5FTVA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
301
structure length
296
Chain Sequence
HHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric Competitive Inhibitors of the Glucose-1-Phosphate Thymidylyltransferase (Rmla) from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
total genus 100
structure length 296
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5ftvA00
1EZIA 4J18A 2DPWA 5FU8A 4G3PA 3JUKA 4LW6A 1FO8A 1FO9A 4FRHA 4BMAA 5C3BA 2WEEA 2NXVA 2RJ7A 4DECA 3SXEA 5CMFX 2ICYA 5C1GA 4CJBA 3I0JA 2VS5A 1SS9A 5DDVA 1H5RA 1NWGB 3I0KA 3PKQA 1NKHB 1S4OA 2RJ8A 2V0IA 4NALA 5IDSA 3OH4A 1GX0A 4AC3A 2X60A 4HO9A 4KRVA 3ZLLA 1H5TA 2RIXA 4B3UA 4HO5A 3Q80A 3CKJA 1NF5B 3SXDA 1PZTA 1ZCYA 1G23A 4B2XA 4FRBA 1VGZA 2GGQA 3CU0A 1FG5N 1GX4A 1ZDFA 4M28A 3U2TA 1G3LA 2RJ4A 1ON8A 4EEGA 1R81A 2PGVA 1VGWA 3OH3A 1H5SA 4EE3A 3NGWA 1H5RB 1H7GA 5DDTA 1O0RA 3F1YA 1QWJA 4HO3A 1S4PA 4FRPA 1G2VA 1O7OA 3GUEA 1H5TB 4DDZA 2BO7A 2WE9A 2WVLA 4FCEA 1VH3A 1H5SC 5C1HA 5AJOA 3FOQA 5C4DA 2YQCA 4D48A 1G8OA 4KT7A 1XHBA 4Y9XA 5CQNX 1TVYA 4HO8A 4B42A 4E1KA 1ZI4A 3SX8A 4EEAA 1H5SB 3I0EA 2OEFA 5C47A 4C2SA 4KXOA 2V0JA 5CQLX 4L41C 4Y62A 3V0LA 2APCA 5C1LA 5C4BA 3U2XA 4G87A 3I0DA 3PNNA 5I1FA 2XWNA 2BO6A 2V0HA 1FGGA 4D0ZA 2X65A 1WT3A 3BCVA 4FRQA 1VH1A 2W0WA 1LVWA 4AYLA 4HG6A 4EEOA 1YP3A 4M2BA 1VGTA 2QKXA 3Q7UA 3F1CA 4FCUA 4B5BA 3DUVA 1JV1A 1FRWA 2Y4LA 4D11A 3SPTA 3CKNA 3ZF8A 2Y7AA 4XWIA 1FR8A 3USQA 1WT2A 1TZFA 4FRLA 1ZCUA 2I5EA 2JCKA 5C4EA 2X5SA 5BXCA 1ZJ3A 1XZ6A 4D11C 2AE7A 4P02A 1YROB 3T7MA 5CMIA 5FYEA 1YP4A 5C36A 1O23B 1EYRA 5EIYA 2OEGA 4HCQA 2XMEA 2JCLA 1FR9A 2AECA 4Y6NA 4BQHA 1PZYB 1OMXA 3IOHA 4AYJA 2YCMA 1G97A 2P6WA 3I0CA 4EE5A 2P72A 2AESA 5C49A 4B2WA 1E5KA 4YS8A 4DE7A 2VXMA 4Y7TA 4Y64A 1R7TA 5FUHA 1FXOA 1ON6A 4IRQA 4EVWA 3SXBA 1O7QA 2YQHA 1ZJ2A 3IOJA 3ZLKA 2JCJA 3K8DA 3U2WA 1VZUA 2QH5A 1JVGA 4GBPA 3USRA 4AAWA 1HJLA 1QGSA 4Y63A 4ECMA 3RSBA 2P73A 4CJ8A 2YQSA 5CMHA 2VD4A 1HJJA 2CU2A 5EJ1A 1VZTA 1FWYA 1NQIB 4KNRA 3SXAA 3CKQA 3TZTA 4NANA 4B4MA 4EE4A 1GQCA 1ZJ1A 4KQLA 2QGIA 3JUJA 1HM8A 4EEMA 2A8UA 2FYBA 2PA4A 1IIMA 4FRMA 3ZGGA 3I0GA 1W57A 2FFUA 2I5KA 3OC9A 4G3QA 1ZCTA 2Z86A 2BO4A 2AGDA 4Y6UA 5HS2A 1NHEB 3SX3A 5L6SA 1GA8A 1VM8A 1G9RA 2RJ0A 5J49A 1LZ0A 1R7UA 4HO0A 3LW6A 1FXJA 4FQWA 4CVHA 4ARWA 5CMGX 3E25A 2WVKA 3BRKX 5C3AA 2AM4A 2VS4A 1JYKA 4LW3A 3V0PA 3FWWA 1Z90A 4FREA 1H7QA 2AM5A 4HO2A 2O1FA 5CMJA 1ZJOA 2AH9A 3SXCA 3DJ4A 1K4VA 4D0TA 2FYDB 3K8EA 1H7EA 3QVBA 1H5SD 1FOAA 4Y7VA 3I0HA 2Z87A 2V0KA 4UEGA 3RMWA 4B4GA 2D0JA 3O3PA 2W0VA 1TW1A 3I0IX 1R82A 5IDTA 3V0MA 5FU0A 1ZCVA 1R7XA 3U0XA 3Q4SA 4FROA 1V84A 1VICA 2MZBA 4HO6A 2ZU8A 3TQDA 3R2WA 2RJ9A 1LZ7A 1OQMB 2O1HA 4KPZA 2YC3A 1ZDGA 2WAWA 1LL0A 1W55A 5C8RA 2FYCB 2ZU7A 2ICXA 2RJ1A 5C48A 4HOCA 4FRDA 1ZI5A 2Y4KA 1TW5A 1R7YA 1GWVA 5JQQA 2VFZA 3D5NA 3PKPA 1YP2A 3V91A 1VGUA 1I52A 5L6VA 1H7FA 3V8ZA 1GQ9A 5FTSA 3V90A 4IRPA 1G1LA 2RITA 3OH0A 4KNXA 2WGZA 2E3DA 1V82A 3CGXA 5C38A 1ZI1A 2JCOA 3D8VA 3HL3A 2Q4JA 4JD0A 2OI5A 3JTJA 3T7OA 1JV3A 1ZI3A 4KC2A 2RIYA 5CQMX 4ZDQA 3KIAA 4R7PA 4Y7UA 1LL3A 1JYLA 1NMMB 1FZWA 3E26A 1H7HA 2OI7A 1OMZA 4CJCA 1R7VA 1HV9A 2VS3A 3SX5A 4MYBA 2Y4MA 3OKRA 2PX7A 4NAKA 4M4KA 3EE5A 1LZJA 1R80A 1MP4A 3U0YA 2BO8A 4P00A 2XWLA 3IOIA 1H4CA 1W77A 1G93A 2AM3A 1VPAA 1HM9A 3POLA 2D7RA 1WSZA 4ASJA 4KC1A 2PGYA 2Y6PA 2YQJA 3R3IA 3V0QA 2RJ5A 1H3MA 1WVCA 2A8WA 1S4NA 2YC5A 1MP5A 3I0FA 5CQPA 3RMVA 2FYAA 3SX7A 3ST8A 4B4BA 2FFVA 1H7TA 1ZJ0A 2VXLA 2WVMA 3OH2A 1VZXA 5C4CA 4MNDA 5C3DA 1H4EA 4HO4A 1MC3A 1V83A 1ZJPA 2XMHA 4FRAA 1INJA 1QG8A 4KC4A 2YESA 4Y7FA 1GWWA 2E8BA 5FTVA 3CKOA 1LZIA 2ZU9A 4KPXA 3U2VA 3I0LA 5EJZA 4Y7GA 1MP3A 3V8YA 5CQOA 3T7NA 2FY7A 1H4DA 2RIZA 1WT1A 5C4FA 3DK5A 3OGZA 3OH1A 4M2AA 3U2UA 3N9WA 1INIA 2O1GA 1ZHJA 2VSIA 2X5ZA 2GGOA 3D98A 1LL2A 3SXGA 2I7BA 5FV9A 1KWSA 2D7IA 1FGXA 4JISA 1ZIZA 5IFYA 1IINA 2OI6A 2RJ6A 5AJNA 4K6RA 1G95A 4ASYA 2V0LA 2UX8A 1JVDA 2VSHA 2Y4JA 3OAMA 5AJPA 1H7LA 4G3SA 1G0RA 3V0NA 1WT0A 2XWMA 3V0OA 4NAIA 1HM0A 1QGQA 3ZGFA 3CKVA
