1VZTA

Roles of individual residues of alpha-1,3 galactosyltransferases in substrate binding and catalysis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
287
structure length
287
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAGWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Roles of Individual Enzyme-Substrate Interactions by Alpha-1,3-Galactosyltransferase in Catalysis and Specificity.
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vztA00
4KPZA 1R81A 2WEEA 1ZJ2A 1H5SD 4D11C 5IDSA 3RSBA 4Y6UA 5C1HA 2FYAA 3R2WA 3BRKX 2VS3A 4EEAA 4Y9XA 2AGDA 1JV3A 3O3PA 4IRPA 5L6SA 1QWJA 2YQCA 2WAWA 2AM3A 3E25A 4ASYA 1V82A 5DDVA 3RMVA 4KPXA 5AJNA 4KC2A 4M2AA 3PKPA 5C1LA 1H7EA 2OI6A 1VM8A 1FGXA 2JCKA 1R80A 5I1FA 2BO8A 1WT3A 1NMMB 2W0VA 4HO6A 5DDTA 4AYJA 1FGGA 1GQ9A 4D0TA 3TZTA 1JV1A 4HO5A 2RJ5A 1NWGB 4GBPA 3Q7UA 3ST8A 3OH1A 2WGZA 1H5RB 3EE5A 1H7QA 1H7TA 1FO9A 2V0HA 2O1FA 2RJ6A 3GUEA 2X5ZA 2RJ8A 2RJ7A 3USQA 1H7HA 1O7QA 4CJBA 2BO6A 2BO4A 2VD4A 2Z87A 3I0DA 3V8YA 2ZU8A 4HCQA 1OMXA 5C3DA 3ZLKA 3U0XA 4IRQA 1XZ6A 1NKHB 1H5SC 3U2UA 2PGVA 2FYBA 3OAMA 4FRDA 4MYBA 1R82A 4DDZA 3IOJA 4EE4A 3U2XA 2JCLA 2A8WA 1ZCUA 3PNNA 4Y7GA 1FZWA 2ICYA 2Q4JA 3I0CA 1LVWA 2YQHA 5IFYA 1LL0A 3V0QA 1ON8A 5FU8A 5IDTA 2AM4A 4EVWA 2FYCB 1ZJ0A 3BCVA 2APCA 5AJPA 4KC1A 3TQDA 1S4OA 3U2TA 3D8VA 2WE9A 2VFZA 5J49A 3CKVA 4Y7VA 3FOQA 3OH2A 1R7TA 5CMJA 4Y64A 3OH3A 3T7NA 3V0PA 5C4CA 4C2SA 4MNDA 5C1GA 4M28A 1KWSA 2WVLA 1W55A 4FQWA 1VH3A 3U2VA 3DK5A 4HO9A 2A8UA 4L41C 1TW5A 4LW3A 2QH5A 3R3IA 2ZU7A 2OEGA 5EJZA 4NALA 2D7IA 1LZ0A 3V90A 2PGYA 1S4NA 4E1KA 5C3AA 3JUKA 1FXOA 1H4CA 1G1LA 2VXMA 2WVMA 2RJ1A 1QGSA 3IOIA 4M4KA 1JVDA 4G87A 2RJ4A 5CQNX 3CKNA 2BO7A 3JUJA 1VGTA 3N9WA 2YQJA 3I0EA 2QKXA 1ZJ1A 2V0JA 2YESA 3I0HA 3OH4A 3U0YA 4KC4A 3I0GA 4LW6A 2RIXA 3I0FA 4HO2A 3I0LA 4KNXA 3U2WA 1H4DA 4FRAA 1WVCA 2GGQA 5CQPA 1EYRA 1G2VA 1R7XA 4KT7A 4B4MA 5CQMX 1SS9A 2X65A 1MC3A 4EEOA 5EJ1A 4AC3A 3ZF8A 1ZIZA 1G93A 2Y4MA 1WT1A 2E8BA 1G0RA 1MP4A 1VPAA 4G3PA 2V0LA 1O23B 1H5TA 5FU0A 4Y6NA 5C4FA 1E5KA 1TVYA 2D0JA 2V0IA 1G23A 1NHEB 1XHBA 4B5BA 1R7VA 4FRPA 2AH9A 4M2BA 1VZUA 4NANA 1YROB 4FREA 1VGWA 2MZBA 4B2WA 1ON6A 3RMWA 1QG8A 4CJ8A 3T7MA 1H7LA 3FWWA 1FO8A 1PZYB 1G3LA 3SXBA 4D11A 2X5SA 2NXVA 5C4DA 4FCUA 1VGUA 2ICXA 2RITA 1ZJPA 5C36A 1ZJ3A 1WSZA 4BQHA 1PZTA 5CQLX 1NQIB 2FFVA 4FRMA 1R7UA 3K8EA 5C48A 1VH1A 1LL3A 3SXAA 4HO8A 2FY7A 1GWVA 4HOCA 5HS2A 2ZU9A 5L6VA 1GQCA 4B4GA 2E3DA 1INJA 4HO3A 1HM9A 3SX8A 1W57A 3IOHA 4DECA 2VXLA 1JYKA 1VZTA 3CKJA 2P73A 3QVBA 1TW1A 4FRLA 5C49A 1NF5B 1LZ7A 1R7YA 2OI7A 3DJ4A 1ZI3A 1HJLA 4J18A 1HV9A 4Y62A 4Y63A 1ZI4A 2PA4A 4JISA 1JVGA 2Z86A 1V83A 1HM8A 3ZGFA 1VZXA 2Y7AA 3SXEA 3K8DA 4Y7FA 1H7GA 4Y7TA 2I7BA 3SXCA 2O1HA 1G95A 4FCEA 1H5SA 2OEFA 1MP3A 2D7RA 4FRHA 1FOAA 5BXCA 1OQMB 4EE5A 1S4PA 1H7FA 5CMHA 1TZFA 2FYDB 2I5EA 4KRVA 4CJCA 5JQQA 2RIZA 2VS4A 1ZJOA 1EZIA 4D0ZA 2UX8A 3V0OA 3V0NA 3ZLLA 3LW6A 4P00A 2XMEA 1YP2A 3HL3A 3NGWA 2Y4JA 1GX4A 3POLA 1OMZA 1LL2A 1G8OA 1V84A 4G3SA 4KXOA 3Q4SA 2FFUA 4AAWA 2W0WA 1ZI5A 1G9RA 3D98A 3E26A 4B4BA 4EEGA 4K6RA 2Y6PA 5CMGX 1VICA 2I5KA 2YQSA 3CKOA 3OH0A 5C38A 2YC5A 5FUHA 2DPWA 1H5RA 4B2XA 3V8ZA 4CVHA 2XMHA 1ZCTA 1MP5A 3ZGGA 2JCJA 2OI5A 1FWYA 2Y4LA 1ZCYA 4ARWA 1H5TB 2V0KA 4NAKA 2VSIA 3OC9A 4XWIA 3USRA 4HG6A 1GX0A 1Z90A 3D5NA 2JCOA 4EEMA 3OKRA 3V91A 1FR9A 2RJ9A 3I0KA 2XWNA 1QGQA 1ZDFA 4KNRA 4NAIA 2RIYA 1IINA 3I0JA 1H4EA 3PKQA 1H3MA 4YS8A 2GGOA 1ZDGA 2P6WA 1O0RA 5C47A 2PX7A 4Y7UA 1HJJA 1K4VA 1FRWA 4HO0A 3SX3A 1LZIA 3CU0A 5CQOA 1GA8A 