4Y7TA

Structural analysis of muru
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
218
Chain Sequence
MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFLLVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGDFRLVGEQVVDGDDPGTLTFSGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGERAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleotidyl transferase
publication title Crystal Structure of the N-Acetylmuramic Acid alpha-1-Phosphate (MurNAc-alpha 1-P) Uridylyltransferase MurU, a Minimal Sugar Nucleotidyltransferase and Potential Drug Target Enzyme in Gram-negative Pathogens.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 67
structure length 218
sequence length 224
ec nomenclature ec 2.7.7.99: N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y7tA00
1K4VA 1FR8A 2AM3A 3I0CA 1ZIZA 2O1GA 5CQOA 2I5EA 1NF5B 4Y62A 2XMHA 1EYRA 4YS8A 3OKRA 1LL3A 1WT1A 2RJ7A 1G95A 4MYBA 2X5ZA 3K8EA 1H3MA 2P72A 2FFVA 5EIYA 3F1YA 1GWVA 1H7HA 3SPTA 4FREA 1VGTA 2RJ8A 2ICYA 4D11C 1I52A 3TQDA 3V8YA 5CQPA 1G23A 1INIA 3Q7UA 4Y7TA 4FQWA 2RITA 2ZU7A 1R7YA 5FYEA 2VXLA 2XMEA 5CQMX 3SXCA 5C1HA 3SXBA 4IRPA 3ZLKA 2AECA 2PGVA 2OEFA 3V0LA 3I0FA 4ZDQA 2XWNA 3I0JA 4Y9XA 1HM8A 2RJ6A 3T7NA 2FY7A 1HJJA 1QGQA 2GGQA 3OH4A 4HO0A 2WVLA 4JD0A 4HOCA 1R82A 2Y4MA 2YC5A 1H4DA 3USQA 3FOQA 3PKQA 1FGGA 3F1CA 1FXJA 1V82A 1XZ6A 1ZJ1A 4ECMA 1KWSA 5CMFX 4D11A 4EE4A 2YQJA 2X5SA 1R7TA 2FFUA 4IRQA 1FR9A 3NGWA 1S4PA 2I7BA 3USRA 3U0YA 4CJ8A 2O1HA 3POLA 1ZCTA 3KIAA 1JV3A 2YC3A 3OGZA 5IDTA 1H7FA 5CQLX 1NHEB 3ZGFA 2PX7A 4DE7A 2RJ0A 4KT7A 1MC3A 1FOAA 2JCLA 4Y7GA 4BQHA 1H7QA 2WE9A 5HS2A 3CKJA 5C47A 1R7VA 2VS3A 4NALA 4Y7FA 3DUVA 2A8WA 4EEOA 1YROB 1ZDGA 1W77A 5DDTA 2MZBA 4FRHA 1H5SA 5AJOA 1YP3A 1ZCVA 5AJNA 2RJ1A 2PA4A 2V0IA 1JYKA 2Y7AA 2FYDB 4Y6UA 1YP2A 1VZUA 2RIXA 1XHBA 2RIZA 1VICA 2W0WA 3GUEA 1ZJPA 1PZTA 1W57A 1GQ9A 4FRPA 1H7EA 2Z87A 4B42A 3CKNA 2OI5A 1H5TA 1QGSA 5FV9A 1ZJ0A 2OEGA 4EE5A 2Q4JA 1TZFA 1G8OA 3HL3A 4FCEA 3SX8A 2D7IA 1WT3A 2APCA 2V0LA 3I0IX 3OC9A 3V8ZA 5C48A 5IFYA 1W55A 4AAWA 4HO4A 4HO5A 2YESA 4Y7VA 3JUKA 1VGUA 1VZXA 4HO2A 4M2BA 4MNDA 4NAIA 2AM4A 3I0LA 4FRQA 2Y4JA 1VH3A 3IOJA 5J49A 3E25A 4K6RA 2QGIA 1ON8A 2AH9A 2WVKA 3U2WA 4CJCA 3DJ4A 2BO7A 1H5SD 1WSZA 1GA8A 4L41C 5EJ1A 3D98A 4GBPA 5CMGX 2D7RA 5IDSA 2AE7A 1HV9A 2GGOA 5FTSA 1G3LA 3CU0A 4B2WA 4CJBA 1NKHB 1VM8A 2DPWA 5C4EA 3JUJA 2QH5A 4HO8A 1WT2A 2NXVA 2QKXA 2FYCB 1H4CA 1H5SC 4D0TA 5AJPA 5C1GA 2Y6PA 1JV1A 1V84A 4J18A 2YQHA 1QWJA 2AESA 1GX0A 3U2XA 5C3BA 1SS9A 3OAMA 3U2TA 1G97A 1TW1A 1ZJ3A 4ARWA 5C4DA 1ZCYA 4ASYA 4B2XA 1O7QA 3R3IA 4AC3A 4HO6A 2VS5A 1LZ7A 3RMVA 1V83A 1LVWA 5BXCA 2AGDA 4NANA 3CKQA 5CQNX 1NQIB 2WVMA 1VPAA 3BRKX 3SX3A 2VXMA 4EEGA 1FO9A 2X60A 3R2WA 1H7GA 5C3DA 3PNNA 4EEAA 1FO8A 3IOHA 3I0DA 4R7PA 5C3AA 5C36A 2VS4A 4HO9A 1HJLA 5FU8A 4D48A 1FZWA 1PZYB 2YQSA 1LL2A 4AYJA 1FRWA 1S4NA 4P00A 1ZI5A 1HM0A 1H7TA 1FG5N 5C4CA 3V91A 4KNXA 1G2VA 1YP4A 2Y4KA 3D5NA 3ZGGA 4XWIA 4HO3A 1O7OA 1H5RB 4LW6A 4FRBA 4Y7UA 4AYLA 4KC1A 1H4EA 3V0PA 3V0QA 4FRAA 4KXOA 4G3PA 2XWLA 4G87A 3OH1A 4HCQA 3U0XA 1FXOA 1WT0A 2RJ5A 1G93A 1MP5A 1R7XA 3TZTA 5FUHA 2E3DA 5L6SA 2X65A 2WAWA 1JVDA 2PGYA 2V0KA 5JQQA 3EE5A 4FRLA 4LW3A 3OH0A 1VGWA 3CKOA 5I1FA 1MP3A 4KRVA 4B4BA 1FGXA 2BO8A 5CMJA 2O1FA 1JVGA 1LZJA 1NMMB 1OQMB 4M28A 3RSBA 3U2VA 1ZHJA 2A8UA 4Y6NA 3JTJA 1R81A 2D0JA 3IOIA 4G3SA 4NAKA 4P02A 2UX8A 1HM9A 4DDZA 1NWGB 4EVWA 3ZLLA 1LL0A 1S4OA 2ICXA 3OH2A 3V0OA 3V0NA 1TVYA 1ZJ2A 4EEMA 4KPZA 4E1KA 3I0KA 3BCVA 3O3PA 1LZIA 1WVCA 1FWYA 2Z86A 4G3QA 1IIMA 4B3UA 3SXEA 1G0RA 