chains in the Genus database with same CATH superfamily
1EZIA 4J18A 2DPWA 5FU8A 4G3PA 3JUKA 4LW6A 1FO8A 1FO9A 4FRHA 4BMAA 5C3BA 2WEEA 2NXVA 2RJ7A 4DECA 3SXEA 5CMFX 2ICYA 5C1GA 4CJBA 3I0JA 2VS5A 1SS9A 5DDVA 1H5RA 1NWGB 3I0KA 3PKQA 1NKHB 1S4OA 2RJ8A 2V0IA 4NALA 5IDSA 3OH4A 1GX0A 4AC3A 2X60A 4HO9A 4KRVA 3ZLLA 1H5TA 2RIXA 4B3UA 4HO5A 3Q80A 3CKJA 1NF5B 3SXDA 1PZTA 1ZCYA 1G23A 4B2XA 4FRBA 1VGZA 2GGQA 3CU0A 1FG5N 1GX4A 1ZDFA 4M28A 3U2TA 1G3LA 2RJ4A 1ON8A 4EEGA 1R81A 2PGVA 1VGWA 3OH3A 1H5SA 4EE3A 3NGWA 1H5RB 1H7GA 5DDTA 1O0RA 3F1YA 1QWJA 4HO3A 1S4PA 4FRPA 1G2VA 1O7OA 3GUEA 1H5TB 4DDZA 2BO7A 2WE9A 2WVLA 4FCEA 1VH3A 1H5SC 5C1HA 5AJOA 3FOQA 5C4DA 2YQCA 4D48A 1G8OA 4KT7A 1XHBA 4Y9XA 5CQNX 1TVYA 2C0NA 4HO8A 4B42A 4E1KA 1ZI4A 3SX8A 4EEAA 1H5SB 3I0EA 2OEFA 5C47A 4C2SA 4KXOA 2V0JA 5CQLX 4L41C 4Y62A 3V0LA 2APCA 5C1LA 5C4BA 3U2XA 4G87A 3I0DA 3PNNA 5I1FA 2XWNA 2BO6A 2V0HA 1FGGA 4D0ZA 2X65A 1WT3A 3BCVA 4FRQA 1VH1A 2W0WA 1LVWA 4AYLA 4HG6A 4EEOA 1YP3A 4M2BA 1VGTA 2QKXA 3Q7UA 3F1CA 4FCUA 4B5BA 3DUVA 1JV1A 1FRWA 2Y4LA 4D11A 3SPTA 3CKNA 3ZF8A 2Y7AA 4XWIA 1FR8A 3USQA 1WT2A 1TZFA 4FRLA 1ZCUA 2I5EA 2JCKA 5C4EA 2X5SA 5BXCA 1ZJ3A 1XZ6A 4MIXA 4D11C 2AE7A 4P02A 1YROB 3T7MA 5CMIA 5FYEA 1YP4A 5C36A 1O23B 1EYRA 5EIYA 2OEGA 4HCQA 2XMEA 2JCLA 1FR9A 2AECA 4Y6NA 4BQHA 1PZYB 1OMXA 3IOHA 4AYJA 2YCMA 1G97A 2P6WA 3I0CA 4EE5A 2P72A 2AESA 5C49A 4B2WA 1E5KA 4YS8A 4DE7A 2VXMA 4Y7TA 4Y64A 1R7TA 5FUHA 1FXOA 1ON6A 4IRQA 4EVWA 3SXBA 1O7QA 2YQHA 1ZJ2A 3IOJA 3ZLKA 2JCJA 3K8DA 3U2WA 1VZUA 2QH5A 1JVGA 4GBPA 3USRA 4AAWA 1HJLA 1QGSA 4Y63A 4ECMA 3RSBA 2P73A 4CJ8A 2YQSA 5CMHA 2VD4A 1HJJA 2CU2A 5EJ1A 1VZTA 1FWYA 1NQIB 4KNRA 3SXAA 3CKQA 3TZTA 4NANA 4B4MA 4EE4A 1GQCA 1ZJ1A 4KQLA 2QGIA 3JUJA 1HM8A 4EEMA 2A8UA 2FYBA 2PA4A 1IIMA 4FRMA 3ZGGA 3I0GA 1W57A 2FFUA 2I5KA 3OC9A 4G3QA 1ZCTA 2Z86A 2BO4A 2AGDA 4Y6UA 5HS2A 1NHEB 3SX3A 5L6SA 1GA8A 1VM8A 1G9RA 2RJ0A 5J49A 1LZ0A 2J0AA 1R7UA 4HO0A 3LW6A 1FXJA 4FQWA 4CVHA 4ARWA 5CMGX 3E25A 2WVKA 3BRKX 5C3AA 2AM4A 2VS4A 1JYKA 4LW3A 3V0PA 3FWWA 4O6MA 1Z90A 4FREA 1H7QA 2AM5A 4HO2A 2O1FA 5CMJA 1ZJOA 2AH9A 3SXCA 3DJ4A 1K4VA 4D0TA 2FYDB 3K8EA 1H7EA 3QVBA 1H5SD 1FOAA 4Y7VA 3I0HA 2Z87A 2V0KA 4UEGA 3RMWA 4B4GA 2D0JA 3O3PA 2W0VA 1TW1A 3I0IX 1R82A 5IDTA 3V0MA 4O6NA 5FU0A 1ZCVA 1R7XA 3U0XA 3Q4SA 4FROA 5D92A 1V84A 1VICA 2MZBA 4HO6A 2ZU8A 3TQDA 3R2WA 2RJ9A 1LZ7A 1OQMB 2O1HA 4KPZA 2YC3A 1ZDGA 2WAWA 1LL0A 2VK9A 1W55A 5C8RA 2FYCB 2ZU7A 2ICXA 2RJ1A 5C48A 4HOCA 4FRDA 1ZI5A 2Y4KA 1TW5A 1R7YA 1GWVA 5JQQA 2VFZA 3D5NA 3PKPA 1YP2A 3V91A 1VGUA 1I52A 5L6VA 1H7FA 3V8ZA 1GQ9A 5FTSA 3V90A 4IRPA 1G1LA 2RITA 3OH0A 4KNXA 2WGZA 2E3DA 1V82A 3CGXA 5C38A 1ZI1A 2JCOA 3D8VA 3HL3A 2Q4JA 4JD0A 2OI5A 3JTJA 3T7OA 1JV3A 1ZI3A 4KC2A 2RIYA 5CQMX 4ZDQA 3KIAA 4R7PA 4Y7UA 2J0BA 1LL3A 4FIYA 1JYLA 1NMMB 1FZWA 3E26A 5D91A 1H7HA 2OI7A 1OMZA 4CJCA 1R7VA 1HV9A 2VS3A 3SX5A 4MYBA 2Y4MA 3OKRA 2PX7A 4NAKA 4M4KA 3EE5A 1LZJA 1R80A 1MP4A 3U0YA 2BO8A 4P00A 2XWLA 3IOIA 1H4CA 1W77A 1G93A 2AM3A 1VPAA 1HM9A 3POLA 2D7RA 1WSZA 