1O7OA 2RJ0A 5FV9A 5C4EA 3F1YA 1WT2A 1G97A 1YP4A 4G3QA 1IIMA 3KIAA 3V0LA 1WT0A 3SXDA 2AE7A 3OGZA 3SX5A 4ECMA 2YCMA 1ZHJA 1ZCVA 1ZI1A 3F1CA 4UEGA 5FTVA 2Y4KA 5AJOA 4KQLA 2X60A 3I0IX 1HM0A 3V0MA 4EE3A 2AM5A 4P02A 4JD0A 4BMAA 4DE7A 3Q80A 2QGIA 4FRQA 5CMFX 2XWMA 2VSHA 4HO4A 2XWLA 4ZDQA 5C4BA 2P72A 1GWWA 4ASJA 2O1GA 2VS5A 3T7OA 5EIYA 3JTJA 2AESA 4AYLA 2AECA 4R7PA 1FR8A 3CKQA 3CGXA 2WVKA 1VGZA 4B3UA 4FRBA 1H5SB 4FROA 1FG5N 3SPTA 4D48A 5C3BA 2CU2A 1I52A 2YC3A 1JYLA 5FTSA 1INIA 1LZJA 3DUVA 1YP3A 4B42A 5CMIA 1W77A 3SXGA 3SX7A 5FYEA 1FXJA 5C8RA
chains in the Genus database with same CATH superfamily
4KPZA 1R81A 2WEEA 1ZJ2A 1H5SD 4D11C 5IDSA 3RSBA 4Y6UA 5C1HA 2FYAA 3R2WA 3BRKX 2VS3A 4EEAA 4Y9XA 2AGDA 1JV3A 3O3PA 4IRPA 5L6SA 1QWJA 2YQCA 2WAWA 2AM3A 3E25A 4ASYA 1V82A 5DDVA 3RMVA 4KPXA 5AJNA 4KC2A 4M2AA 3PKPA 5C1LA 1H7EA 2OI6A 1VM8A 1FGXA 2JCKA 1R80A 5I1FA 2BO8A 1WT3A 1NMMB 2W0VA 4HO6A 5DDTA 4AYJA 1FGGA 1GQ9A 4D0TA 3TZTA 1JV1A 4HO5A 2RJ5A 1NWGB 4GBPA 3Q7UA 3ST8A 3OH1A 2WGZA 1H5RB 3EE5A 5D91A 1H7QA 1H7TA 1FO9A 2V0HA 2O1FA 2RJ6A 3GUEA 2X5ZA 2RJ8A 2RJ7A 3USQA 1H7HA 1O7QA 4CJBA 2BO6A 2BO4A 2VD4A 2Z87A 3I0DA 3V8YA 2ZU8A 4HCQA 1OMXA 5C3DA 3ZLKA 3U0XA 4IRQA 1XZ6A 1NKHB 1H5SC 3U2UA 2PGVA 2FYBA 3OAMA 4FRDA 4MYBA 1R82A 4DDZA 4O6MA 3IOJA 4EE4A 3U2XA 2JCLA 2A8WA 1ZCUA 3PNNA 4Y7GA 1FZWA 2ICYA 2Q4JA 3I0CA 1LVWA 2YQHA 5IFYA 1LL0A 3V0QA 1ON8A 5FU8A 5IDTA 2AM4A 4EVWA 2FYCB 1ZJ0A 3BCVA 2APCA 5AJPA 4KC1A 3TQDA 1S4OA 3U2TA 3D8VA 2WE9A 2VFZA 5J49A 3CKVA 4Y7VA 3FOQA 3OH2A 1R7TA 5CMJA 4Y64A 3OH3A 3T7NA 3V0PA 5C4CA 4C2SA 4MNDA 5C1GA 4M28A 1KWSA 2WVLA 1W55A 4FQWA 1VH3A 3U2VA 3DK5A 4HO9A 2A8UA 4L41C 1TW5A 4LW3A 2QH5A 3R3IA 2ZU7A 2OEGA 5EJZA 4NALA 2D7IA 1LZ0A 3V90A 2PGYA 1S4NA 4E1KA 5C3AA 3JUKA 1FXOA 1H4CA 1G1LA 2VXMA 2WVMA 2RJ1A 1QGSA 3IOIA 4M4KA 1JVDA 4G87A 2RJ4A 5CQNX 3CKNA 2BO7A 3JUJA 1VGTA 3N9WA 2YQJA 3I0EA 2QKXA 1ZJ1A 2V0JA 2YESA 4FIYA 3I0HA 3OH4A 3U0YA 4KC4A 3I0GA 4LW6A 2RIXA 3I0FA 4HO2A 3I0LA 4KNXA 3U2WA 1H4DA 4FRAA 1WVCA 2GGQA 5CQPA 1EYRA 1G2VA 1R7XA 4KT7A 4B4MA 5CQMX 1SS9A 2X65A 1MC3A 4EEOA 5EJ1A 4AC3A 3ZF8A 1ZIZA 1G93A 2Y4MA 1WT1A 2E8BA 1G0RA 1MP4A 1VPAA 4G3PA 2V0LA 1O23B 1H5TA 5FU0A 4Y6NA 5C4FA 1E5KA 1TVYA 2D0JA 2V0IA 1G23A 1NHEB 1XHBA 4B5BA 1R7VA 4FRPA 2AH9A 4M2BA 1VZUA 4NANA 1YROB 4FREA 1VGWA 2MZBA 4B2WA 1ON6A 3RMWA 1QG8A 4CJ8A 3T7MA 1H7LA 3FWWA 1FO8A 1PZYB 1G3LA 3SXBA 4D11A 2X5SA 2NXVA 5C4DA 4FCUA 1VGUA 2ICXA 2RITA 1ZJPA 5C36A 1ZJ3A 1WSZA 4BQHA 1PZTA 5CQLX 1NQIB 2FFVA 4FRMA 1R7UA 3K8EA 5C48A 1VH1A 1LL3A 3SXAA 4HO8A 2FY7A 1GWVA 4HOCA 5HS2A 2ZU9A 5L6VA 1GQCA 4B4GA 2J0BA 2E3DA 2C0NA 1INJA 4HO3A 1HM9A 3SX8A 1W57A 3IOHA 4DECA 2VXLA 1JYKA 1VZTA 3CKJA 2P73A 3QVBA 1TW1A 4FRLA 5C49A 1NF5B 1LZ7A 1R7YA 2OI7A 3DJ4A 1ZI3A 1HJLA 4J18A 1HV9A 4Y62A 4Y63A 1ZI4A 2PA4A 4JISA 1JVGA 2Z86A 1V83A 1HM8A 3ZGFA 1VZXA 2Y7AA 3SXEA 3K8DA 4Y7FA 1H7GA 4Y7TA 2I7BA 3SXCA 2O1HA 1G95A 4FCEA 1H5SA 2OEFA 1MP3A 2D7RA 4FRHA 4MIXA 1FOAA 5BXCA 1OQMB 4EE5A 1S4PA 1H7FA 5CMHA 1TZFA 2FYDB 2I5EA 4KRVA 4CJCA 5JQQA 2RIZA 2VS4A 1ZJOA 1EZIA 4D0ZA 2UX8A 3V0OA 3V0NA 3ZLLA 3LW6A 4P00A 2XMEA 1YP2A 2J0AA 3HL3A 3NGWA 2Y4JA 1GX4A 3POLA 1OMZA 1LL2A 2VK9A 1G8OA 1V84A 4G3SA 4KXOA 3Q4SA 2FFUA 4AAWA 2W0WA 1ZI5A 1G9RA 3D98A 3E26A 5D92A 4B4BA 4EEGA 4K6RA 2Y6PA 5CMGX 1VICA 2I5KA 2YQSA 3CKOA 3OH0A 5C38A 2YC5A 5FUHA 2DPWA 1H5RA 4B2XA 3V8ZA 4CVHA 2XMHA 1ZCTA 1MP5A 3ZGGA 2JCJA 2OI5A 1FWYA 2Y4LA 1ZCYA 4ARWA 1H5TB 2V0KA 4NAKA 2VSIA 3OC9A 4XWIA 3USRA 4HG6A 1GX0A 1Z90A 3D5NA 2JCOA 4EEMA 3OKRA 3V91A 1FR9A 