1LZ0A 3CKVA 5C49A 5CMHA 1EZIA 4B4GA 3PKPA 3SX7A 2VSIA 5C8RA 3D8VA 1JYLA 1QG8A 3V0MA 3U2UA 4B4MA 1ZI1A 5FU0A 3LW6A 2OI6A 3SXDA 4C2SA 2BO4A 2RIYA 2WGZA 1G9RA 1MP4A 2YQCA 3T7OA 4CVHA 2YCMA 2CU2A 4D0ZA 1Z90A 4KC4A 5DDVA 1O0RA 3DK5A 4B5BA 4Y64A 2BO6A 3QVBA 2ZU9A 1ZJOA 2VFZA 2V0HA 5C4BA 1OMXA 4HG6A 1VGZA 4UEGA 3SX5A 3I0HA 4KC2A 4JISA 2VSHA 3SXGA 2JCJA 3E26A 2JCOA 4FCUA 4KNRA 1INJA 4FROA 1ZDFA 5C38A 2XWMA 1R7UA 4M4KA 1G1LA 3SXAA 3FWWA 4KPXA 3OH3A 4ASJA 2RJ4A 2V0JA 3I0EA 4KQLA 2P73A 3ZF8A 1VH1A 1GQCA 5EJZA 3N9WA 2I5KA 3V90A 2WEEA 1H5SB 2P6WA 1ZCUA 2ZU8A 4BMAA 1GWWA 2W0VA 3Q4SA 1GX4A 4EE3A 1ZI3A 5FTVA 2OI7A 4M2AA 1TW5A 1H5RA 1H7LA 2Y4LA 2RJ9A 4FRMA 5C1LA 3I0GA 2AM5A 1ZI4A 2FYBA 3ST8A 1R80A 1OMZA 5L6VA 4Y63A 4FRDA 3RMWA 1E5KA 5CMIA 3Q80A 1H5TB 2JCKA 1VZTA 2E8BA 3T7MA 4DECA 1ON6A 3K8DA 3CGXA 5C4FA 1IINA 1O23B 2FYAA 2VD4A
chains in the Genus database with same CATH superfamily
1K4VA 1FR8A 4MIXA 2AM3A 3I0CA 1ZIZA 2O1GA 5CQOA 2I5EA 1NF5B 4Y62A 2XMHA 1EYRA 4YS8A 3OKRA 1LL3A 1WT1A 2RJ7A 1G95A 4MYBA 2X5ZA 3K8EA 1H3MA 2P72A 2FFVA 5EIYA 3F1YA 1GWVA 1H7HA 3SPTA 4FREA 1VGTA 2RJ8A 2ICYA 4D11C 1I52A 3TQDA 3V8YA 5CQPA 1G23A 1INIA 3Q7UA 4Y7TA 4FQWA 2RITA 2ZU7A 1R7YA 5FYEA 2VXLA 2XMEA 5CQMX 3SXCA 5C1HA 3SXBA 4IRPA 3ZLKA 2AECA 2PGVA 2OEFA 3V0LA 3I0FA 4ZDQA 2XWNA 3I0JA 4Y9XA 1HM8A 2RJ6A 3T7NA 2FY7A 1HJJA 1QGQA 2GGQA 3OH4A 4HO0A 2WVLA 4JD0A 4HOCA 1R82A 2Y4MA 2YC5A 1H4DA 3USQA 3FOQA 3PKQA 1FGGA 4FIXA 3F1CA 1FXJA 1V82A 1XZ6A 1ZJ1A 4ECMA 1KWSA 5CMFX 4D11A 4EE4A 2YQJA 2X5SA 1R7TA 2FFUA 4IRQA 1FR9A 3NGWA 1S4PA 2I7BA 3USRA 3U0YA 4CJ8A 2O1HA 3POLA 1ZCTA 3KIAA 1JV3A 2YC3A 3OGZA 5IDTA 1H7FA 5CQLX 1NHEB 3ZGFA 2PX7A 4DE7A 2RJ0A 4KT7A 4O6MA 1MC3A 1FOAA 2JCLA 4Y7GA 4BQHA 1H7QA 2WE9A 5HS2A 3CKJA 5C47A 1R7VA 2VS3A 4NALA 4Y7FA 3DUVA 2A8WA 4EEOA 1YROB 1ZDGA 1W77A 5DDTA 2MZBA 4FRHA 1H5SA 5AJOA 1YP3A 1ZCVA 5AJNA 2RJ1A 2PA4A 2V0IA 1JYKA 2Y7AA 2FYDB 4Y6UA 1YP2A 1VZUA 2RIXA 1XHBA 2RIZA 1VICA 2W0WA 3GUEA 1ZJPA 1PZTA 1W57A 1GQ9A 4FRPA 1H7EA 2Z87A 4B42A 3CKNA 2OI5A 1H5TA 1QGSA 5FV9A 1ZJ0A 2OEGA 4EE5A 2Q4JA 1TZFA 1G8OA 3HL3A 4FCEA 3SX8A 2D7IA 1WT3A 2APCA 2V0LA 3I0IX 3OC9A 3V8ZA 5C48A 5IFYA 1W55A 4AAWA 4HO4A 4HO5A 2YESA 4Y7VA 3JUKA 1VGUA 1VZXA 4HO2A 4M2BA 4MNDA 4NAIA 2AM4A 3I0LA 4FRQA 2Y4JA 1VH3A 3IOJA 5J49A 3E25A 4K6RA 2QGIA 1ON8A 2AH9A 2WVKA 3U2WA 4CJCA 3DJ4A 2BO7A 1H5SD 1WSZA 2VK9A 1GA8A 4L41C 5EJ1A 3D98A 4GBPA 5CMGX 2D7RA 5IDSA 2AE7A 1HV9A 2GGOA 5FTSA 1G3LA 3CU0A 4B2WA 4CJBA 1NKHB 1VM8A 2DPWA 5C4EA 3JUJA 2QH5A 4HO8A 1WT2A 2NXVA 2QKXA 2FYCB 1H4CA 1H5SC 4D0TA 5AJPA 5C1GA 2Y6PA 1JV1A 1V84A 4J18A 2YQHA 1QWJA 2AESA 1GX0A 3U2XA 5C3BA 1SS9A 3OAMA 3U2TA 1G97A 1TW1A 1ZJ3A 4ARWA 5C4DA 1ZCYA 4ASYA 4B2XA 1O7QA 3R3IA 4AC3A 4HO6A 2VS5A 1LZ7A 3RMVA 1V83A 1LVWA 5BXCA 2AGDA 4NANA 3CKQA 5CQNX 1NQIB 2WVMA 1VPAA 3BRKX 3SX3A 2VXMA 4EEGA 1FO9A 2X60A 3R2WA 1H7GA 5C3DA 3PNNA 4EEAA 1FO8A 3IOHA 3I0DA 4R7PA 5C3AA 5C36A 2VS4A 4HO9A 1HJLA 5FU8A 4D48A 1FZWA 1PZYB 2YQSA 1LL2A 4AYJA 1FRWA 1S4NA 4P00A 1ZI5A 1HM0A 1H7TA 1FG5N 5C4CA 3V91A 4KNXA 1G2VA 1YP4A 2Y4KA 3D5NA 3ZGGA 4XWIA 4HO3A 1O7OA 1H5RB 4LW6A 4FRBA 4Y7UA 4AYLA 4KC1A 1H4EA 3V0PA 3V0QA 4FRAA 4KXOA 4G3PA 2XWLA 4G87A 3OH1A 4HCQA 3U0XA 1FXOA 1WT0A 2RJ5A 1G93A 1MP5A 1R7XA 3TZTA 5FUHA 2E3DA 4O6NA 5L6SA 2X65A 2WAWA 1JVDA 2PGYA 2V0KA 5JQQA 3EE5A 4FRLA 4LW3A 3OH0A 1VGWA 3CKOA 5I1FA 1MP3A 4KRVA 4B4BA 1FGXA 2BO8A 5CMJA 2O1FA 1JVGA 1LZJA 1NMMB 1OQMB 4M28A 3RSBA 3U2VA 1ZHJA 2A8UA 4Y6NA 3JTJA 1R81A 5D91A 2D0JA 2J0BA 3IOIA 4G3SA 4NAKA 4P02A 2UX8A 1HM9A 5D92A 4DDZA 1NWGB 4EVWA 3ZLLA 1LL0A 