4ASJA 4KC1A 2PGYA 2Y6PA 2YQJA 3R3IA 3V0QA 2RJ5A 1H3MA 1WVCA 2A8WA 1S4NA 2YC5A 1MP5A 3I0FA 5CQPA 3RMVA 2FYAA 3SX7A 3ST8A 4B4BA 2FFVA 1H7TA 1ZJ0A 2VXLA 2WVMA 3OH2A 1VZXA 5C4CA 4MNDA 5C3DA 1H4EA 4HO4A 1MC3A 1V83A 1ZJPA 2XMHA 4FRAA 1INJA 1QG8A 4KC4A 2YESA 4Y7FA 1GWWA 2E8BA 4FIXA 5FTVA 3CKOA 1LZIA 2ZU9A 4KPXA 3U2VA 3I0LA 5EJZA 4Y7GA 1MP3A 3V8YA 5CQOA 3T7NA 2FY7A 1H4DA 2RIZA 1WT1A 5C4FA 3DK5A 3OGZA 3OH1A 4M2AA 3U2UA 3N9WA 1INIA 2O1GA 1ZHJA 2VSIA 2X5ZA 2GGOA 3D98A 1LL2A 3SXGA 2I7BA 5FV9A 1KWSA 2D7IA 1FGXA 4JISA 1ZIZA 5IFYA 1IINA 2OI6A 2RJ6A 5AJNA 4K6RA 1G95A 4ASYA 2V0LA 2UX8A 1JVDA 2VSHA 2Y4JA 3OAMA 5AJPA 1H7LA 4G3SA 1G0RA 3V0NA 1WT0A 4Q7CA 2XWMA 3V0OA 4NAIA 1HM0A 1QGQA 3ZGFA 3CKVA
chains in the Genus database with same CATH topology
1EZIA 4J18A 2DPWA 5FU8A 4G3PA 3JUKA 4LW6A 1FO8A 1FO9A 4FRHA 4BMAA 5C3BA 2WEEA 2NXVA 2RJ7A 4DECA 3SXEA 5CMFX 2ICYA 5C1GA 4CJBA 3I0JA 2VS5A 1SS9A 5DDVA 1H5RA 1NWGB 3I0KA 3PKQA 1NKHB 1S4OA 2RJ8A 2V0IA 4NALA 5IDSA 3OH4A 1GX0A 4AC3A 2X60A 4HO9A 4KRVA 3ZLLA 1H5TA 2RIXA 4B3UA 4HO5A 3Q80A 3CKJA 1NF5B 3SXDA 1PZTA 1ZCYA 1G23A 4B2XA 4FRBA 1VGZA 2GGQA 3CU0A 1FG5N 1GX4A 1ZDFA 4M28A 3U2TA 1G3LA 2RJ4A 1ON8A 4EEGA 1R81A 2PGVA 1VGWA 3OH3A 1H5SA 4EE3A 3NGWA 1H5RB 1H7GA 5DDTA 1O0RA 3F1YA 1QWJA 4HO3A 1S4PA 4FRPA 1G2VA 1O7OA 3GUEA 1H5TB 4DDZA 2BO7A 2WE9A 2WVLA 4FCEA 1VH3A 1H5SC 5C1HA 5AJOA 3FOQA 5C4DA 2YQCA 4D48A 1G8OA 4KT7A 1XHBA 4Y9XA 5CQNX 1TVYA 2C0NA 4HO8A 4B42A 4E1KA 1ZI4A 3SX8A 4EEAA 1H5SB 3I0EA 2OEFA 5C47A 4C2SA 4KXOA 2V0JA 5CQLX 4L41C 4Y62A 3V0LA 2APCA 5C1LA 5C4BA 3U2XA 4G87A 3I0DA 3PNNA 5I1FA 2XWNA 2BO6A 2V0HA 1FGGA 4D0ZA 2X65A 1WT3A 3BCVA 4FRQA 1VH1A 2W0WA 1LVWA 4AYLA 4HG6A 4EEOA 1YP3A 4M2BA 1VGTA 2QKXA 3Q7UA 3F1CA 4FCUA 4B5BA 3DUVA 1JV1A 1FRWA 2Y4LA 4D11A 3SPTA 3CKNA 3ZF8A 2Y7AA 4XWIA 1FR8A 3USQA 1WT2A 1TZFA 4FRLA 1ZCUA 2I5EA 2JCKA 5C4EA 2X5SA 5BXCA 1ZJ3A 1XZ6A 4MIXA 4D11C 2AE7A 4P02A 1YROB 3T7MA 5CMIA 5FYEA 1YP4A 5C36A 1O23B 1EYRA 5EIYA 2OEGA 4HCQA 2XMEA 2JCLA 1FR9A 2AECA 4Y6NA 4BQHA 1PZYB 1OMXA 3IOHA 4AYJA 2YCMA 1G97A 2P6WA 3I0CA 4EE5A 2P72A 2AESA 5C49A 4B2WA 1E5KA 4YS8A 4DE7A 2VXMA 4Y7TA 4Y64A 1R7TA 5FUHA 1FXOA 1ON6A 4IRQA 4EVWA 3SXBA 1O7QA 2YQHA 1ZJ2A 3IOJA 3ZLKA 2JCJA 3K8DA 3U2WA 1VZUA 2QH5A 1JVGA 4GBPA 3USRA 4AAWA 1HJLA 1QGSA 4Y63A 4ECMA 3RSBA 2P73A 4CJ8A 2YQSA 5CMHA 2VD4A 1HJJA 2CU2A 5EJ1A 1VZTA 1FWYA 1NQIB 4KNRA 3SXAA 3CKQA 3TZTA 4NANA 4B4MA 4EE4A 1GQCA 1ZJ1A 4KQLA 2QGIA 3JUJA 1HM8A 4EEMA 2A8UA 2FYBA 2PA4A 1IIMA 4FRMA 3ZGGA 3I0GA 1W57A 2FFUA 2I5KA 3OC9A 4G3QA 1ZCTA 2Z86A 2BO4A 2AGDA 4Y6UA 5HS2A 1NHEB 3SX3A 5L6SA 1GA8A 1VM8A 1G9RA 2RJ0A 5J49A 1LZ0A 2J0AA 1R7UA 4HO0A 3LW6A 1FXJA 4FQWA 4CVHA 4ARWA 5CMGX 3E25A 2WVKA 3BRKX 5C3AA 2AM4A 2VS4A 1JYKA 4LW3A 3V0PA 3FWWA 4O6MA 1Z90A 4FREA 1H7QA 2AM5A 4HO2A 2O1FA 5CMJA 1ZJOA 2AH9A 3SXCA 3DJ4A 1K4VA 4D0TA 2FYDB 3K8EA 1H7EA 3QVBA 1H5SD 1FOAA 4Y7VA 3I0HA 2Z87A 2V0KA 4UEGA 3RMWA 4B4GA 2D0JA 3O3PA 2W0VA 1TW1A 3I0IX 1R82A 5IDTA 3V0MA 4O6NA 5FU0A 1ZCVA 1R7XA 3U0XA 3Q4SA 4FROA 5D92A 1V84A 1VICA 2MZBA 4HO6A 2ZU8A 3TQDA 3R2WA 2RJ9A 1LZ7A 1OQMB 2O1HA 4KPZA 2YC3A 1ZDGA 2WAWA 1LL0A 2VK9A 1W55A 5C8RA 2FYCB 2ZU7A 2ICXA 2RJ1A 5C48A 4HOCA 4FRDA 1ZI5A 2Y4KA 1TW5A 1R7YA 1GWVA 5JQQA 2VFZA 3D5NA 3PKPA 1YP2A 3V91A 1VGUA 1I52A 5L6VA 1H7FA 3V8ZA 1GQ9A 5FTSA 3V90A 4IRPA 1G1LA 2RITA 3OH0A 4KNXA 2WGZA 2E3DA 1V82A 3CGXA 5C38A 1ZI1A 2JCOA 3D8VA 3HL3A 2Q4JA 4JD0A 2OI5A 3JTJA 3T7OA 1JV3A 1ZI3A 4KC2A 2RIYA 5CQMX 4ZDQA 3KIAA 4R7PA 4Y7UA 2J0BA 1LL3A 4FIYA 1JYLA 1NMMB 1FZWA 