2RJ9A 3I0KA 2XWNA 4Q7CA 1QGQA 1ZDFA 4KNRA 4NAIA 2RIYA 1IINA 3I0JA 1H4EA 3PKQA 1H3MA 4YS8A 2GGOA 1ZDGA 2P6WA 1O0RA 5C47A 2PX7A 4Y7UA 1HJJA 1K4VA 1FRWA 4HO0A 3SX3A 1LZIA 3CU0A 5CQOA 1GA8A 1O7OA 2RJ0A 5FV9A 5C4EA 3F1YA 1WT2A 1G97A 1YP4A 4G3QA 1IIMA 3KIAA 3V0LA 1WT0A 3SXDA 2AE7A 3OGZA 3SX5A 4ECMA 2YCMA 1ZHJA 1ZCVA 1ZI1A 4O6NA 3F1CA 4UEGA 5FTVA 2Y4KA 5AJOA 4KQLA 2X60A 3I0IX 1HM0A 3V0MA 4EE3A 2AM5A 4P02A 4JD0A 4BMAA 4DE7A 3Q80A 2QGIA 4FRQA 5CMFX 2XWMA 2VSHA 4HO4A 2XWLA 4ZDQA 5C4BA 2P72A 1GWWA 4ASJA 2O1GA 2VS5A 3T7OA 5EIYA 3JTJA 2AESA 4AYLA 2AECA 4R7PA 1FR8A 3CKQA 3CGXA 2WVKA 4FIXA 1VGZA 4B3UA 4FRBA 1H5SB 4FROA 1FG5N 3SPTA 4D48A 5C3BA 2CU2A 1I52A 2YC3A 1JYLA 5FTSA 1INIA 1LZJA 3DUVA 1YP3A 4B42A 5CMIA 1W77A 3SXGA 3SX7A 5FYEA 1FXJA 5C8RA
chains in the Genus database with same CATH topology
4KPZA 1R81A 2WEEA 1ZJ2A 1H5SD 4D11C 5IDSA 3RSBA 4Y6UA 5C1HA 2FYAA 3R2WA 3BRKX 2VS3A 4EEAA 4Y9XA 2AGDA 1JV3A 3O3PA 4IRPA 5L6SA 1QWJA 2YQCA 2WAWA 2AM3A 3E25A 4ASYA 1V82A 5DDVA 3RMVA 4KPXA 5AJNA 4KC2A 4M2AA 3PKPA 5C1LA 1H7EA 2OI6A 1VM8A 1FGXA 2JCKA 1R80A 5I1FA 2BO8A 1WT3A 1NMMB 2W0VA 4HO6A 5DDTA 4AYJA 1FGGA 1GQ9A 4D0TA 3TZTA 1JV1A 4HO5A 2RJ5A 1NWGB 4GBPA 3Q7UA 3ST8A 3OH1A 2WGZA 1H5RB 3EE5A 5D91A 1H7QA 1H7TA 1FO9A 2V0HA 2O1FA 2RJ6A 3GUEA 2X5ZA 2RJ8A 2RJ7A 3USQA 1H7HA 1O7QA 4CJBA 2BO6A 2BO4A 2VD4A 2Z87A 3I0DA 3V8YA 2ZU8A 4HCQA 1OMXA 5C3DA 3ZLKA 3U0XA 4IRQA 1XZ6A 1NKHB 1H5SC 3U2UA 2PGVA 2FYBA 3OAMA 4FRDA 4MYBA 1R82A 4DDZA 4O6MA 3IOJA 4EE4A 3U2XA 2JCLA 2A8WA 1ZCUA 3PNNA 4Y7GA 1FZWA 2ICYA 2Q4JA 3I0CA 1LVWA 2YQHA 5IFYA 1LL0A 3V0QA 1ON8A 5FU8A 5IDTA 2AM4A 4EVWA 2FYCB 1ZJ0A 3BCVA 2APCA 5AJPA 4KC1A 3TQDA 1S4OA 3U2TA 3D8VA 2WE9A 2VFZA 5J49A 3CKVA 4Y7VA 3FOQA 3OH2A 1R7TA 5CMJA 4Y64A 3OH3A 3T7NA 3V0PA 5C4CA 4C2SA 4MNDA 5C1GA 4M28A 1KWSA 2WVLA 1W55A 4FQWA 1VH3A 3U2VA 3DK5A 4HO9A 2A8UA 4L41C 1TW5A 4LW3A 2QH5A 3R3IA 2ZU7A 2OEGA 5EJZA 4NALA 2D7IA 1LZ0A 3V90A 2PGYA 1S4NA 4E1KA 5C3AA 3JUKA 1FXOA 1H4CA 1G1LA 2VXMA 2WVMA 2RJ1A 1QGSA 3IOIA 4M4KA 1JVDA 4G87A 2RJ4A 5CQNX 3CKNA 2BO7A 3JUJA 1VGTA 3N9WA 2YQJA 3I0EA 2QKXA 1ZJ1A 2V0JA 2YESA 4FIYA 3I0HA 3OH4A 3U0YA 4KC4A 3I0GA 4LW6A 2RIXA 3I0FA 4HO2A 3I0LA 4KNXA 3U2WA 1H4DA 4FRAA 1WVCA 2GGQA 5CQPA 1EYRA 1G2VA 1R7XA 4KT7A 4B4MA 5CQMX 1SS9A 2X65A 1MC3A 4EEOA 5EJ1A 4AC3A 3ZF8A 1ZIZA 1G93A 2Y4MA 1WT1A 2E8BA 1G0RA 1MP4A 1VPAA 4G3PA 2V0LA 1O23B 1H5TA 5FU0A 4Y6NA 5C4FA 1E5KA 1TVYA 2D0JA 2V0IA 1G23A 1NHEB 1XHBA 4B5BA 1R7VA 4FRPA 2AH9A 4M2BA 1VZUA 4NANA 1YROB 4FREA 1VGWA 2MZBA 4B2WA 1ON6A 3RMWA 1QG8A 4CJ8A 3T7MA 1H7LA 3FWWA 1FO8A 1PZYB 1G3LA 3SXBA 4D11A 2X5SA 2NXVA 5C4DA 4FCUA 1VGUA 2ICXA 2RITA 1ZJPA 5C36A 1ZJ3A 1WSZA 4BQHA 1PZTA 5CQLX 1NQIB 2FFVA 4FRMA 1R7UA 3K8EA 5C48A 1VH1A 1LL3A 3SXAA 4HO8A 2FY7A 1GWVA 4HOCA 5HS2A 2ZU9A 5L6VA 1GQCA 4B4GA 2J0BA 2E3DA 2C0NA 1INJA 4HO3A 1HM9A 3SX8A 1W57A 3IOHA 4DECA 2VXLA 1JYKA 1VZTA 3CKJA 2P73A 3QVBA 1TW1A 4FRLA 5C49A 1NF5B 1LZ7A 1R7YA 2OI7A 3DJ4A 1ZI3A 1HJLA 4J18A 1HV9A 4Y62A 4Y63A 1ZI4A 2PA4A 4JISA 1JVGA 2Z86A 1V83A 1HM8A 3ZGFA 1VZXA 2Y7AA 3SXEA 3K8DA 4Y7FA 1H7GA 4Y7TA 2I7BA 3SXCA 2O1HA 1G95A 4FCEA 1H5SA 2OEFA 1MP3A 2D7RA 4FRHA 4MIXA 1FOAA 5BXCA 1OQMB 4EE5A 1S4PA 1H7FA 5CMHA 1TZFA 2FYDB 2I5EA 4KRVA 4CJCA 5JQQA 2RIZA 2VS4A 1ZJOA 1EZIA 4D0ZA 2UX8A 3V0OA 3V0NA 3ZLLA 3LW6A 4P00A 2XMEA 1YP2A 2J0AA 3HL3A 3NGWA 2Y4JA 1GX4A 3POLA 1OMZA 1LL2A 2VK9A 1G8OA 1V84A 4G3SA 4KXOA 3Q4SA 2FFUA 4AAWA 2W0WA 1ZI5A 1G9RA 3D98A 3E26A 5D92A 4B4BA 4EEGA 4K6RA 2Y6PA 5CMGX 1VICA 2I5KA 2YQSA 3CKOA 3OH0A 5C38A 