1S4OA 2ICXA 3OH2A 3V0OA 3V0NA 1TVYA 1ZJ2A 4EEMA 4KPZA 4E1KA 3I0KA 3BCVA 3O3PA 1LZIA 1WVCA 1FWYA 2Z86A 4G3QA 4Q7CA 1IIMA 4B3UA 3SXEA 1G0RA 1LZ0A 3CKVA 5C49A 5CMHA 1EZIA 4B4GA 3PKPA 3SX7A 2VSIA 5C8RA 3D8VA 1JYLA 1QG8A 3V0MA 3U2UA 4B4MA 1ZI1A 5FU0A 3LW6A 2OI6A 3SXDA 4C2SA 2BO4A 2RIYA 2WGZA 1G9RA 1MP4A 2YQCA 3T7OA 4CVHA 2YCMA 2CU2A 2C0NA 4D0ZA 1Z90A 4KC4A 5DDVA 1O0RA 3DK5A 4B5BA 4Y64A 4FIYA 2BO6A 3QVBA 2ZU9A 1ZJOA 2VFZA 2V0HA 5C4BA 1OMXA 4HG6A 1VGZA 4UEGA 3SX5A 3I0HA 4KC2A 4JISA 2VSHA 3SXGA 2JCJA 3E26A 2JCOA 4FCUA 4KNRA 1INJA 4FROA 1ZDFA 5C38A 2XWMA 1R7UA 4M4KA 1G1LA 3SXAA 3FWWA 4KPXA 3OH3A 4ASJA 2RJ4A 2V0JA 3I0EA 4KQLA 2P73A 3ZF8A 1VH1A 1GQCA 5EJZA 3N9WA 2I5KA 3V90A 2WEEA 1H5SB 2J0AA 2P6WA 1ZCUA 2ZU8A 4BMAA 1GWWA 2W0VA 3Q4SA 1GX4A 4EE3A 1ZI3A 5FTVA 2OI7A 4M2AA 1TW5A 1H5RA 1H7LA 2Y4LA 2RJ9A 4FRMA 5C1LA 3I0GA 2AM5A 1ZI4A 2FYBA 3ST8A 1R80A 1OMZA 5L6VA 4Y63A 4FRDA 3RMWA 1E5KA 5CMIA 3Q80A 1H5TB 2JCKA 1VZTA 2E8BA 3T7MA 4DECA 1ON6A 3K8DA 3CGXA 5C4FA 1IINA 1O23B 2FYAA 2VD4A
chains in the Genus database with same CATH topology
1K4VA 1FR8A 4MIXA 2AM3A 3I0CA 1ZIZA 2O1GA 5CQOA 2I5EA 1NF5B 4Y62A 2XMHA 1EYRA 4YS8A 3OKRA 1LL3A 1WT1A 2RJ7A 1G95A 4MYBA 2X5ZA 3K8EA 1H3MA 2P72A 2FFVA 5EIYA 3F1YA 1GWVA 1H7HA 3SPTA 4FREA 1VGTA 2RJ8A 2ICYA 4D11C 1I52A 3TQDA 3V8YA 5CQPA 1G23A 1INIA 3Q7UA 4Y7TA 4FQWA 2RITA 2ZU7A 1R7YA 5FYEA 2VXLA 2XMEA 5CQMX 3SXCA 5C1HA 3SXBA 4IRPA 3ZLKA 2AECA 2PGVA 2OEFA 3V0LA 3I0FA 4ZDQA 2XWNA 3I0JA 4Y9XA 1HM8A 2RJ6A 3T7NA 2FY7A 1HJJA 1QGQA 2GGQA 3OH4A 4HO0A 2WVLA 4JD0A 4HOCA 1R82A 2Y4MA 2YC5A 1H4DA 3USQA 3FOQA 3PKQA 1FGGA 4FIXA 3F1CA 1FXJA 1V82A 1XZ6A 1ZJ1A 4ECMA 1KWSA 5CMFX 4D11A 4EE4A 2YQJA 2X5SA 1R7TA 2FFUA 4IRQA 1FR9A 3NGWA 1S4PA 2I7BA 3USRA 3U0YA 4CJ8A 2O1HA 3POLA 1ZCTA 3KIAA 1JV3A 2YC3A 3OGZA 5IDTA 1H7FA 5CQLX 1NHEB 3ZGFA 2PX7A 4DE7A 2RJ0A 4KT7A 4O6MA 1MC3A 1FOAA 2JCLA 4Y7GA 4BQHA 1H7QA 2WE9A 5HS2A 3CKJA 5C47A 1R7VA 2VS3A 4NALA 4Y7FA 3DUVA 2A8WA 4EEOA 1YROB 1ZDGA 1W77A 5DDTA 2MZBA 4FRHA 1H5SA 5AJOA 1YP3A 1ZCVA 5AJNA 2RJ1A 2PA4A 2V0IA 1JYKA 2Y7AA 2FYDB 4Y6UA 1YP2A 1VZUA 2RIXA 1XHBA 2RIZA 1VICA 2W0WA 3GUEA 1ZJPA 1PZTA 1W57A 1GQ9A 4FRPA 1H7EA 2Z87A 4B42A 3CKNA 2OI5A 1H5TA 1QGSA 5FV9A 1ZJ0A 2OEGA 4EE5A 2Q4JA 1TZFA 1G8OA 3HL3A 4FCEA 3SX8A 2D7IA 1WT3A 2APCA 2V0LA 3I0IX 3OC9A 3V8ZA 5C48A 5IFYA 1W55A 4AAWA 4HO4A 4HO5A 2YESA 4Y7VA 3JUKA 1VGUA 1VZXA 4HO2A 4M2BA 4MNDA 4NAIA 2AM4A 3I0LA 4FRQA 2Y4JA 1VH3A 3IOJA 5J49A 3E25A 4K6RA 2QGIA 1ON8A 2AH9A 2WVKA 3U2WA 4CJCA 3DJ4A 2BO7A 1H5SD 1WSZA 2VK9A 1GA8A 4L41C 5EJ1A 3D98A 4GBPA 5CMGX 2D7RA 5IDSA 2AE7A 1HV9A 2GGOA 5FTSA 1G3LA 3CU0A 4B2WA 4CJBA 1NKHB 1VM8A 2DPWA 5C4EA 3JUJA 2QH5A 4HO8A 1WT2A 2NXVA 2QKXA 2FYCB 1H4CA 1H5SC 4D0TA 5AJPA 5C1GA 2Y6PA 1JV1A 1V84A 4J18A 2YQHA 1QWJA 2AESA 1GX0A 3U2XA 5C3BA 1SS9A 3OAMA 3U2TA 1G97A 1TW1A 1ZJ3A 4ARWA 5C4DA 1ZCYA 4ASYA 4B2XA 1O7QA 3R3IA 4AC3A 4HO6A 2VS5A 1LZ7A 3RMVA 1V83A 1LVWA 5BXCA 2AGDA 4NANA 3CKQA 5CQNX 1NQIB 2WVMA 1VPAA 3BRKX 3SX3A 2VXMA 4EEGA 1FO9A 2X60A 3R2WA 1H7GA 5C3DA 3PNNA 4EEAA 1FO8A 3IOHA 3I0DA 4R7PA 5C3AA 5C36A 2VS4A 4HO9A 1HJLA 5FU8A 4D48A 1FZWA 1PZYB 2YQSA 1LL2A 4AYJA 1FRWA 1S4NA 4P00A 1ZI5A 1HM0A 1H7TA 1FG5N 5C4CA 3V91A 4KNXA 1G2VA 1YP4A 2Y4KA 3D5NA 3ZGGA 4XWIA 4HO3A 1O7OA 1H5RB 4LW6A 4FRBA 4Y7UA 4AYLA 4KC1A 1H4EA 3V0PA 3V0QA 4FRAA 4KXOA 4G3PA 2XWLA 4G87A 3OH1A 4HCQA 3U0XA 1FXOA 1WT0A 2RJ5A 1G93A 1MP5A 1R7XA 3TZTA 5FUHA 2E3DA 4O6NA 5L6SA 2X65A 2WAWA 1JVDA 2PGYA 2V0KA 5JQQA 3EE5A 4FRLA 4LW3A 3OH0A 1VGWA 3CKOA 5I1FA 1MP3A 4KRVA 4B4BA 1FGXA 2BO8A 5CMJA 2O1FA 1JVGA 