3E26A 5D91A 1H7HA 2OI7A 1OMZA 4CJCA 1R7VA 1HV9A 2VS3A 3SX5A 4MYBA 2Y4MA 3OKRA 2PX7A 4NAKA 4M4KA 3EE5A 1LZJA 1R80A 1MP4A 3U0YA 2BO8A 4P00A 2XWLA 3IOIA 1H4CA 1W77A 1G93A 2AM3A 1VPAA 1HM9A 3POLA 2D7RA 1WSZA 4ASJA 4KC1A 2PGYA 2Y6PA 2YQJA 3R3IA 3V0QA 2RJ5A 1H3MA 1WVCA 2A8WA 1S4NA 2YC5A 1MP5A 3I0FA 5CQPA 3RMVA 2FYAA 3SX7A 3ST8A 4B4BA 2FFVA 1H7TA 1ZJ0A 2VXLA 2WVMA 3OH2A 1VZXA 5C4CA 4MNDA 5C3DA 1H4EA 4HO4A 1MC3A 1V83A 1ZJPA 2XMHA 4FRAA 1INJA 1QG8A 4KC4A 2YESA 4Y7FA 1GWWA 2E8BA 4FIXA 5FTVA 3CKOA 1LZIA 2ZU9A 4KPXA 3U2VA 3I0LA 5EJZA 4Y7GA 1MP3A 3V8YA 5CQOA 3T7NA 2FY7A 1H4DA 2RIZA 1WT1A 5C4FA 3DK5A 3OGZA 3OH1A 4M2AA 3U2UA 3N9WA 1INIA 2O1GA 1ZHJA 2VSIA 2X5ZA 2GGOA 3D98A 1LL2A 3SXGA 2I7BA 5FV9A 1KWSA 2D7IA 1FGXA 4JISA 1ZIZA 5IFYA 1IINA 2OI6A 2RJ6A 5AJNA 4K6RA 1G95A 4ASYA 2V0LA 2UX8A 1JVDA 2VSHA 2Y4JA 3OAMA 5AJPA 1H7LA 4G3SA 1G0RA 3V0NA 1WT0A 4Q7CA 2XWMA 3V0OA 4NAIA 1HM0A 1QGQA 3ZGFA 3CKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZI A;  4J18 A;  2DPW A;  5FU8 A;  4G3P A;  3JUK A;  4LW6 A;  1FO8 A;  1FO9 A;  4FRH A;  4BMA A;  5C3B A;  2WEE A;  2NXV A;  2RJ7 A;  4DEC A;  3SXE A;  5CMF X;  2ICY A;  5C1G A;  4CJB A;  3I0J A;  2VS5 A;  1SS9 A;  5DDV A;  1H5R A;  1NWG B;  3I0K A;  3PKQ A;  1NKH B;  1S4O A;  2RJ8 A;  2V0I A;  4NAL A;  5IDS A;  3OH4 A;  1GX0 A;  4AC3 A;  2X60 A;  4HO9 A;  4KRV A;  3ZLL A;  1H5T A;  2RIX A;  4B3U A;  4HO5 A;  3Q80 A;  3CKJ A;  1NF5 B;  3SXD A;  1PZT A;  1ZCY A;  1G23 A;  4B2X A;  4FRB A;  1VGZ A;  2GGQ A;  3CU0 A;  1FG5 N;  1GX4 A;  1ZDF A;  4M28 A;  3U2T A;  1G3L A;  2RJ4 A;  1ON8 A;  4EEG A;  1R81 A;  2PGV A;  1VGW A;  3OH3 A;  1H5S A;  4EE3 A;  3NGW A;  1H5R B;  1H7G A;  5DDT A;  1O0R A;  3F1Y A;  1QWJ A;  4HO3 A;  1S4P A;  4FRP A;  1G2V A;  1O7O A;  3GUE A;  1H5T B;  4DDZ A;  2BO7 A;  2WE9 A;  2WVL A;  4FCE A;  1VH3 A;  1H5S C;  5C1H A;  5AJO A;  3FOQ A;  5C4D A;  2YQC A;  4D48 A;  1G8O A;  4KT7 A;  1XHB A;  4Y9X A;  5CQN X;  1TVY A;  4HO8 A;  4B42 A;  4E1K A;  1ZI4 A;  3SX8 A;  4EEA A;  1H5S B;  3I0E A;  2OEF A;  5C47 A;  4C2S A;  4KXO A;  2V0J A;  5CQL X;  4L41 C;  4Y62 A;  3V0L A;  2APC A;  5C1L A;  5C4B A;  3U2X A;  4G87 A;  3I0D A;  3PNN A;  5I1F A;  2XWN A;  2BO6 A;  2V0H A;  1FGG A;  4D0Z A;  2X65 A;  1WT3 A;  3BCV A;  4FRQ A;  1VH1 A;  2W0W A;  1LVW A;  4AYL A;  4HG6 A;  4EEO A;  1YP3 A;  4M2B A;  1VGT A;  2QKX A;  3Q7U A;  3F1C A;  4FCU A;  4B5B A;  3DUV A;  1JV1 A;  1FRW A;  2Y4L A;  4D11 A;  3SPT A;  3CKN A;  3ZF8 A;  2Y7A A;  4XWI A;  1FR8 A;  3USQ A;  1WT2 A;  1TZF A;  4FRL A;  1ZCU A;  2I5E A;  2JCK A;  5C4E A;  2X5S A;  5BXC A;  1ZJ3 A;  1XZ6 A;  4D11 C;  2AE7 A;  4P02 A;  1YRO B;  3T7M A;  5CMI A;  5FYE A;  1YP4 A;  5C36 A;  1O23 B;  1EYR A;  5EIY A;  2OEG A;  4HCQ A;  2XME A;  2JCL A;  1FR9 A;  2AEC A;  4Y6N A;  4BQH A;  1PZY B;  1OMX A;  3IOH A;  4AYJ A;  2YCM A;  1G97 A;  2P6W A;  3I0C A;  4EE5 A;  2P72 A;  2AES A;  5C49 A;  4B2W A;  1E5K A;  4YS8 A;  4DE7 A;  2VXM A;  4Y7T A;  4Y64 A;  1R7T A;  5FUH A;  1FXO A;  1ON6 A;  4IRQ A;  4EVW A;  3SXB A;  1O7Q A;  2YQH A;  1ZJ2 A;  3IOJ A;  3ZLK A;  2JCJ A;  3K8D A;  3U2W A;  1VZU A;  2QH5 A;  1JVG A;  4GBP A;  3USR A;  4AAW A;  1HJL A;  1QGS A;  4Y63 A;  4ECM A;  3RSB A;  2P73 A;  4CJ8 A;  2YQS A;  5CMH A;  2VD4 A;  1HJJ A;  2CU2 A;  5EJ1 A;  1VZT A;  1FWY A;  1NQI B;  4KNR A;  3SXA A;  3CKQ A;  3TZT A;  4NAN A;  4B4M A;  4EE4 A;  1GQC A;  1ZJ1 A;  4KQL A;  2QGI A;  3JUJ A;  1HM8 A;  4EEM A;  2A8U A;  2FYB A;  