2YC5A 5FUHA 2DPWA 1H5RA 4B2XA 3V8ZA 4CVHA 2XMHA 1ZCTA 1MP5A 3ZGGA 2JCJA 2OI5A 1FWYA 2Y4LA 1ZCYA 4ARWA 1H5TB 2V0KA 4NAKA 2VSIA 3OC9A 4XWIA 3USRA 4HG6A 1GX0A 1Z90A 3D5NA 2JCOA 4EEMA 3OKRA 3V91A 1FR9A 2RJ9A 3I0KA 2XWNA 4Q7CA 1QGQA 1ZDFA 4KNRA 4NAIA 2RIYA 1IINA 3I0JA 1H4EA 3PKQA 1H3MA 4YS8A 2GGOA 1ZDGA 2P6WA 1O0RA 5C47A 2PX7A 4Y7UA 1HJJA 1K4VA 1FRWA 4HO0A 3SX3A 1LZIA 3CU0A 5CQOA 1GA8A 1O7OA 2RJ0A 5FV9A 5C4EA 3F1YA 1WT2A 1G97A 1YP4A 4G3QA 1IIMA 3KIAA 3V0LA 1WT0A 3SXDA 2AE7A 3OGZA 3SX5A 4ECMA 2YCMA 1ZHJA 1ZCVA 1ZI1A 4O6NA 3F1CA 4UEGA 5FTVA 2Y4KA 5AJOA 4KQLA 2X60A 3I0IX 1HM0A 3V0MA 4EE3A 2AM5A 4P02A 4JD0A 4BMAA 4DE7A 3Q80A 2QGIA 4FRQA 5CMFX 2XWMA 2VSHA 4HO4A 2XWLA 4ZDQA 5C4BA 2P72A 1GWWA 4ASJA 2O1GA 2VS5A 3T7OA 5EIYA 3JTJA 2AESA 4AYLA 2AECA 4R7PA 1FR8A 3CKQA 3CGXA 2WVKA 4FIXA 1VGZA 4B3UA 4FRBA 1H5SB 4FROA 1FG5N 3SPTA 4D48A 5C3BA 2CU2A 1I52A 2YC3A 1JYLA 5FTSA 1INIA 1LZJA 3DUVA 1YP3A 4B42A 5CMIA 1W77A 3SXGA 3SX7A 5FYEA 1FXJA 5C8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPZ A;  1R81 A;  2WEE A;  1ZJ2 A;  1H5S D;  4D11 C;  5IDS A;  3RSB A;  4Y6U A;  5C1H A;  2FYA A;  3R2W A;  3BRK X;  2VS3 A;  4EEA A;  4Y9X A;  2AGD A;  1JV3 A;  3O3P A;  4IRP A;  5L6S A;  1QWJ A;  2YQC A;  2WAW A;  2AM3 A;  3E25 A;  4ASY A;  1V82 A;  5DDV A;  3RMV A;  4KPX A;  5AJN A;  4KC2 A;  4M2A A;  3PKP A;  5C1L A;  1H7E A;  2OI6 A;  1VM8 A;  1FGX A;  2JCK A;  1R80 A;  5I1F A;  2BO8 A;  1WT3 A;  1NMM B;  2W0V A;  4HO6 A;  5DDT A;  4AYJ A;  1FGG A;  1GQ9 A;  4D0T A;  3TZT A;  1JV1 A;  4HO5 A;  2RJ5 A;  1NWG B;  4GBP A;  3Q7U A;  3ST8 A;  3OH1 A;  2WGZ A;  1H5R B;  3EE5 A;  1H7Q A;  1H7T A;  1FO9 A;  2V0H A;  2O1F A;  2RJ6 A;  3GUE A;  2X5Z A;  2RJ8 A;  2RJ7 A;  3USQ A;  1H7H A;  1O7Q A;  4CJB A;  2BO6 A;  2BO4 A;  2VD4 A;  2Z87 A;  3I0D A;  3V8Y A;  2ZU8 A;  4HCQ A;  1OMX A;  5C3D A;  3ZLK A;  3U0X A;  4IRQ A;  1XZ6 A;  1NKH B;  1H5S C;  3U2U A;  2PGV A;  2FYB A;  3OAM A;  4FRD A;  4MYB A;  1R82 A;  4DDZ A;  3IOJ A;  4EE4 A;  3U2X A;  2JCL A;  2A8W A;  1ZCU A;  3PNN A;  4Y7G A;  1FZW A;  2ICY A;  2Q4J A;  3I0C A;  1LVW A;  2YQH A;  5IFY A;  1LL0 A;  3V0Q A;  1ON8 A;  5FU8 A;  5IDT A;  2AM4 A;  4EVW A;  2FYC B;  1ZJ0 A;  3BCV A;  2APC A;  5AJP A;  4KC1 A;  3TQD A;  1S4O A;  3U2T A;  3D8V A;  2WE9 A;  2VFZ A;  5J49 A;  3CKV A;  4Y7V A;  3FOQ A;  3OH2 A;  1R7T A;  5CMJ A;  4Y64 A;  3OH3 A;  3T7N A;  3V0P A;  5C4C A;  4C2S A;  4MND A;  5C1G A;  4M28 A;  1KWS A;  2WVL A;  1W55 A;  4FQW A;  1VH3 A;  3U2V A;  3DK5 A;  4HO9 A;  2A8U A;  4L41 C;  1TW5 A;  4LW3 A;  2QH5 A;  3R3I A;  2ZU7 A;  2OEG A;  5EJZ A;  4NAL A;  2D7I A;  1LZ0 A;  3V90 A;  2PGY A;  1S4N A;  4E1K A;  5C3A A;  3JUK A;  1FXO A;  1H4C A;  1G1L A;  2VXM A;  2WVM A;  2RJ1 A;  1QGS A;  3IOI A;  4M4K A;  1JVD A;  4G87 A;  2RJ4 A;  5CQN X;  3CKN A;  2BO7 A;  3JUJ A;  1VGT A;  3N9W A;  2YQJ A;  3I0E A;  2QKX A;  1ZJ1 A;  2V0J A;  2YES A;  3I0H A;  3OH4 A;  3U0Y A;  4KC4 A;  3I0G A;  4LW6 A;  2RIX A;  3I0F A;  4HO2 A;  3I0L A;  4KNX A;  3U2W A;  1H4D A;  4FRA A;  1WVC A;  2GGQ A;  5CQP A;  1EYR A;  1G2V A;  1R7X A;  4KT7 A;  4B4M A;  5CQM X;  1SS9 A;  2X65 A;  1MC3 A;  4EEO A;  5EJ1 A;  4AC3 A;  3ZF8 A;  1ZIZ A;  1G93 A;  2Y4M A;  1WT1 A;  2E8B A;  1G0R A;  1MP4 A;  1VPA A;  4G3P A;  2V0L A;  1O23 B;  1H5T A;  5FU0 A;  4Y6N A;  5C4F A;  1E5K A;  1TVY A;  2D0J A;  2V0I A;  1G23 A;  1NHE B;  1XHB A;  4B5B A;  1R7V A;  4FRP A;  2AH9 A;  4M2B A;  1VZU A;  4NAN A;  1YRO B;  4FRE A;  1VGW