1LZJA 1NMMB 1OQMB 4M28A 3RSBA 3U2VA 1ZHJA 2A8UA 4Y6NA 3JTJA 1R81A 5D91A 2D0JA 2J0BA 3IOIA 4G3SA 4NAKA 4P02A 2UX8A 1HM9A 5D92A 4DDZA 1NWGB 4EVWA 3ZLLA 1LL0A 1S4OA 2ICXA 3OH2A 3V0OA 3V0NA 1TVYA 1ZJ2A 4EEMA 4KPZA 4E1KA 3I0KA 3BCVA 3O3PA 1LZIA 1WVCA 1FWYA 2Z86A 4G3QA 4Q7CA 1IIMA 4B3UA 3SXEA 1G0RA 1LZ0A 3CKVA 5C49A 5CMHA 1EZIA 4B4GA 3PKPA 3SX7A 2VSIA 5C8RA 3D8VA 1JYLA 1QG8A 3V0MA 3U2UA 4B4MA 1ZI1A 5FU0A 3LW6A 2OI6A 3SXDA 4C2SA 2BO4A 2RIYA 2WGZA 1G9RA 1MP4A 2YQCA 3T7OA 4CVHA 2YCMA 2CU2A 2C0NA 4D0ZA 1Z90A 4KC4A 5DDVA 1O0RA 3DK5A 4B5BA 4Y64A 4FIYA 2BO6A 3QVBA 2ZU9A 1ZJOA 2VFZA 2V0HA 5C4BA 1OMXA 4HG6A 1VGZA 4UEGA 3SX5A 3I0HA 4KC2A 4JISA 2VSHA 3SXGA 2JCJA 3E26A 2JCOA 4FCUA 4KNRA 1INJA 4FROA 1ZDFA 5C38A 2XWMA 1R7UA 4M4KA 1G1LA 3SXAA 3FWWA 4KPXA 3OH3A 4ASJA 2RJ4A 2V0JA 3I0EA 4KQLA 2P73A 3ZF8A 1VH1A 1GQCA 5EJZA 3N9WA 2I5KA 3V90A 2WEEA 1H5SB 2J0AA 2P6WA 1ZCUA 2ZU8A 4BMAA 1GWWA 2W0VA 3Q4SA 1GX4A 4EE3A 1ZI3A 5FTVA 2OI7A 4M2AA 1TW5A 1H5RA 1H7LA 2Y4LA 2RJ9A 4FRMA 5C1LA 3I0GA 2AM5A 1ZI4A 2FYBA 3ST8A 1R80A 1OMZA 5L6VA 4Y63A 4FRDA 3RMWA 1E5KA 5CMIA 3Q80A 1H5TB 2JCKA 1VZTA 2E8BA 3T7MA 4DECA 1ON6A 3K8DA 3CGXA 5C4FA 1IINA 1O23B 2FYAA 2VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4V A;  1FR8 A;  2AM3 A;  3I0C A;  1ZIZ A;  2O1G A;  5CQO A;  2I5E A;  1NF5 B;  4Y62 A;  2XMH A;  1EYR A;  4YS8 A;  3OKR A;  1LL3 A;  1WT1 A;  2RJ7 A;  1G95 A;  4MYB A;  2X5Z A;  3K8E A;  1H3M A;  2P72 A;  2FFV A;  5EIY A;  3F1Y A;  1GWV A;  1H7H A;  3SPT A;  4FRE A;  1VGT A;  2RJ8 A;  2ICY A;  4D11 C;  1I52 A;  3TQD A;  3V8Y A;  5CQP A;  1G23 A;  1INI A;  3Q7U A;  4Y7T A;  4FQW A;  2RIT A;  2ZU7 A;  1R7Y A;  5FYE A;  2VXL A;  2XME A;  5CQM X;  3SXC A;  5C1H A;  3SXB A;  4IRP A;  3ZLK A;  2AEC A;  2PGV A;  2OEF A;  3V0L A;  3I0F A;  4ZDQ A;  2XWN A;  3I0J A;  4Y9X A;  1HM8 A;  2RJ6 A;  3T7N A;  2FY7 A;  1HJJ A;  1QGQ A;  2GGQ A;  3OH4 A;  4HO0 A;  2WVL A;  4JD0 A;  4HOC A;  1R82 A;  2Y4M A;  2YC5 A;  1H4D A;  3USQ A;  3FOQ A;  3PKQ A;  1FGG A;  3F1C A;  1FXJ A;  1V82 A;  1XZ6 A;  1ZJ1 A;  4ECM A;  1KWS A;  5CMF X;  4D11 A;  4EE4 A;  2YQJ A;  2X5S A;  1R7T A;  2FFU A;  4IRQ A;  1FR9 A;  3NGW A;  1S4P A;  2I7B A;  3USR A;  3U0Y A;  4CJ8 A;  2O1H A;  3POL A;  1ZCT A;  3KIA A;  1JV3 A;  2YC3 A;  3OGZ A;  5IDT A;  1H7F A;  5CQL X;  1NHE B;  3ZGF A;  2PX7 A;  4DE7 A;  2RJ0 A;  4KT7 A;  1MC3 A;  1FOA A;  2JCL A;  4Y7G A;  4BQH A;  1H7Q A;  2WE9 A;  5HS2 A;  3CKJ A;  5C47 A;  1R7V A;  2VS3 A;  4NAL A;  4Y7F A;  3DUV A;  2A8W A;  4EEO A;  1YRO B;  1ZDG A;  1W77 A;  5DDT A;  2MZB A;  4FRH A;  1H5S A;  5AJO A;  1YP3 A;  1ZCV A;  5AJN A;  2RJ1 A;  2PA4 A;  2V0I A;  1JYK A;  2Y7A A;  2FYD B;  4Y6U A;  1YP2 A;  1VZU A;  2RIX A;  1XHB A;  2RIZ A;  1VIC A;  2W0W A;  3GUE A;  1ZJP A;  1PZT A;  1W57 A;  1GQ9 A;  4FRP A;  1H7E A;  2Z87 A;  4B42 A;  3CKN A;  2OI5 A;  1H5T A;  1QGS A;  5FV9 A;  1ZJ0 A;  2OEG A;  4EE5 A;  2Q4J A;  1TZF A;  1G8O A;  3HL3 A;  4FCE A;  3SX8 A;  2D7I A;  1WT3 A;  2APC A;  2V0L A;  3I0I X;  3OC9 A;  3V8Z A;  5C48 A;  5IFY A;  1W55 A;  4AAW A;  4HO4 A;  4HO5 A;  2YES A;  4Y7V A;  3JUK A;  1VGU A;  1VZX A;  4HO2 A;  4M2B A;  4MND A;  4NAI A;  2AM4 A;  3I0L A;  4FRQ A;  2Y4J A;  1VH3 A;  3IOJ A;  5J49 A;  3E25 A;  4K6R A;  2QGI A;  1ON8 A;  2AH9 A;  2WVK A;  3U2W A;  4CJC A;  3DJ4 A;  2BO7 A;  1H5S D;  1WSZ A;  1GA8 A;  4L41 C;  5EJ1 A;  3D98 A;  4GBP A;  5CMG X;  2D7R A;  5IDS A;  2AE7 A;  1HV9 A;  2GGO A;  5FTS A;  1G3L A;  3CU0 A;  4B2W A;  4CJB A;  1NKH B;  1VM8 A;  2DPW A;  