2PA4 A;  1IIM A;  4FRM A;  3ZGG A;  3I0G A;  1W57 A;  2FFU A;  2I5K A;  3OC9 A;  4G3Q A;  1ZCT A;  2Z86 A;  2BO4 A;  2AGD A;  4Y6U A;  5HS2 A;  1NHE B;  3SX3 A;  5L6S A;  1GA8 A;  1VM8 A;  1G9R A;  2RJ0 A;  5J49 A;  1LZ0 A;  1R7U A;  4HO0 A;  3LW6 A;  1FXJ A;  4FQW A;  4CVH A;  4ARW A;  5CMG X;  3E25 A;  2WVK A;  3BRK X;  5C3A A;  2AM4 A;  2VS4 A;  1JYK A;  4LW3 A;  3V0P A;  3FWW A;  1Z90 A;  4FRE A;  1H7Q A;  2AM5 A;  4HO2 A;  2O1F A;  5CMJ A;  1ZJO A;  2AH9 A;  3SXC A;  3DJ4 A;  1K4V A;  4D0T A;  2FYD B;  3K8E A;  1H7E A;  3QVB A;  1H5S D;  1FOA A;  4Y7V A;  3I0H A;  2Z87 A;  2V0K A;  4UEG A;  3RMW A;  4B4G A;  2D0J A;  3O3P A;  2W0V A;  1TW1 A;  3I0I X;  1R82 A;  5IDT A;  3V0M A;  5FU0 A;  1ZCV A;  1R7X A;  3U0X A;  3Q4S A;  4FRO A;  1V84 A;  1VIC A;  2MZB A;  4HO6 A;  2ZU8 A;  3TQD A;  3R2W A;  2RJ9 A;  1LZ7 A;  1OQM B;  2O1H A;  4KPZ A;  2YC3 A;  1ZDG A;  2WAW A;  1LL0 A;  1W55 A;  5C8R A;  2FYC B;  2ZU7 A;  2ICX A;  2RJ1 A;  5C48 A;  4HOC A;  4FRD A;  1ZI5 A;  2Y4K A;  1TW5 A;  1R7Y A;  1GWV A;  5JQQ A;  2VFZ A;  3D5N A;  3PKP A;  1YP2 A;  3V91 A;  1VGU A;  1I52 A;  5L6V A;  1H7F A;  3V8Z A;  1GQ9 A;  5FTS A;  3V90 A;  4IRP A;  1G1L A;  2RIT A;  3OH0 A;  4KNX A;  2WGZ A;  2E3D A;  1V82 A;  3CGX A;  5C38 A;  1ZI1 A;  2JCO A;  3D8V A;  3HL3 A;  2Q4J A;  4JD0 A;  2OI5 A;  3JTJ A;  3T7O A;  1JV3 A;  1ZI3 A;  4KC2 A;  2RIY A;  5CQM X;  4ZDQ A;  3KIA A;  4R7P A;  4Y7U A;  1LL3 A;  1JYL A;  1NMM B;  1FZW A;  3E26 A;  1H7H A;  2OI7 A;  1OMZ A;  4CJC A;  1R7V A;  1HV9 A;  2VS3 A;  3SX5 A;  4MYB A;  2Y4M A;  3OKR A;  2PX7 A;  4NAK A;  4M4K A;  3EE5 A;  1LZJ A;  1R80 A;  1MP4 A;  3U0Y A;  2BO8 A;  4P00 A;  2XWL A;  3IOI A;  1H4C A;  1W77 A;  1G93 A;  2AM3 A;  1VPA A;  1HM9 A;  3POL A;  2D7R A;  1WSZ A;  4ASJ A;  4KC1 A;  2PGY A;  2Y6P A;  2YQJ A;  3R3I A;  3V0Q A;  2RJ5 A;  1H3M A;  1WVC A;  2A8W A;  1S4N A;  2YC5 A;  1MP5 A;  3I0F A;  5CQP A;  3RMV A;  2FYA A;  3SX7 A;  3ST8 A;  4B4B A;  2FFV A;  1H7T A;  1ZJ0 A;  2VXL A;  2WVM A;  3OH2 A;  1VZX A;  5C4C A;  4MND A;  5C3D A;  1H4E A;  4HO4 A;  1MC3 A;  1V83 A;  1ZJP A;  2XMH A;  4FRA A;  1INJ A;  1QG8 A;  4KC4 A;  2YES A;  4Y7F A;  1GWW A;  2E8B A;  5FTV A;  3CKO A;  1LZI A;  2ZU9 A;  4KPX A;  3U2V A;  3I0L A;  5EJZ A;  4Y7G A;  1MP3 A;  3V8Y A;  5CQO A;  3T7N A;  2FY7 A;  1H4D A;  2RIZ A;  1WT1 A;  5C4F A;  3DK5 A;  3OGZ A;  3OH1 A;  4M2A A;  3U2U A;  3N9W A;  1INI A;  2O1G A;  1ZHJ A;  2VSI A;  2X5Z A;  2GGO A;  3D98 A;  1LL2 A;  3SXG A;  2I7B A;  5FV9 A;  1KWS A;  2D7I A;  1FGX A;  4JIS A;  1ZIZ A;  5IFY A;  1IIN A;  2OI6 A;  2RJ6 A;  5AJN A;  4K6R A;  1G95 A;  4ASY A;  2V0L A;  2UX8 A;  1JVD A;  2VSH A;  2Y4J A;  3OAM A;  5AJP A;  1H7L A;  4G3S A;  1G0R A;  3V0N A;  1WT0 A;  2XWM A;  3V0O A;  4NAI A;  1HM0 A;  1QGQ A;  3ZGF A;  3CKV A; 
#chains in the Genus database with same CATH topology
 1EZI A;  4J18 A;  2DPW A;  5FU8 A;  4G3P A;  3JUK A;  4LW6 A;  1FO8 A;  1FO9 A;  4FRH A;  4BMA A;  5C3B A;  2WEE A;  2NXV A;  2RJ7 A;  4DEC A;  3SXE A;  5CMF X;  2ICY A;  5C1G A;  4CJB A;  3I0J A;  2VS5 A;  1SS9 A;  5DDV A;  1H5R A;  1NWG B;  3I0K A;  3PKQ A;  1NKH B;  1S4O A;  2RJ8 A;  2V0I A;  4NAL A;  5IDS A;  3OH4 A;  1GX0 A;  4AC3 A;  2X60 A;  4HO9 A;  4KRV A;  3ZLL A;  1H5T A;  2RIX A;  4B3U A;  4HO5 A;  3Q80 A;  3CKJ A;  1NF5 B;  3SXD A;  1PZT A;  1ZCY A;  1G23 A;  4B2X A;  4FRB A;  1VGZ A;  2GGQ A;  3CU0 A;  1FG5 N;  1GX4 A;  1ZDF A;  4M28 A;  3U2T