMG X;  4AYL A;  4KQL A;  1H7F A;  3I0E A;  4Y7T A;  4NAI A;  3D8V A;  4HO2 A;  4FIX A;  2VFZ A;  2O1G A;  4P00 A;  1NWG B;  4LW3 A;  3OH3 A;  5C8R A;  4J18 A;  1FO8 A;  4EVW A;  5IDS A;  1PZY B;  3SXC A;  4M4K A;  4Y62 A;  3SXB A;  2ICY A;  1V83 A;  4HO6 A;  3U2W A;  1G3L A;  2I5K A;  1YP3 A;  3K8D A;  1FRW A;  1H3M A;  1LVW A;  3SX3 A;  4FRB A;  4EEG A;  2VSI A;  2D7R A;  3DUV A;  1LZ7 A;  3I0C A;  4L41 C;  2YES A;  1NKH B;  4BQH A;  1O7O A;  4KNR A;  3SXD A;  4O6N A;  4KNX A;  4IRQ A;  3V0M A;  1LZJ A;  2Z86 A;  3IOI A;  1HJJ A;  4B4M A;  5CMI A;  2X5S A;  1INI A;  2YQJ A;  1JV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...