5C4E A;  3JUJ A;  2QH5 A;  4HO8 A;  1WT2 A;  2NXV A;  2QKX A;  2FYC B;  1H4C A;  1H5S C;  4D0T A;  5AJP A;  5C1G A;  2Y6P A;  1JV1 A;  1V84 A;  4J18 A;  2YQH A;  1QWJ A;  2AES A;  1GX0 A;  3U2X A;  5C3B A;  1SS9 A;  3OAM A;  3U2T A;  1G97 A;  1TW1 A;  1ZJ3 A;  4ARW A;  5C4D A;  1ZCY A;  4ASY A;  4B2X A;  1O7Q A;  3R3I A;  4AC3 A;  4HO6 A;  2VS5 A;  1LZ7 A;  3RMV A;  1V83 A;  1LVW A;  5BXC A;  2AGD A;  4NAN A;  3CKQ A;  5CQN X;  1NQI B;  2WVM A;  1VPA A;  3BRK X;  3SX3 A;  2VXM A;  4EEG A;  1FO9 A;  2X60 A;  3R2W A;  1H7G A;  5C3D A;  3PNN A;  4EEA A;  1FO8 A;  3IOH A;  3I0D A;  4R7P A;  5C3A A;  5C36 A;  2VS4 A;  4HO9 A;  1HJL A;  5FU8 A;  4D48 A;  1FZW A;  1PZY B;  2YQS A;  1LL2 A;  4AYJ A;  1FRW A;  1S4N A;  4P00 A;  1ZI5 A;  1HM0 A;  1H7T A;  1FG5 N;  5C4C A;  3V91 A;  4KNX A;  1G2V A;  1YP4 A;  2Y4K A;  3D5N A;  3ZGG A;  4XWI A;  4HO3 A;  1O7O A;  1H5R B;  4LW6 A;  4FRB A;  4Y7U A;  4AYL A;  4KC1 A;  1H4E A;  3V0P A;  3V0Q A;  4FRA A;  4KXO A;  4G3P A;  2XWL A;  4G87 A;  3OH1 A;  4HCQ A;  3U0X A;  1FXO A;  1WT0 A;  2RJ5 A;  1G93 A;  1MP5 A;  1R7X A;  3TZT A;  5FUH A;  2E3D A;  5L6S A;  2X65 A;  2WAW A;  1JVD A;  2PGY A;  2V0K A;  5JQQ A;  3EE5 A;  4FRL A;  4LW3 A;  3OH0 A;  1VGW A;  3CKO A;  5I1F A;  1MP3 A;  4KRV A;  4B4B A;  1FGX A;  2BO8 A;  5CMJ A;  2O1F A;  1JVG A;  1LZJ A;  1NMM B;  1OQM B;  4M28 A;  3RSB A;  3U2V A;  1ZHJ A;  2A8U A;  4Y6N A;  3JTJ A;  1R81 A;  2D0J A;  3IOI A;  4G3S A;  4NAK A;  4P02 A;  2UX8 A;  1HM9 A;  4DDZ A;  1NWG B;  4EVW A;  3ZLL A;  1LL0 A;  1S4O A;  2ICX A;  3OH2 A;  3V0O A;  3V0N A;  1TVY A;  1ZJ2 A;  4EEM A;  4KPZ A;  4E1K A;  3I0K A;  3BCV A;  3O3P A;  1LZI A;  1WVC A;  1FWY A;  2Z86 A;  4G3Q A;  1IIM A;  4B3U A;  3SXE A;  1G0R A;  1LZ0 A;  3CKV A;  5C49 A;  5CMH A;  1EZI A;  4B4G A;  3PKP A;  3SX7 A;  2VSI A;  5C8R A;  3D8V A;  1JYL A;  1QG8 A;  3V0M A;  3U2U A;  4B4M A;  1ZI1 A;  5FU0 A;  3LW6 A;  2OI6 A;  3SXD A;  4C2S A;  2BO4 A;  2RIY A;  2WGZ A;  1G9R A;  1MP4 A;  2YQC A;  3T7O A;  4CVH A;  2YCM A;  2CU2 A;  4D0Z A;  1Z90 A;  4KC4 A;  5DDV A;  1O0R A;  3DK5 A;  4B5B A;  4Y64 A;  2BO6 A;  3QVB A;  2ZU9 A;  1ZJO A;  2VFZ A;  2V0H A;  5C4B A;  1OMX A;  4HG6 A;  1VGZ A;  4UEG A;  3SX5 A;  3I0H A;  4KC2 A;  4JIS A;  2VSH A;  3SXG A;  2JCJ A;  3E26 A;  2JCO A;  4FCU A;  4KNR A;  1INJ A;  4FRO A;  1ZDF A;  5C38 A;  2XWM A;  1R7U A;  4M4K A;  1G1L A;  3SXA A;  3FWW A;  4KPX A;  3OH3 A;  4ASJ A;  2RJ4 A;  2V0J A;  3I0E A;  4KQL A;  2P73 A;  3ZF8 A;  1VH1 A;  1GQC A;  5EJZ A;  3N9W A;  2I5K A;  3V90 A;  2WEE A;  1H5S B;  2P6W A;  1ZCU A;  2ZU8 A;  4BMA A;  1GWW A;  2W0V A;  3Q4S A;  1GX4 A;  4EE3 A;  1ZI3 A;  5FTV A;  2OI7 A;  4M2A A;  1TW5 A;  1H5R A;  1H7L A;  2Y4L A;  2RJ9 A;  4FRM A;  5C1L A;  3I0G A;  2AM5 A;  1ZI4 A;  2FYB A;  3ST8 A;  1R80 A;  1OMZ A;  5L6V A;  4Y63 A;  4FRD A;  3RMW A;  1E5K A;  5CMI A;  3Q80 A;  1H5T B;  2JCK A;  1VZT A;  2E8B A;  3T7M A;  4DEC A;  1ON6 A;  3K8D A;  3CGX A;  5C4F A;  1IIN A;  1O23 B;  2FYA A;  2VD4 A; 
#chains in the Genus database with same CATH topology