A;  1G3L A;  2RJ4 A;  1ON8 A;  4EEG A;  1R81 A;  2PGV A;  1VGW A;  3OH3 A;  1H5S A;  4EE3 A;  3NGW A;  1H5R B;  1H7G A;  5DDT A;  1O0R A;  3F1Y A;  1QWJ A;  4HO3 A;  1S4P A;  4FRP A;  1G2V A;  1O7O A;  3GUE A;  1H5T B;  4DDZ A;  2BO7 A;  2WE9 A;  2WVL A;  4FCE A;  1VH3 A;  1H5S C;  5C1H A;  5AJO A;  3FOQ A;  5C4D A;  2YQC A;  4D48 A;  1G8O A;  4KT7 A;  1XHB A;  4Y9X A;  5CQN X;  1TVY A;  2C0N A;  4HO8 A;  4B42 A;  4E1K A;  1ZI4 A;  3SX8 A;  4EEA A;  1H5S B;  3I0E A;  2OEF A;  5C47 A;  4C2S A;  4KXO A;  2V0J A;  5CQL X;  4L41 C;  4Y62 A;  3V0L A;  2APC A;  5C1L A;  5C4B A;  3U2X A;  4G87 A;  3I0D A;  3PNN A;  5I1F A;  2XWN A;  2BO6 A;  2V0H A;  1FGG A;  4D0Z A;  2X65 A;  1WT3 A;  3BCV A;  4FRQ A;  1VH1 A;  2W0W A;  1LVW A;  4AYL A;  4HG6 A;  4EEO A;  1YP3 A;  4M2B A;  1VGT A;  2QKX A;  3Q7U A;  3F1C A;  4FCU A;  4B5B A;  3DUV A;  1JV1 A;  1FRW A;  2Y4L A;  4D11 A;  3SPT A;  3CKN A;  3ZF8 A;  2Y7A A;  4XWI A;  1FR8 A;  3USQ A;  1WT2 A;  1TZF A;  4FRL A;  1ZCU A;  2I5E A;  2JCK A;  5C4E A;  2X5S A;  5BXC A;  1ZJ3 A;  1XZ6 A;  4MIX A;  4D11 C;  2AE7 A;  4P02 A;  1YRO B;  3T7M A;  5CMI A;  5FYE A;  1YP4 A;  5C36 A;  1O23 B;  1EYR A;  5EIY A;  2OEG A;  4HCQ A;  2XME A;  2JCL A;  1FR9 A;  2AEC A;  4Y6N A;  4BQH A;  1PZY B;  1OMX A;  3IOH A;  4AYJ A;  2YCM A;  1G97 A;  2P6W A;  3I0C A;  4EE5 A;  2P72 A;  2AES A;  5C49 A;  4B2W A;  1E5K A;  4YS8 A;  4DE7 A;  2VXM A;  4Y7T A;  4Y64 A;  1R7T A;  5FUH A;  1FXO A;  1ON6 A;  4IRQ A;  4EVW A;  3SXB A;  1O7Q A;  2YQH A;  1ZJ2 A;  3IOJ A;  3ZLK A;  2JCJ A;  3K8D A;  3U2W A;  1VZU A;  2QH5 A;  1JVG A;  4GBP A;  3USR A;  4AAW A;  1HJL A;  1QGS A;  4Y63 A;  4ECM A;  3RSB A;  2P73 A;  4CJ8 A;  2YQS A;  5CMH A;  2VD4 A;  1HJJ A;  2CU2 A;  5EJ1 A;  1VZT A;  1FWY A;  1NQI B;  4KNR A;  3SXA A;  3CKQ A;  3TZT A;  4NAN A;  4B4M A;  4EE4 A;  1GQC A;  1ZJ1 A;  4KQL A;  2QGI A;  3JUJ A;  1HM8 A;  4EEM A;  2A8U A;  2FYB A;  2PA4 A;  1IIM A;  4FRM A;  3ZGG A;  3I0G A;  1W57 A;  2FFU A;  2I5K A;  3OC9 A;  4G3Q A;  1ZCT A;  2Z86 A;  2BO4 A;  2AGD A;  4Y6U A;  5HS2 A;  1NHE B;  3SX3 A;  5L6S A;  1GA8 A;  1VM8 A;  1G9R A;  2RJ0 A;  5J49 A;  1LZ0 A;  2J0A A;  1R7U A;  4HO0 A;  3LW6 A;  1FXJ A;  4FQW A;  4CVH A;  4ARW A;  5CMG X;  3E25 A;  2WVK A;  3BRK X;  5C3A A;  2AM4 A;  2VS4 A;  1JYK A;  4LW3 A;  3V0P A;  3FWW A;  4O6M A;  1Z90 A;  4FRE A;  1H7Q A;  2AM5 A;  4HO2 A;  2O1F A;  5CMJ A;  1ZJO A;  2AH9 A;  3SXC A;  3DJ4 A;  1K4V A;  4D0T A;  2FYD B;  3K8E A;  1H7E A;  3QVB A;  1H5S D;  1FOA A;  4Y7V A;  3I0H A;  2Z87 A;  2V0K A;  4UEG A;  3RMW A;  4B4G A;  2D0J A;  3O3P A;  2W0V A;  1TW1 A;  3I0I X;  1R82 A;  5IDT A;  3V0M A;  4O6N A;  5FU0 A;  1ZCV A;  1R7X A;  3U0X A;  3Q4S A;  4FRO A;  5D92 A;  1V84 A;  1VIC A;  2MZB A;  4HO6 A;  2ZU8 A;  3TQD A;  3R2W A;  2RJ9 A;  1LZ7 A;  1OQM B;  2O1H A;  4KPZ A;  2YC3 A;  1ZDG A;  2WAW A;  1LL0 A;  2VK9 A;  1W55 A;  5C8R A;  2FYC B;  2ZU7 A;  2ICX A;  2RJ1 A;  5C48 A;  4HOC A;  4FRD A;  1ZI5 A;  2Y4K A;  1TW5 A;  1R7Y A;  1GWV A;  5JQQ A;  2VFZ A;  3D5N A;  3PKP A;  1YP2 A;  3V91 A;  1VGU A;  1I52 A;  5L6V A;  1H7F A;  3V8Z A;  1GQ9 A;  5FTS A;  3V90 A;  4IRP A;  1G1L A;  2RIT A;  3OH0 A;  4KNX A;  2WGZ A;  2E3D A;  1V82 A;  3CGX A;  5C38 A;  1ZI1 A;  2JCO A;  3D8V A;  3HL3 A;  2Q4J A;  4JD0 A;  2OI5 A;  3JTJ A;  3T7O A;  1JV3 A;  1ZI3 A;  4KC2 A;  2RIY A;  5CQM X;  4ZDQ A;  3KIA A;  4R7P A;  4Y7U A;  2J0B A;  1LL3 A;  4FIY A;  1JYL A;  1NMM