A;  2MZB A;  4B2W A;  1ON6 A;  3RMW A;  1QG8 A;  4CJ8 A;  3T7M A;  1H7L A;  3FWW A;  1FO8 A;  1PZY B;  1G3L A;  3SXB A;  4D11 A;  2X5S A;  2NXV A;  5C4D A;  4FCU A;  1VGU A;  2ICX A;  2RIT A;  1ZJP A;  5C36 A;  1ZJ3 A;  1WSZ A;  4BQH A;  1PZT A;  5CQL X;  1NQI B;  2FFV A;  4FRM A;  1R7U A;  3K8E A;  5C48 A;  1VH1 A;  1LL3 A;  3SXA A;  4HO8 A;  2FY7 A;  1GWV A;  4HOC A;  5HS2 A;  2ZU9 A;  5L6V A;  1GQC A;  4B4G A;  2E3D A;  1INJ A;  4HO3 A;  1HM9 A;  3SX8 A;  1W57 A;  3IOH A;  4DEC A;  2VXL A;  1JYK A;  1VZT A;  3CKJ A;  2P73 A;  3QVB A;  1TW1 A;  4FRL A;  5C49 A;  1NF5 B;  1LZ7 A;  1R7Y A;  2OI7 A;  3DJ4 A;  1ZI3 A;  1HJL A;  4J18 A;  1HV9 A;  4Y62 A;  4Y63 A;  1ZI4 A;  2PA4 A;  4JIS A;  1JVG A;  2Z86 A;  1V83 A;  1HM8 A;  3ZGF A;  1VZX A;  2Y7A A;  3SXE A;  3K8D A;  4Y7F A;  1H7G A;  4Y7T A;  2I7B A;  3SXC A;  2O1H A;  1G95 A;  4FCE A;  1H5S A;  2OEF A;  1MP3 A;  2D7R A;  4FRH A;  1FOA A;  5BXC A;  1OQM B;  4EE5 A;  1S4P A;  1H7F A;  5CMH A;  1TZF A;  2FYD B;  2I5E A;  4KRV A;  4CJC A;  5JQQ A;  2RIZ A;  2VS4 A;  1ZJO A;  1EZI A;  4D0Z A;  2UX8 A;  3V0O A;  3V0N A;  3ZLL A;  3LW6 A;  4P00 A;  2XME A;  1YP2 A;  3HL3 A;  3NGW A;  2Y4J A;  1GX4 A;  3POL A;  1OMZ A;  1LL2 A;  1G8O A;  1V84 A;  4G3S A;  4KXO A;  3Q4S A;  2FFU A;  4AAW A;  2W0W A;  1ZI5 A;  1G9R A;  3D98 A;  3E26 A;  4B4B A;  4EEG A;  4K6R A;  2Y6P A;  5CMG X;  1VIC A;  2I5K A;  2YQS A;  3CKO A;  3OH0 A;  5C38 A;  2YC5 A;  5FUH A;  2DPW A;  1H5R A;  4B2X A;  3V8Z A;  4CVH A;  2XMH A;  1ZCT A;  1MP5 A;  3ZGG A;  2JCJ A;  2OI5 A;  1FWY A;  2Y4L A;  1ZCY A;  4ARW A;  1H5T B;  2V0K A;  4NAK A;  2VSI A;  3OC9 A;  4XWI A;  3USR A;  4HG6 A;  1GX0 A;  1Z90 A;  3D5N A;  2JCO A;  4EEM A;  3OKR A;  3V91 A;  1FR9 A;  2RJ9 A;  3I0K A;  2XWN A;  1QGQ A;  1ZDF A;  4KNR A;  4NAI A;  2RIY A;  1IIN A;  3I0J A;  1H4E A;  3PKQ A;  1H3M A;  4YS8 A;  2GGO A;  1ZDG A;  2P6W A;  1O0R A;  5C47 A;  2PX7 A;  4Y7U A;  1HJJ A;  1K4V A;  1FRW A;  4HO0 A;  3SX3 A;  1LZI A;  3CU0 A;  5CQO A;  1GA8 A;  1O7O A;  2RJ0 A;  5FV9 A;  5C4E A;  3F1Y A;  1WT2 A;  1G97 A;  1YP4 A;  4G3Q A;  1IIM A;  3KIA A;  3V0L A;  1WT0 A;  3SXD A;  2AE7 A;  3OGZ A;  3SX5 A;  4ECM A;  2YCM A;  1ZHJ A;  1ZCV A;  1ZI1 A;  3F1C A;  4UEG A;  5FTV A;  2Y4K A;  5AJO A;  4KQL A;  2X60 A;  3I0I X;  1HM0 A;  3V0M A;  4EE3 A;  2AM5 A;  4P02 A;  4JD0 A;  4BMA A;  4DE7 A;  3Q80 A;  2QGI A;  4FRQ A;  5CMF X;  2XWM A;  2VSH A;  4HO4 A;  2XWL A;  4ZDQ A;  5C4B A;  2P72 A;  1GWW A;  4ASJ A;  2O1G A;  2VS5 A;  3T7O A;  5EIY A;  3JTJ A;  2AES A;  4AYL A;  2AEC A;  4R7P A;  1FR8 A;  3CKQ A;  3CGX A;  2WVK A;  1VGZ A;  4B3U A;  4FRB A;  1H5S B;  4FRO A;  1FG5 N;  3SPT A;  4D48 A;  5C3B A;  2CU2 A;  1I52 A;  2YC3 A;  1JYL A;  5FTS A;  1INI A;  1LZJ A;  3DUV A;  1YP3 A;  4B42 A;  5CMI A;  1W77 A;  3SXG A;  3SX7 A;  5FYE A;  1FXJ A;  5C8R A; 
#chains in the Genus database with same CATH topology
 4KPZ A;  1R81 A;  2WEE A;  1ZJ2 A;  1H5S D;  4D11 C;  5IDS A;  3RSB A;  4Y6U A;  5C1H A;  2FYA A;  3R2W A;  3BRK X;  2VS3 A;  4EEA A;  4Y9X A;  2AGD A;  1JV3 A;  3O3P A;  4IRP A;  5L6S A;  1QWJ A;  2YQC A;  2WAW A;  2AM3 A;  3E25 A;  4ASY A;  1V82 A;  5DDV A;  3RMV A;  4KPX A;  5AJN A;  4KC2 A;  4M2A A;  3PKP A;  5C1L A;  1H7E A;  2OI6 A;  1VM8 A;  1FGX A;  2JCK A;  1R80 A;  5I1F A;  2BO8 A;  1WT3 A;  1NMM B;  2W0V A;  4HO6 A;  5DDT A;  4AYJ A;  1FGG A;  1GQ9 A;  4D0T A;  3TZT A;  1JV1 A;  4HO5 A;  2RJ5 A;  1NWG B;  4GBP A;  3Q7U