 1K4V A;  1FR8 A;  4MIX A;  2AM3 A;  3I0C A;  1ZIZ A;  2O1G A;  5CQO A;  2I5E A;  1NF5 B;  4Y62 A;  2XMH A;  1EYR A;  4YS8 A;  3OKR A;  1LL3 A;  1WT1 A;  2RJ7 A;  1G95 A;  4MYB A;  2X5Z A;  3K8E A;  1H3M A;  2P72 A;  2FFV A;  5EIY A;  3F1Y A;  1GWV A;  1H7H A;  3SPT A;  4FRE A;  1VGT A;  2RJ8 A;  2ICY A;  4D11 C;  1I52 A;  3TQD A;  3V8Y A;  5CQP A;  1G23 A;  1INI A;  3Q7U A;  4Y7T A;  4FQW A;  2RIT A;  2ZU7 A;  1R7Y A;  5FYE A;  2VXL A;  2XME A;  5CQM X;  3SXC A;  5C1H A;  3SXB A;  4IRP A;  3ZLK A;  2AEC A;  2PGV A;  2OEF A;  3V0L A;  3I0F A;  4ZDQ A;  2XWN A;  3I0J A;  4Y9X A;  1HM8 A;  2RJ6 A;  3T7N A;  2FY7 A;  1HJJ A;  1QGQ A;  2GGQ A;  3OH4 A;  4HO0 A;  2WVL A;  4JD0 A;  4HOC A;  1R82 A;  2Y4M A;  2YC5 A;  1H4D A;  3USQ A;  3FOQ A;  3PKQ A;  1FGG A;  4FIX A;  3F1C A;  1FXJ A;  1V82 A;  1XZ6 A;  1ZJ1 A;  4ECM A;  1KWS A;  5CMF X;  4D11 A;  4EE4 A;  2YQJ A;  2X5S A;  1R7T A;  2FFU A;  4IRQ A;  1FR9 A;  3NGW A;  1S4P A;  2I7B A;  3USR A;  3U0Y A;  4CJ8 A;  2O1H A;  3POL A;  1ZCT A;  3KIA A;  1JV3 A;  2YC3 A;  3OGZ A;  5IDT A;  1H7F A;  5CQL X;  1NHE B;  3ZGF A;  2PX7 A;  4DE7 A;  2RJ0 A;  4KT7 A;  4O6M A;  1MC3 A;  1FOA A;  2JCL A;  4Y7G A;  4BQH A;  1H7Q A;  2WE9 A;  5HS2 A;  3CKJ A;  5C47 A;  1R7V A;  2VS3 A;  4NAL A;  4Y7F A;  3DUV A;  2A8W A;  4EEO A;  1YRO B;  1ZDG A;  1W77 A;  5DDT A;  2MZB A;  4FRH A;  1H5S A;  5AJO A;  1YP3 A;  1ZCV A;  5AJN A;  2RJ1 A;  2PA4 A;  2V0I A;  1JYK A;  2Y7A A;  2FYD B;  4Y6U A;  1YP2 A;  1VZU A;  2RIX A;  1XHB A;  2RIZ A;  1VIC A;  2W0W A;  3GUE A;  1ZJP A;  1PZT A;  1W57 A;  1GQ9 A;  4FRP A;  1H7E A;  2Z87 A;  4B42 A;  3CKN A;  2OI5 A;  1H5T A;  1QGS A;  5FV9 A;  1ZJ0 A;  2OEG A;  4EE5 A;  2Q4J A;  1TZF A;  1G8O A;  3HL3 A;  4FCE A;  3SX8 A;  2D7I A;  1WT3 A;  2APC A;  2V0L A;  3I0I X;  3OC9 A;  3V8Z A;  5C48 A;  5IFY A;  1W55 A;  4AAW A;  4HO4 A;  4HO5 A;  2YES A;  4Y7V A;  3JUK A;  1VGU A;  1VZX A;  4HO2 A;  4M2B A;  4MND A;  4NAI A;  2AM4 A;  3I0L A;  4FRQ A;  2Y4J A;  1VH3 A;  3IOJ A;  5J49 A;  3E25 A;  4K6R A;  2QGI A;  1ON8 A;  2AH9 A;  2WVK A;  3U2W A;  4CJC A;  3DJ4 A;  2BO7 A;  1H5S D;  1WSZ A;  2VK9 A;  1GA8 A;  4L41 C;  5EJ1 A;  3D98 A;  4GBP A;  5CMG X;  2D7R A;  5IDS A;  2AE7 A;  1HV9 A;  2GGO A;  5FTS A;  1G3L A;  3CU0 A;  4B2W A;  4CJB A;  1NKH B;  1VM8 A;  2DPW A;  5C4E A;  3JUJ A;  2QH5 A;  4HO8 A;  1WT2 A;  2NXV A;  2QKX A;  2FYC B;  1H4C A;  1H5S C;  4D0T A;  5AJP A;  5C1G A;  2Y6P A;  1JV1 A;  1V84 A;  4J18 A;  2YQH A;  1QWJ A;  2AES A;  1GX0 A;  3U2X A;  5C3B A;  1SS9 A;  3OAM A;  3U2T A;  1G97 A;  1TW1 A;  1ZJ3 A;  4ARW A;  5C4D A;  1ZCY A;  4ASY A;  4B2X A;  1O7Q A;  3R3I A;  4AC3 A;  4HO6 A;  2VS5 A;  1LZ7 A;  3RMV A;  1V83 A;  1LVW A;  5BXC A;  2AGD A;  4NAN A;  3CKQ A;  5CQN X;  1NQI B;  2WVM A;  1VPA A;  3BRK X;  3SX3 A;  2VXM A;  4EEG A;  1FO9 A;  2X60 A;  3R2W A;  1H7G A;  5C3D A;  3PNN A;  4EEA A;  1FO8 A;  3IOH A;  3I0D A;  4R7P A;  5C3A A;  5C36 A;  2VS4 A;  4HO9 A;  1HJL A;  5FU8 A;  4D48 A;  1FZW A;  1PZY B;  2YQS A;  1LL2 A;  4AYJ A;  1FRW A;  1S4N A;  4P00 A;  1ZI5 A;  1HM0 A;  1H7T A;  1FG5 N;  5C4C A;  3V91 A;  4KNX A;  1G2V A;  1YP4 A;  2Y4K A;  3D5N A;  3ZGG A;  4XWI A;  4HO3 A;  1O7O A;  1H5R B;  4LW6 A;  4FRB A;  4Y7U A;  4AYL A;  4KC1 A;  1H4E A;  3V0P A;  3V0Q A;  4FRA A;  4KXO A;  4G3P A;  2XWL A;  4G87 A;  3OH1 A;  4HCQ A;  3U0X A;  1FXO A;  1WT0 A;  2RJ5 A;  1G93 A;  1MP5 A;  1R7X A;  3TZT A;  5FUH A;  2E3D A;  4O6N A;  5L6S A;  2X65 A;  2WAW A;  1JVD A;  2PGY A;  2V0K A;  5JQQ A;  3EE5 A;  4FRL A;  4LW3 A;  3OH0 A;  1VGW A;  3CKO A;  5I1F A;  1MP3 A;  4KRV A;  4B4B A;  1FGX A;  2BO8 A;  5CMJ A;  2O1F A;  1JVG A;  1LZJ A;  1NMM B;  1OQM B;  4M28 A;  3RSB A;  3U2V A;  1ZHJ A;  2A8U A;  4Y6N A;  3JTJ A;  1R81 A;  5D91 A;  2D0J A;  2J0B A;  3IOI A;  4G3S A;  4NAK A;  4P02 A;  2UX8 A;  1HM9 A;  5D92 A;  4DDZ A;  1NWG B;  4EVW A;  3ZLL A;  1LL0 A;  1S4O A;  2ICX A;  3OH2 