B;  1FZW A;  3E26 A;  5D91 A;  1H7H A;  2OI7 A;  1OMZ A;  4CJC A;  1R7V A;  1HV9 A;  2VS3 A;  3SX5 A;  4MYB A;  2Y4M A;  3OKR A;  2PX7 A;  4NAK A;  4M4K A;  3EE5 A;  1LZJ A;  1R80 A;  1MP4 A;  3U0Y A;  2BO8 A;  4P00 A;  2XWL A;  3IOI A;  1H4C A;  1W77 A;  1G93 A;  2AM3 A;  1VPA A;  1HM9 A;  3POL A;  2D7R A;  1WSZ A;  4ASJ A;  4KC1 A;  2PGY A;  2Y6P A;  2YQJ A;  3R3I A;  3V0Q A;  2RJ5 A;  1H3M A;  1WVC A;  2A8W A;  1S4N A;  2YC5 A;  1MP5 A;  3I0F A;  5CQP A;  3RMV A;  2FYA A;  3SX7 A;  3ST8 A;  4B4B A;  2FFV A;  1H7T A;  1ZJ0 A;  2VXL A;  2WVM A;  3OH2 A;  1VZX A;  5C4C A;  4MND A;  5C3D A;  1H4E A;  4HO4 A;  1MC3 A;  1V83 A;  1ZJP A;  2XMH A;  4FRA A;  1INJ A;  1QG8 A;  4KC4 A;  2YES A;  4Y7F A;  1GWW A;  2E8B A;  4FIX A;  5FTV A;  3CKO A;  1LZI A;  2ZU9 A;  4KPX A;  3U2V A;  3I0L A;  5EJZ A;  4Y7G A;  1MP3 A;  3V8Y A;  5CQO A;  3T7N A;  2FY7 A;  1H4D A;  2RIZ A;  1WT1 A;  5C4F A;  3DK5 A;  3OGZ A;  3OH1 A;  4M2A A;  3U2U A;  3N9W A;  1INI A;  2O1G A;  1ZHJ A;  2VSI A;  2X5Z A;  2GGO A;  3D98 A;  1LL2 A;  3SXG A;  2I7B A;  5FV9 A;  1KWS A;  2D7I A;  1FGX A;  4JIS A;  1ZIZ A;  5IFY A;  1IIN A;  2OI6 A;  2RJ6 A;  5AJN A;  4K6R A;  1G95 A;  4ASY A;  2V0L A;  2UX8 A;  1JVD A;  2VSH A;  2Y4J A;  3OAM A;  5AJP A;  1H7L A;  4G3S A;  1G0R A;  3V0N A;  1WT0 A;  4Q7C A;  2XWM A;  3V0O A;  4NAI A;  1HM0 A;  1QGQ A;  3ZGF A;  3CKV A; 
#chains in the Genus database with same CATH homology
 1EZI A;  4J18 A;  2DPW A;  5FU8 A;  4G3P A;  3JUK A;  4LW6 A;  1FO8 A;  1FO9 A;  4FRH A;  4BMA A;  5C3B A;  2WEE A;  2NXV A;  2RJ7 A;  4DEC A;  3SXE A;  5CMF X;  2ICY A;  5C1G A;  4CJB A;  3I0J A;  2VS5 A;  1SS9 A;  5DDV A;  1H5R A;  1NWG B;  3I0K A;  3PKQ A;  1NKH B;  1S4O A;  2RJ8 A;  2V0I A;  4NAL A;  5IDS A;  3OH4 A;  1GX0 A;  4AC3 A;  2X60 A;  4HO9 A;  4KRV A;  3ZLL A;  1H5T A;  2RIX A;  4B3U A;  4HO5 A;  3Q80 A;  3CKJ A;  1NF5 B;  3SXD A;  1PZT A;  1ZCY A;  1G23 A;  4B2X A;  4FRB A;  1VGZ A;  2GGQ A;  3CU0 A;  1FG5 N;  1GX4 A;  1ZDF A;  4M28 A;  3U2T A;  1G3L A;  2RJ4 A;  1ON8 A;  4EEG A;  1R81 A;  2PGV A;  1VGW A;  3OH3 A;  1H5S A;  4EE3 A;  3NGW A;  1H5R B;  1H7G A;  5DDT A;  1O0R A;  3F1Y A;  1QWJ A;  4HO3 A;  1S4P A;  4FRP A;  1G2V A;  1O7O A;  3GUE A;  1H5T B;  4DDZ A;  2BO7 A;  2WE9 A;  2WVL A;  4FCE A;  1VH3 A;  1H5S C;  5C1H A;  5AJO A;  3FOQ A;  5C4D A;  2YQC A;  4D48 A;  1G8O A;  4KT7 A;  1XHB A;  4Y9X A;  5CQN X;  1TVY A;  2C0N A;  4HO8 A;  4B42 A;  4E1K A;  1ZI4 A;  3SX8 A;  4EEA A;  1H5S B;  3I0E A;  2OEF A;  5C47 A;  4C2S A;  4KXO A;  2V0J A;  5CQL X;  4L41 C;  4Y62 A;  3V0L A;  2APC A;  5C1L A;  5C4B A;  3U2X A;  4G87 A;  3I0D A;  3PNN A;  5I1F A;  2XWN A;  2BO6 A;  2V0H A;  1FGG A;  4D0Z A;  2X65 A;  1WT3 A;  3BCV A;  4FRQ A;  1VH1 A;  2W0W A;  1LVW A;  4AYL A;  4HG6 A;  4EEO A;  1YP3 A;  4M2B A;  1VGT A;  2QKX A;  3Q7U A;  3F1C A;  4FCU A;  4B5B A;  3DUV A;  1JV1 A;  1FRW A;  2Y4L A;  4D11 A;  3SPT A;  3CKN A;  3ZF8 A;  2Y7A A;  4XWI A;  1FR8 A;  3USQ A;  1WT2 A;  1TZF A;  4FRL A;  1ZCU A;  2I5E A;  2JCK A;  5C4E A;  2X5S A;  5BXC A;  1ZJ3 A;  1XZ6 A;  4MIX A;  4D11 C;  2AE7 A;  4P02 A;  1YRO B;  3T7M A;  5CMI A;  5FYE A;  1YP4 A;  5C36 A;  1O23 B;  1EYR A;  5EIY A;  2OEG A;  4HCQ A;  2XME A;  2JCL A;  1FR9 A;  2AEC A;  4Y6N A;  4BQH A;  1PZY B;  1OMX A;  3IOH A;  4AYJ A;  2YCM A;  1G97 A;  2P6W A;  3I0C A;  4EE5 A;  2P72 A;  2AES A;  5C49 A;  4B2W A;  1E5K A;  4YS8 A;  4DE7 A;  2VXM A;  4Y7T A;  4Y64 