A;  3ST8 A;  3OH1 A;  2WGZ A;  1H5R B;  3EE5 A;  5D91 A;  1H7Q A;  1H7T A;  1FO9 A;  2V0H A;  2O1F A;  2RJ6 A;  3GUE A;  2X5Z A;  2RJ8 A;  2RJ7 A;  3USQ A;  1H7H A;  1O7Q A;  4CJB A;  2BO6 A;  2BO4 A;  2VD4 A;  2Z87 A;  3I0D A;  3V8Y A;  2ZU8 A;  4HCQ A;  1OMX A;  5C3D A;  3ZLK A;  3U0X A;  4IRQ A;  1XZ6 A;  1NKH B;  1H5S C;  3U2U A;  2PGV A;  2FYB A;  3OAM A;  4FRD A;  4MYB A;  1R82 A;  4DDZ A;  4O6M A;  3IOJ A;  4EE4 A;  3U2X A;  2JCL A;  2A8W A;  1ZCU A;  3PNN A;  4Y7G A;  1FZW A;  2ICY A;  2Q4J A;  3I0C A;  1LVW A;  2YQH A;  5IFY A;  1LL0 A;  3V0Q A;  1ON8 A;  5FU8 A;  5IDT A;  2AM4 A;  4EVW A;  2FYC B;  1ZJ0 A;  3BCV A;  2APC A;  5AJP A;  4KC1 A;  3TQD A;  1S4O A;  3U2T A;  3D8V A;  2WE9 A;  2VFZ A;  5J49 A;  3CKV A;  4Y7V A;  3FOQ A;  3OH2 A;  1R7T A;  5CMJ A;  4Y64 A;  3OH3 A;  3T7N A;  3V0P A;  5C4C A;  4C2S A;  4MND A;  5C1G A;  4M28 A;  1KWS A;  2WVL A;  1W55 A;  4FQW A;  1VH3 A;  3U2V A;  3DK5 A;  4HO9 A;  2A8U A;  4L41 C;  1TW5 A;  4LW3 A;  2QH5 A;  3R3I A;  2ZU7 A;  2OEG A;  5EJZ A;  4NAL A;  2D7I A;  1LZ0 A;  3V90 A;  2PGY A;  1S4N A;  4E1K A;  5C3A A;  3JUK A;  1FXO A;  1H4C A;  1G1L A;  2VXM A;  2WVM A;  2RJ1 A;  1QGS A;  3IOI A;  4M4K A;  1JVD A;  4G87 A;  2RJ4 A;  5CQN X;  3CKN A;  2BO7 A;  3JUJ A;  1VGT A;  3N9W A;  2YQJ A;  3I0E A;  2QKX A;  1ZJ1 A;  2V0J A;  2YES A;  4FIY A;  3I0H A;  3OH4 A;  3U0Y A;  4KC4 A;  3I0G A;  4LW6 A;  2RIX A;  3I0F A;  4HO2 A;  3I0L A;  4KNX A;  3U2W A;  1H4D A;  4FRA A;  1WVC A;  2GGQ A;  5CQP A;  1EYR A;  1G2V A;  1R7X A;  4KT7 A;  4B4M A;  5CQM X;  1SS9 A;  2X65 A;  1MC3 A;  4EEO A;  5EJ1 A;  4AC3 A;  3ZF8 A;  1ZIZ A;  1G93 A;  2Y4M A;  1WT1 A;  2E8B A;  1G0R A;  1MP4 A;  1VPA A;  4G3P A;  2V0L A;  1O23 B;  1H5T A;  5FU0 A;  4Y6N A;  5C4F A;  1E5K A;  1TVY A;  2D0J A;  2V0I A;  1G23 A;  1NHE B;  1XHB A;  4B5B A;  1R7V A;  4FRP A;  2AH9 A;  4M2B A;  1VZU A;  4NAN A;  1YRO B;  4FRE A;  1VGW A;  2MZB A;  4B2W A;  1ON6 A;  3RMW A;  1QG8 A;  4CJ8 A;  3T7M A;  1H7L A;  3FWW A;  1FO8 A;  1PZY B;  1G3L A;  3SXB A;  4D11 A;  2X5S A;  2NXV A;  5C4D A;  4FCU A;  1VGU A;  2ICX A;  2RIT A;  1ZJP A;  5C36 A;  1ZJ3 A;  1WSZ A;  4BQH A;  1PZT A;  5CQL X;  1NQI B;  2FFV A;  4FRM A;  1R7U A;  3K8E A;  5C48 A;  1VH1 A;  1LL3 A;  3SXA A;  4HO8 A;  2FY7 A;  1GWV A;  4HOC A;  5HS2 A;  2ZU9 A;  5L6V A;  1GQC A;  4B4G A;  2J0B A;  2E3D A;  2C0N A;  1INJ A;  4HO3 A;  1HM9 A;  3SX8 A;  1W57 A;  3IOH A;  4DEC A;  2VXL A;  1JYK A;  1VZT A;  3CKJ A;  2P73 A;  3QVB A;  1TW1 A;  4FRL A;  5C49 A;  1NF5 B;  1LZ7 A;  1R7Y A;  2OI7 A;  3DJ4 A;  1ZI3 A;  1HJL A;  4J18 A;  1HV9 A;  4Y62 A;  4Y63 A;  1ZI4 A;  2PA4 A;  4JIS A;  1JVG A;  2Z86 A;  1V83 A;  1HM8 A;  3ZGF A;  1VZX A;  2Y7A A;  3SXE A;  3K8D A;  4Y7F A;  1H7G A;  4Y7T A;  2I7B A;  3SXC A;  2O1H A;  1G95 A;  4FCE A;  1H5S A;  2OEF A;  1MP3 A;  2D7R A;  4FRH A;  4MIX A;  1FOA A;  5BXC A;  1OQM B;  4EE5 A;  1S4P A;  1H7F A;  5CMH A;  1TZF A;  2FYD B;  2I5E A;  4KRV A;  4CJC A;  5JQQ A;  2RIZ A;  2VS4 A;  1ZJO A;  1EZI A;  4D0Z A;  2UX8 A;  3V0O A;  3V0N A;  3ZLL A;  3LW6 A;  4P00 A;  2XME A;  1YP2 A;  2J0A A;  3HL3 A;  3NGW A;  2Y4J A;  1GX4 A;  3POL A;  1OMZ A;  1LL2 A;  2VK9 A;  1G8O A;  1V84 A;  4G3S A;  4KXO A;  3Q4S A;  2FFU A;  4AAW A;  2W0W A;  1ZI5 A;  1G9R A;  3D98 A;  3E26 A;  5D92 A;  4B4B A;  4EEG A;  4K6R A;  2Y6P A;  5CMG X;  1VIC A;  2I5K A;  2YQS A;  3CKO A;  3OH0 A;  5C38 A;  2YC5 A;  5FUH A;  2DPW A;  1H5R A;  4B2X