A;  3V0O A;  3V0N A;  1TVY A;  1ZJ2 A;  4EEM A;  4KPZ A;  4E1K A;  3I0K A;  3BCV A;  3O3P A;  1LZI A;  1WVC A;  1FWY A;  2Z86 A;  4G3Q A;  4Q7C A;  1IIM A;  4B3U A;  3SXE A;  1G0R A;  1LZ0 A;  3CKV A;  5C49 A;  5CMH A;  1EZI A;  4B4G A;  3PKP A;  3SX7 A;  2VSI A;  5C8R A;  3D8V A;  1JYL A;  1QG8 A;  3V0M A;  3U2U A;  4B4M A;  1ZI1 A;  5FU0 A;  3LW6 A;  2OI6 A;  3SXD A;  4C2S A;  2BO4 A;  2RIY A;  2WGZ A;  1G9R A;  1MP4 A;  2YQC A;  3T7O A;  4CVH A;  2YCM A;  2CU2 A;  2C0N A;  4D0Z A;  1Z90 A;  4KC4 A;  5DDV A;  1O0R A;  3DK5 A;  4B5B A;  4Y64 A;  4FIY A;  2BO6 A;  3QVB A;  2ZU9 A;  1ZJO A;  2VFZ A;  2V0H A;  5C4B A;  1OMX A;  4HG6 A;  1VGZ A;  4UEG A;  3SX5 A;  3I0H A;  4KC2 A;  4JIS A;  2VSH A;  3SXG A;  2JCJ A;  3E26 A;  2JCO A;  4FCU A;  4KNR A;  1INJ A;  4FRO A;  1ZDF A;  5C38 A;  2XWM A;  1R7U A;  4M4K A;  1G1L A;  3SXA A;  3FWW A;  4KPX A;  3OH3 A;  4ASJ A;  2RJ4 A;  2V0J A;  3I0E A;  4KQL A;  2P73 A;  3ZF8 A;  1VH1 A;  1GQC A;  5EJZ A;  3N9W A;  2I5K A;  3V90 A;  2WEE A;  1H5S B;  2J0A A;  2P6W A;  1ZCU A;  2ZU8 A;  4BMA A;  1GWW A;  2W0V A;  3Q4S A;  1GX4 A;  4EE3 A;  1ZI3 A;  5FTV A;  2OI7 A;  4M2A A;  1TW5 A;  1H5R A;  1H7L A;  2Y4L A;  2RJ9 A;  4FRM A;  5C1L A;  3I0G A;  2AM5 A;  1ZI4 A;  2FYB A;  3ST8 A;  1R80 A;  1OMZ A;  5L6V A;  4Y63 A;  4FRD A;  3RMW A;  1E5K A;  5CMI A;  3Q80 A;  1H5T B;  2JCK A;  1VZT A;  2E8B A;  3T7M A;  4DEC A;  1ON6 A;  3K8D A;  3CGX A;  5C4F A;  1IIN A;  1O23 B;  2FYA A;  2VD4 A; 
#chains in the Genus database with same CATH homology
 1K4V A;  1FR8 A;  4MIX A;  2AM3 A;  3I0C A;  1ZIZ A;  2O1G A;  5CQO A;  2I5E A;  1NF5 B;  4Y62 A;  2XMH A;  1EYR A;  4YS8 A;  3OKR A;  1LL3 A;  1WT1 A;  2RJ7 A;  1G95 A;  4MYB A;  2X5Z A;  3K8E A;  1H3M A;  2P72 A;  2FFV A;  5EIY A;  3F1Y A;  1GWV A;  1H7H A;  3SPT A;  4FRE A;  1VGT A;  2RJ8 A;  2ICY A;  4D11 C;  1I52 A;  3TQD A;  3V8Y A;  5CQP A;  1G23 A;  1INI A;  3Q7U A;  4Y7T A;  4FQW A;  2RIT A;  2ZU7 A;  1R7Y A;  5FYE A;  2VXL A;  2XME A;  5CQM X;  3SXC A;  5C1H A;  3SXB A;  4IRP A;  3ZLK A;  2AEC A;  2PGV A;  2OEF A;  3V0L A;  3I0F A;  4ZDQ A;  2XWN A;  3I0J A;  4Y9X A;  1HM8 A;  2RJ6 A;  3T7N A;  2FY7 A;  1HJJ A;  1QGQ A;  2GGQ A;  3OH4 A;  4HO0 A;  2WVL A;  4JD0 A;  4HOC A;  1R82 A;  2Y4M A;  2YC5 A;  1H4D A;  3USQ A;  3FOQ A;  3PKQ A;  1FGG A;  4FIX A;  3F1C A;  1FXJ A;  1V82 A;  1XZ6 A;  1ZJ1 A;  4ECM A;  1KWS A;  5CMF X;  4D11 A;  4EE4 A;  2YQJ A;  2X5S A;  1R7T A;  2FFU A;  4IRQ A;  1FR9 A;  3NGW A;  1S4P A;  2I7B A;  3USR A;  3U0Y A;  4CJ8 A;  2O1H A;  3POL A;  1ZCT A;  3KIA A;  1JV3 A;  2YC3 A;  3OGZ A;  5IDT A;  1H7F A;  5CQL X;  1NHE B;  3ZGF A;  2PX7 A;  4DE7 A;  2RJ0 A;  4KT7 A;  4O6M A;  1MC3 A;  1FOA A;  2JCL A;  4Y7G A;  4BQH A;  1H7Q A;  2WE9 A;  5HS2 A;  3CKJ A;  5C47 A;  1R7V A;  2VS3 A;  4NAL A;  4Y7F A;  3DUV A;  2A8W A;  4EEO A;  1YRO B;  1ZDG A;  1W77 A;  5DDT A;  2MZB A;  4FRH A;  1H5S A;  5AJO A;  1YP3 A;  1ZCV A;  5AJN A;  2RJ1 A;  2PA4 A;  2V0I A;  1JYK A;  2Y7A A;  2FYD B;  4Y6U A;  1YP2 A;  1VZU A;  2RIX A;  1XHB A;  2RIZ A;  1VIC A;  2W0W A;  3GUE A;  1ZJP A;  1PZT A;  1W57 A;  1GQ9 A;  4FRP A;  1H7E A;  2Z87 A;  4B42 A;  3CKN A;  2OI5 A;  1H5T A;  1QGS A;  5FV9 A;  1ZJ0 A;  2OEG A;  4EE5 A;  2Q4J A;  1TZF A;  1G8O A;  3HL3 A;  4FCE A;  3SX8 A;  2D7I A;  1WT3 A;  2APC A;  2V0L A;  3I0I X;  3OC9 A;  3V8Z A;  5C48 A;  5IFY A;  1W55 A;  4AAW A;  4HO4 A;  4HO5 A;  2YES A;  4Y7V A;  3JUK A;  1VGU A;  1VZX A;  4HO2 A;  4M2B A;  4MND A;  4NAI A;  