A;  1R7T A;  5FUH A;  1FXO A;  1ON6 A;  4IRQ A;  4EVW A;  3SXB A;  1O7Q A;  2YQH A;  1ZJ2 A;  3IOJ A;  3ZLK A;  2JCJ A;  3K8D A;  3U2W A;  1VZU A;  2QH5 A;  1JVG A;  4GBP A;  3USR A;  4AAW A;  1HJL A;  1QGS A;  4Y63 A;  4ECM A;  3RSB A;  2P73 A;  4CJ8 A;  2YQS A;  5CMH A;  2VD4 A;  1HJJ A;  2CU2 A;  5EJ1 A;  1VZT A;  1FWY A;  1NQI B;  4KNR A;  3SXA A;  3CKQ A;  3TZT A;  4NAN A;  4B4M A;  4EE4 A;  1GQC A;  1ZJ1 A;  4KQL A;  2QGI A;  3JUJ A;  1HM8 A;  4EEM A;  2A8U A;  2FYB A;  2PA4 A;  1IIM A;  4FRM A;  3ZGG A;  3I0G A;  1W57 A;  2FFU A;  2I5K A;  3OC9 A;  4G3Q A;  1ZCT A;  2Z86 A;  2BO4 A;  2AGD A;  4Y6U A;  5HS2 A;  1NHE B;  3SX3 A;  5L6S A;  1GA8 A;  1VM8 A;  1G9R A;  2RJ0 A;  5J49 A;  1LZ0 A;  2J0A A;  1R7U A;  4HO0 A;  3LW6 A;  1FXJ A;  4FQW A;  4CVH A;  4ARW A;  5CMG X;  3E25 A;  2WVK A;  3BRK X;  5C3A A;  2AM4 A;  2VS4 A;  1JYK A;  4LW3 A;  3V0P A;  3FWW A;  4O6M A;  1Z90 A;  4FRE A;  1H7Q A;  2AM5 A;  4HO2 A;  2O1F A;  5CMJ A;  1ZJO A;  2AH9 A;  3SXC A;  3DJ4 A;  1K4V A;  4D0T A;  2FYD B;  3K8E A;  1H7E A;  3QVB A;  1H5S D;  1FOA A;  4Y7V A;  3I0H A;  2Z87 A;  2V0K A;  4UEG A;  3RMW A;  4B4G A;  2D0J A;  3O3P A;  2W0V A;  1TW1 A;  3I0I X;  1R82 A;  5IDT A;  3V0M A;  4O6N A;  5FU0 A;  1ZCV A;  1R7X A;  3U0X A;  3Q4S A;  4FRO A;  5D92 A;  1V84 A;  1VIC A;  2MZB A;  4HO6 A;  2ZU8 A;  3TQD A;  3R2W A;  2RJ9 A;  1LZ7 A;  1OQM B;  2O1H A;  4KPZ A;  2YC3 A;  1ZDG A;  2WAW A;  1LL0 A;  2VK9 A;  1W55 A;  5C8R A;  2FYC B;  2ZU7 A;  2ICX A;  2RJ1 A;  5C48 A;  4HOC A;  4FRD A;  1ZI5 A;  2Y4K A;  1TW5 A;  1R7Y A;  1GWV A;  5JQQ A;  2VFZ A;  3D5N A;  3PKP A;  1YP2 A;  3V91 A;  1VGU A;  1I52 A;  5L6V A;  1H7F A;  3V8Z A;  1GQ9 A;  5FTS A;  3V90 A;  4IRP A;  1G1L A;  2RIT A;  3OH0 A;  4KNX A;  2WGZ A;  2E3D A;  1V82 A;  3CGX A;  5C38 A;  1ZI1 A;  2JCO A;  3D8V A;  3HL3 A;  2Q4J A;  4JD0 A;  2OI5 A;  3JTJ A;  3T7O A;  1JV3 A;  1ZI3 A;  4KC2 A;  2RIY A;  5CQM X;  4ZDQ A;  3KIA A;  4R7P A;  4Y7U A;  2J0B A;  1LL3 A;  4FIY A;  1JYL A;  1NMM B;  1FZW A;  3E26 A;  5D91 A;  1H7H A;  2OI7 A;  1OMZ A;  4CJC A;  1R7V A;  1HV9 A;  2VS3 A;  3SX5 A;  4MYB A;  2Y4M A;  3OKR A;  2PX7 A;  4NAK A;  4M4K A;  3EE5 A;  1LZJ A;  1R80 A;  1MP4 A;  3U0Y A;  2BO8 A;  4P00 A;  2XWL A;  3IOI A;  1H4C A;  1W77 A;  1G93 A;  2AM3 A;  1VPA A;  1HM9 A;  3POL A;  2D7R A;  1WSZ A;  4ASJ A;  4KC1 A;  2PGY A;  2Y6P A;  2YQJ A;  3R3I A;  3V0Q A;  2RJ5 A;  1H3M A;  1WVC A;  2A8W A;  1S4N A;  2YC5 A;  1MP5 A;  3I0F A;  5CQP A;  3RMV A;  2FYA A;  3SX7 A;  3ST8 A;  4B4B A;  2FFV A;  1H7T A;  1ZJ0 A;  2VXL A;  2WVM A;  3OH2 A;  1VZX A;  5C4C A;  4MND A;  5C3D A;  1H4E A;  4HO4 A;  1MC3 A;  1V83 A;  1ZJP A;  2XMH A;  4FRA A;  1INJ A;  1QG8 A;  4KC4 A;  2YES A;  4Y7F A;  1GWW A;  2E8B A;  4FIX A;  5FTV A;  3CKO A;  1LZI A;  2ZU9 A;  4KPX A;  3U2V A;  3I0L A;  5EJZ A;  4Y7G A;  1MP3 A;  3V8Y A;  5CQO A;  3T7N A;  2FY7 A;  1H4D A;  2RIZ A;  1WT1 A;  5C4F A;  3DK5 A;  3OGZ A;  3OH1 A;  4M2A A;  3U2U A;  3N9W A;  1INI A;  2O1G A;  1ZHJ A;  2VSI A;  2X5Z A;  2GGO A;  3D98 A;  1LL2 A;  3SXG A;  2I7B A;  5FV9 A;  1KWS A;  2D7I A;  1FGX A;  4JIS A;  1ZIZ A;  5IFY A;  1IIN A;  2OI6 A;  2RJ6 A;  5AJN A;  4K6R A;  1G95 A;  4ASY A;  2V0L A;  2UX8 A;  1JVD A;  2VSH A;  2Y4J A;  3OAM A;  5AJP A;  1H7L A;  4G3S A;  1G0R A;  3V0N A;  1WT0 A;  4Q7C A;  2XWM A;  3V0O A;  4NAI A;  1HM0 A;  1QGQ A;  3ZGF A;  3CKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...