A;  3V8Z A;  4CVH A;  2XMH A;  1ZCT A;  1MP5 A;  3ZGG A;  2JCJ A;  2OI5 A;  1FWY A;  2Y4L A;  1ZCY A;  4ARW A;  1H5T B;  2V0K A;  4NAK A;  2VSI A;  3OC9 A;  4XWI A;  3USR A;  4HG6 A;  1GX0 A;  1Z90 A;  3D5N A;  2JCO A;  4EEM A;  3OKR A;  3V91 A;  1FR9 A;  2RJ9 A;  3I0K A;  2XWN A;  4Q7C A;  1QGQ A;  1ZDF A;  4KNR A;  4NAI A;  2RIY A;  1IIN A;  3I0J A;  1H4E A;  3PKQ A;  1H3M A;  4YS8 A;  2GGO A;  1ZDG A;  2P6W A;  1O0R A;  5C47 A;  2PX7 A;  4Y7U A;  1HJJ A;  1K4V A;  1FRW A;  4HO0 A;  3SX3 A;  1LZI A;  3CU0 A;  5CQO A;  1GA8 A;  1O7O A;  2RJ0 A;  5FV9 A;  5C4E A;  3F1Y A;  1WT2 A;  1G97 A;  1YP4 A;  4G3Q A;  1IIM A;  3KIA A;  3V0L A;  1WT0 A;  3SXD A;  2AE7 A;  3OGZ A;  3SX5 A;  4ECM A;  2YCM A;  1ZHJ A;  1ZCV A;  1ZI1 A;  4O6N A;  3F1C A;  4UEG A;  5FTV A;  2Y4K A;  5AJO A;  4KQL A;  2X60 A;  3I0I X;  1HM0 A;  3V0M A;  4EE3 A;  2AM5 A;  4P02 A;  4JD0 A;  4BMA A;  4DE7 A;  3Q80 A;  2QGI A;  4FRQ A;  5CMF X;  2XWM A;  2VSH A;  4HO4 A;  2XWL A;  4ZDQ A;  5C4B A;  2P72 A;  1GWW A;  4ASJ A;  2O1G A;  2VS5 A;  3T7O A;  5EIY A;  3JTJ A;  2AES A;  4AYL A;  2AEC A;  4R7P A;  1FR8 A;  3CKQ A;  3CGX A;  2WVK A;  4FIX A;  1VGZ A;  4B3U A;  4FRB A;  1H5S B;  4FRO A;  1FG5 N;  3SPT A;  4D48 A;  5C3B A;  2CU2 A;  1I52 A;  2YC3 A;  1JYL A;  5FTS A;  1INI A;  1LZJ A;  3DUV A;  1YP3 A;  4B42 A;  5CMI A;  1W77 A;  3SXG A;  3SX7 A;  5FYE A;  1FXJ A;  5C8R A; 
#chains in the Genus database with same CATH homology
 4KPZ A;  1R81 A;  2WEE A;  1ZJ2 A;  1H5S D;  4D11 C;  5IDS A;  3RSB A;  4Y6U A;  5C1H A;  2FYA A;  3R2W A;  3BRK X;  2VS3 A;  4EEA A;  4Y9X A;  2AGD A;  1JV3 A;  3O3P A;  4IRP A;  5L6S A;  1QWJ A;  2YQC A;  2WAW A;  2AM3 A;  3E25 A;  4ASY A;  1V82 A;  5DDV A;  3RMV A;  4KPX A;  5AJN A;  4KC2 A;  4M2A A;  3PKP A;  5C1L A;  1H7E A;  2OI6 A;  1VM8 A;  1FGX A;  2JCK A;  1R80 A;  5I1F A;  2BO8 A;  1WT3 A;  1NMM B;  2W0V A;  4HO6 A;  5DDT A;  4AYJ A;  1FGG A;  1GQ9 A;  4D0T A;  3TZT A;  1JV1 A;  4HO5 A;  2RJ5 A;  1NWG B;  4GBP A;  3Q7U A;  3ST8 A;  3OH1 A;  2WGZ A;  1H5R B;  3EE5 A;  5D91 A;  1H7Q A;  1H7T A;  1FO9 A;  2V0H A;  2O1F A;  2RJ6 A;  3GUE A;  2X5Z A;  2RJ8 A;  2RJ7 A;  3USQ A;  1H7H A;  1O7Q A;  4CJB A;  2BO6 A;  2BO4 A;  2VD4 A;  2Z87 A;  3I0D A;  3V8Y A;  2ZU8 A;  4HCQ A;  1OMX A;  5C3D A;  3ZLK A;  3U0X A;  4IRQ A;  1XZ6 A;  1NKH B;  1H5S C;  3U2U A;  2PGV A;  2FYB A;  3OAM A;  4FRD A;  4MYB A;  1R82 A;  4DDZ A;  4O6M A;  3IOJ A;  4EE4 A;  3U2X A;  2JCL A;  2A8W A;  1ZCU A;  3PNN A;  4Y7G A;  1FZW A;  2ICY A;  2Q4J A;  3I0C A;  1LVW A;  2YQH A;  5IFY A;  1LL0 A;  3V0Q A;  1ON8 A;  5FU8 A;  5IDT A;  2AM4 A;  4EVW A;  2FYC B;  1ZJ0 A;  3BCV A;  2APC A;  5AJP A;  4KC1 A;  3TQD A;  1S4O A;  3U2T A;  3D8V A;  2WE9 A;  2VFZ A;  5J49 A;  3CKV A;  4Y7V A;  3FOQ A;  3OH2 A;  1R7T A;  5CMJ A;  4Y64 A;  3OH3 A;  3T7N A;  3V0P A;  5C4C A;  4C2S A;  4MND A;  5C1G A;  4M28 A;  1KWS A;  2WVL A;  1W55 A;  4FQW A;  1VH3 A;  3U2V A;  3DK5 A;  4HO9 A;  2A8U A;  4L41 C;  1TW5 A;  4LW3 A;  2QH5 A;  3R3I A;  2ZU7 A;  2OEG A;  5EJZ A;  4NAL A;  2D7I A;  1LZ0 A;  3V90 A;  2PGY A;  1S4N A;  4E1K A;  5C3A A;  3JUK A;  1FXO A;  1H4C A;  1G1L A;  2VXM A;  2WVM A;  2RJ1 A;  1QGS A;  3IOI A;  4M4K A;  1JVD A;  4G87 A;  2RJ4 A;  5CQN X;  3CKN A;  2BO7 A;  3JUJ A;  1VGT A;  3N9W A;  2YQJ A;  3I0E A;  2QKX A;  1ZJ1 A;  2V0J A;  2YES A;  4FIY A;  3I0H A;  3OH4 A;  3U0Y A;  4KC4 A;  3I0G A;  4LW6 A;  2RIX A;  3I0F A;  4HO2 A;  3I0L A;  4KNX