2AM4 A;  3I0L A;  4FRQ A;  2Y4J A;  1VH3 A;  3IOJ A;  5J49 A;  3E25 A;  4K6R A;  2QGI A;  1ON8 A;  2AH9 A;  2WVK A;  3U2W A;  4CJC A;  3DJ4 A;  2BO7 A;  1H5S D;  1WSZ A;  2VK9 A;  1GA8 A;  4L41 C;  5EJ1 A;  3D98 A;  4GBP A;  5CMG X;  2D7R A;  5IDS A;  2AE7 A;  1HV9 A;  2GGO A;  5FTS A;  1G3L A;  3CU0 A;  4B2W A;  4CJB A;  1NKH B;  1VM8 A;  2DPW A;  5C4E A;  3JUJ A;  2QH5 A;  4HO8 A;  1WT2 A;  2NXV A;  2QKX A;  2FYC B;  1H4C A;  1H5S C;  4D0T A;  5AJP A;  5C1G A;  2Y6P A;  1JV1 A;  1V84 A;  4J18 A;  2YQH A;  1QWJ A;  2AES A;  1GX0 A;  3U2X A;  5C3B A;  1SS9 A;  3OAM A;  3U2T A;  1G97 A;  1TW1 A;  1ZJ3 A;  4ARW A;  5C4D A;  1ZCY A;  4ASY A;  4B2X A;  1O7Q A;  3R3I A;  4AC3 A;  4HO6 A;  2VS5 A;  1LZ7 A;  3RMV A;  1V83 A;  1LVW A;  5BXC A;  2AGD A;  4NAN A;  3CKQ A;  5CQN X;  1NQI B;  2WVM A;  1VPA A;  3BRK X;  3SX3 A;  2VXM A;  4EEG A;  1FO9 A;  2X60 A;  3R2W A;  1H7G A;  5C3D A;  3PNN A;  4EEA A;  1FO8 A;  3IOH A;  3I0D A;  4R7P A;  5C3A A;  5C36 A;  2VS4 A;  4HO9 A;  1HJL A;  5FU8 A;  4D48 A;  1FZW A;  1PZY B;  2YQS A;  1LL2 A;  4AYJ A;  1FRW A;  1S4N A;  4P00 A;  1ZI5 A;  1HM0 A;  1H7T A;  1FG5 N;  5C4C A;  3V91 A;  4KNX A;  1G2V A;  1YP4 A;  2Y4K A;  3D5N A;  3ZGG A;  4XWI A;  4HO3 A;  1O7O A;  1H5R B;  4LW6 A;  4FRB A;  4Y7U A;  4AYL A;  4KC1 A;  1H4E A;  3V0P A;  3V0Q A;  4FRA A;  4KXO A;  4G3P A;  2XWL A;  4G87 A;  3OH1 A;  4HCQ A;  3U0X A;  1FXO A;  1WT0 A;  2RJ5 A;  1G93 A;  1MP5 A;  1R7X A;  3TZT A;  5FUH A;  2E3D A;  4O6N A;  5L6S A;  2X65 A;  2WAW A;  1JVD A;  2PGY A;  2V0K A;  5JQQ A;  3EE5 A;  4FRL A;  4LW3 A;  3OH0 A;  1VGW A;  3CKO A;  5I1F A;  1MP3 A;  4KRV A;  4B4B A;  1FGX A;  2BO8 A;  5CMJ A;  2O1F A;  1JVG A;  1LZJ A;  1NMM B;  1OQM B;  4M28 A;  3RSB A;  3U2V A;  1ZHJ A;  2A8U A;  4Y6N A;  3JTJ A;  1R81 A;  5D91 A;  2D0J A;  2J0B A;  3IOI A;  4G3S A;  4NAK A;  4P02 A;  2UX8 A;  1HM9 A;  5D92 A;  4DDZ A;  1NWG B;  4EVW A;  3ZLL A;  1LL0 A;  1S4O A;  2ICX A;  3OH2 A;  3V0O A;  3V0N A;  1TVY A;  1ZJ2 A;  4EEM A;  4KPZ A;  4E1K A;  3I0K A;  3BCV A;  3O3P A;  1LZI A;  1WVC A;  1FWY A;  2Z86 A;  4G3Q A;  4Q7C A;  1IIM A;  4B3U A;  3SXE A;  1G0R A;  1LZ0 A;  3CKV A;  5C49 A;  5CMH A;  1EZI A;  4B4G A;  3PKP A;  3SX7 A;  2VSI A;  5C8R A;  3D8V A;  1JYL A;  1QG8 A;  3V0M A;  3U2U A;  4B4M A;  1ZI1 A;  5FU0 A;  3LW6 A;  2OI6 A;  3SXD A;  4C2S A;  2BO4 A;  2RIY A;  2WGZ A;  1G9R A;  1MP4 A;  2YQC A;  3T7O A;  4CVH A;  2YCM A;  2CU2 A;  2C0N A;  4D0Z A;  1Z90 A;  4KC4 A;  5DDV A;  1O0R A;  3DK5 A;  4B5B A;  4Y64 A;  4FIY A;  2BO6 A;  3QVB A;  2ZU9 A;  1ZJO A;  2VFZ A;  2V0H A;  5C4B A;  1OMX A;  4HG6 A;  1VGZ A;  4UEG A;  3SX5 A;  3I0H A;  4KC2 A;  4JIS A;  2VSH A;  3SXG A;  2JCJ A;  3E26 A;  2JCO A;  4FCU A;  4KNR A;  1INJ A;  4FRO A;  1ZDF A;  5C38 A;  2XWM A;  1R7U A;  4M4K A;  1G1L A;  3SXA A;  3FWW A;  4KPX A;  3OH3 A;  4ASJ A;  2RJ4 A;  2V0J A;  3I0E A;  4KQL A;  2P73 A;  3ZF8 A;  1VH1 A;  1GQC A;  5EJZ A;  3N9W A;  2I5K A;  3V90 A;  2WEE A;  1H5S B;  2J0A A;  2P6W A;  1ZCU A;  2ZU8 A;  4BMA A;  1GWW A;  2W0V A;  3Q4S A;  1GX4 A;  4EE3 A;  1ZI3 A;  5FTV A;  2OI7 A;  4M2A A;  1TW5 A;  1H5R A;  1H7L A;  2Y4L A;  2RJ9 A;  4FRM A;  5C1L A;  3I0G A;  2AM5 A;  1ZI4 A;  2FYB A;  3ST8 A;  1R80 A;  1OMZ A;  5L6V A;  4Y63 A;  4FRD A;  3RMW A;  1E5K A;  5CMI A;  3Q80 A;  1H5T B;  2JCK A;  1VZT A;  2E8B A;  3T7M A;  4DEC A;  1ON6 A;  3K8D A;  3CGX A;  5C4F A;  1IIN A;  1O23 B;  2FYA A;  2VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...