A;  3U2W A;  1H4D A;  4FRA A;  1WVC A;  2GGQ A;  5CQP A;  1EYR A;  1G2V A;  1R7X A;  4KT7 A;  4B4M A;  5CQM X;  1SS9 A;  2X65 A;  1MC3 A;  4EEO A;  5EJ1 A;  4AC3 A;  3ZF8 A;  1ZIZ A;  1G93 A;  2Y4M A;  1WT1 A;  2E8B A;  1G0R A;  1MP4 A;  1VPA A;  4G3P A;  2V0L A;  1O23 B;  1H5T A;  5FU0 A;  4Y6N A;  5C4F A;  1E5K A;  1TVY A;  2D0J A;  2V0I A;  1G23 A;  1NHE B;  1XHB A;  4B5B A;  1R7V A;  4FRP A;  2AH9 A;  4M2B A;  1VZU A;  4NAN A;  1YRO B;  4FRE A;  1VGW A;  2MZB A;  4B2W A;  1ON6 A;  3RMW A;  1QG8 A;  4CJ8 A;  3T7M A;  1H7L A;  3FWW A;  1FO8 A;  1PZY B;  1G3L A;  3SXB A;  4D11 A;  2X5S A;  2NXV A;  5C4D A;  4FCU A;  1VGU A;  2ICX A;  2RIT A;  1ZJP A;  5C36 A;  1ZJ3 A;  1WSZ A;  4BQH A;  1PZT A;  5CQL X;  1NQI B;  2FFV A;  4FRM A;  1R7U A;  3K8E A;  5C48 A;  1VH1 A;  1LL3 A;  3SXA A;  4HO8 A;  2FY7 A;  1GWV A;  4HOC A;  5HS2 A;  2ZU9 A;  5L6V A;  1GQC A;  4B4G A;  2J0B A;  2E3D A;  2C0N A;  1INJ A;  4HO3 A;  1HM9 A;  3SX8 A;  1W57 A;  3IOH A;  4DEC A;  2VXL A;  1JYK A;  1VZT A;  3CKJ A;  2P73 A;  3QVB A;  1TW1 A;  4FRL A;  5C49 A;  1NF5 B;  1LZ7 A;  1R7Y A;  2OI7 A;  3DJ4 A;  1ZI3 A;  1HJL A;  4J18 A;  1HV9 A;  4Y62 A;  4Y63 A;  1ZI4 A;  2PA4 A;  4JIS A;  1JVG A;  2Z86 A;  1V83 A;  1HM8 A;  3ZGF A;  1VZX A;  2Y7A A;  3SXE A;  3K8D A;  4Y7F A;  1H7G A;  4Y7T A;  2I7B A;  3SXC A;  2O1H A;  1G95 A;  4FCE A;  1H5S A;  2OEF A;  1MP3 A;  2D7R A;  4FRH A;  4MIX A;  1FOA A;  5BXC A;  1OQM B;  4EE5 A;  1S4P A;  1H7F A;  5CMH A;  1TZF A;  2FYD B;  2I5E A;  4KRV A;  4CJC A;  5JQQ A;  2RIZ A;  2VS4 A;  1ZJO A;  1EZI A;  4D0Z A;  2UX8 A;  3V0O A;  3V0N A;  3ZLL A;  3LW6 A;  4P00 A;  2XME A;  1YP2 A;  2J0A A;  3HL3 A;  3NGW A;  2Y4J A;  1GX4 A;  3POL A;  1OMZ A;  1LL2 A;  2VK9 A;  1G8O A;  1V84 A;  4G3S A;  4KXO A;  3Q4S A;  2FFU A;  4AAW A;  2W0W A;  1ZI5 A;  1G9R A;  3D98 A;  3E26 A;  5D92 A;  4B4B A;  4EEG A;  4K6R A;  2Y6P A;  5CMG X;  1VIC A;  2I5K A;  2YQS A;  3CKO A;  3OH0 A;  5C38 A;  2YC5 A;  5FUH A;  2DPW A;  1H5R A;  4B2X A;  3V8Z A;  4CVH A;  2XMH A;  1ZCT A;  1MP5 A;  3ZGG A;  2JCJ A;  2OI5 A;  1FWY A;  2Y4L A;  1ZCY A;  4ARW A;  1H5T B;  2V0K A;  4NAK A;  2VSI A;  3OC9 A;  4XWI A;  3USR A;  4HG6 A;  1GX0 A;  1Z90 A;  3D5N A;  2JCO A;  4EEM A;  3OKR A;  3V91 A;  1FR9 A;  2RJ9 A;  3I0K A;  2XWN A;  4Q7C A;  1QGQ A;  1ZDF A;  4KNR A;  4NAI A;  2RIY A;  1IIN A;  3I0J A;  1H4E A;  3PKQ A;  1H3M A;  4YS8 A;  2GGO A;  1ZDG A;  2P6W A;  1O0R A;  5C47 A;  2PX7 A;  4Y7U A;  1HJJ A;  1K4V A;  1FRW A;  4HO0 A;  3SX3 A;  1LZI A;  3CU0 A;  5CQO A;  1GA8 A;  1O7O A;  2RJ0 A;  5FV9 A;  5C4E A;  3F1Y A;  1WT2 A;  1G97 A;  1YP4 A;  4G3Q A;  1IIM A;  3KIA A;  3V0L A;  1WT0 A;  3SXD A;  2AE7 A;  3OGZ A;  3SX5 A;  4ECM A;  2YCM A;  1ZHJ A;  1ZCV A;  1ZI1 A;  4O6N A;  3F1C A;  4UEG A;  5FTV A;  2Y4K A;  5AJO A;  4KQL A;  2X60 A;  3I0I X;  1HM0 A;  3V0M A;  4EE3 A;  2AM5 A;  4P02 A;  4JD0 A;  4BMA A;  4DE7 A;  3Q80 A;  2QGI A;  4FRQ A;  5CMF X;  2XWM A;  2VSH A;  4HO4 A;  2XWL A;  4ZDQ A;  5C4B A;  2P72 A;  1GWW A;  4ASJ A;  2O1G A;  2VS5 A;  3T7O A;  5EIY A;  3JTJ A;  2AES A;  4AYL A;  2AEC A;  4R7P A;  1FR8 A;  3CKQ A;  3CGX A;  2WVK A;  4FIX A;  1VGZ A;  4B3U A;  4FRB A;  1H5S B;  4FRO A;  1FG5 N;  3SPT A;  4D48 A;  5C3B A;  2CU2 A;  1I52 A;  2YC3 A;  1JYL A;  5FTS A;  1INI A;  1LZJ A;  3DUV A;  1YP3 A;  4B42 A;  5CMI A;  1W77 A;  3SXG A;  3SX7 A;  5FYE A;  1FXJ A;  5C8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...