5C48A

Crystal structure of gtb + udp-c-gal + di
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
282
Chain Sequence
GEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 282
sequence length 287
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c48A00
2Y7AA 2AESA 4P02A 2BO7A 3I0LA 4EEAA 1WT0A 4AYJA 1JV1A 4Y6NA 5C47A 3IOIA 2V0JA 5FV9A 4Y7UA 4FRMA 3POLA 4IRPA 1H5SC 4FRAA 1HM9A 1VGWA 3I0KA 4ASYA 5C36A 5CMJA 1QGSA 1VZUA 4KRVA 4EEGA 1FO8A 4G3QA 1H7FA 1ZCUA 1G23A 4R7PA 4Y63A 2JCOA 3SX8A 1FG5N 2VSHA 1GWWA 1SS9A 4Y7FA 4LW3A 2QGIA 4B4GA 2VS4A 1ZCYA 3FOQA 3OH2A 1H7QA 1VH1A 3U2XA 2Z86A 4JISA 2WEEA 2X60A 5C1LA 4CVHA 3PKPA 2YC3A 4DECA 4IRQA 2VS3A 4L41C 3SXEA 1FXOA 1GA8A 3ZLLA 1FGGA 1OMXA 2JCLA 1FOAA 4FRLA 5CQMX 4D11A 4FREA 2AE7A 4FCUA 2A8UA 4HO9A 2Y4JA 2PA4A 2Y6PA 1ZIZA 2E8BA 3OH3A 3V0OA 3OH4A 1R81A 2W0WA 3OH1A 1R80A 3ZF8A 5JQQA 1HJLA 3ZLKA 3CGXA 4KQLA 4Y7TA 3V90A 5L6VA 4ECMA 3DUVA 4DDZA 2PGYA 5FTSA 2FY7A 3Q80A 1WT3A 4FRPA 1YP3A 1LL2A 3I0JA 4B5BA 4HO3A 5I1FA 1W55A 3OAMA 4B3UA 2X5SA 3FWWA 3T7NA 4D48A 4KC4A 1ZJ0A 1LZIA 1H7LA 1GQCA 2WVMA 3PKQA 4KNRA 2WVLA 4KC1A 1H4EA 3E26A 1XZ6A 2ZU8A 2E3DA 5AJPA 1E5KA 2V0HA 1INJA 1R7TA 1S4NA 4FRQA 3D5NA 1H5SB 3SPTA 1Z90A 3LW6A 3HL3A 3V0LA 2FYAA 1QG8A 4M4KA 4B42A 4M2BA 2AGDA 1H7GA 2QH5A 2ZU7A 4MNDA 3RMVA 1MP3A 4B2XA 3CKVA 1NMMB 5FYEA 3SXDA 1ZCTA 3D98A 4Y7VA 4EVWA 4FQWA 1ZJ1A 4E1KA 1K4VA 5IFYA 1ON6A 1H5SA 1LZJA 3PNNA 4EE3A 2OI7A 1I52A 2Q4JA 4BMAA 2RJ6A 2OEFA 2WE9A 3TZTA 4HO0A 1WT1A 2YQCA 4KT7A 5CMHA 5CQOA 4EE4A 2RJ7A 3V8YA 1H5SD 3RSBA 1QGQA 3IOJA 2XWLA 4EE5A 3DJ4A 1YP4A 3I0CA 1VGTA 3SXAA 2XWNA 1PZTA 1JVDA 5C4CA 1HM8A 1FR8A 1VZTA 2RJ4A 2P72A 1LL3A 1FR9A 3BCVA 1MC3A 3I0GA 1ZJOA 4GBPA 1XHBA 1H5TB 3T7MA 2V0LA 2Y4LA 2Y4MA 3KIAA 1GQ9A 5C4FA 4AC3A 4G3SA 4AAWA 1ZDGA 1GWVA 1ZI4A 2V0KA 1FRWA 2BO6A 2FFVA 4M2AA 4HO4A 1H4DA 1QWJA 2Y4KA 2XMHA 3DK5A 3U2VA 4NAIA 2UX8A 1FXJA 4HG6A 3R3IA 5CMGX 4CJBA 3NGWA 2JCKA 1VM8A 2VXLA 4Y6UA 4KXOA 1ZI1A 1LVWA 2YC5A 3I0IX 4HCQA 5AJOA 3E25A 1HJJA 2GGQA 2FYBA 1KWSA 5C4BA 2RJ1A 2RIYA 1LL0A 1H7HA 1H5TA 3BRKX 4HO8A 4NANA 3I0DA 3V0QA 3IOHA 5C48A 2VSIA 2YQSA 3SXCA 1JYKA 1OMZA 1G93A 4NAKA 1R7VA 4FCEA 1W77A 4EEOA 5C1HA 3QVBA 1OQMB 1ON8A 1W57A 2VD4A 3O3PA 1PZYB 1G2VA 1HM0A 4UEGA 4BQHA 3ST8A 1R7UA 2YCMA 3U2UA 4XWIA 3EE5A 1VZXA 2ICYA 3F1CA 5C8RA 5CQPA 5BXCA 2W0VA 1ZI5A 4B4MA 3U0XA 2I7BA 1IINA 1ZJ2A 1LZ7A 2PGVA 4Y64A 1NF5B 4CJ8A 1ZDFA 3U2WA 5C3DA 4FRHA 1GX4A 1G0RA 4HO2A 3D8VA 2CU2A 1MP4A 1VH3A 2YQHA 2WGZA 2ICXA 3I0FA 1FGXA 2D0JA 3I0EA 3V91A 5C4DA 2AM4A 1JV3A 3K8EA 5CQLX 3K8DA 4HO5A 2X65A 1G3LA 1G97A 5C4EA 5IDTA 2RJ9A 4C2SA 1MP5A 2D7RA 4FRDA 2YQJA 3USQA 4JD0A 4FROA 5AJNA 2VXMA 3F1YA 1NWGB 2O1FA 2RITA 2XWMA 1V84A 1HV9A 4HOCA 5EJ1A 5FU0A 4EEMA 3USRA 1H7TA 1ZJPA 3R2WA 3JUKA 1NHEB 1INIA 5FU8A 1EYRA 1G9RA 3SX5A 5J49A 5CMFX 2V0IA 2WVKA 1G95A 1ZI3A 2A8WA 2VFZA 4ASJA 1YP2A 5L6SA 4LW6A 2QKXA 1H7EA 2PX7A 1JVGA 1YROB 2AM3A 4G87A 4B2WA 3CKQA 2GGOA 1R82A 1H5RB 2VS5A 2O1GA 2BO8A 3SXGA 4FRBA 5EIYA 3Q4SA 3V8ZA 1VGUA 3SX7A 3CU0A 5FUHA 1S4OA 5C3AA 1FO9A 4HO6A 4M28A 1LZ0A 1ZHJA 1VICA 5C49A 4D0TA 4KPZA 4ARWA 2AECA 3CKOA 5C3BA 1VGZA 4D11C 1G8OA 1G1LA 3N9WA 1V83A 4NALA 2X5ZA 2D7IA 3OC9A 2JCJA 3RMWA 2NXVA 2OI5A 1WVCA 4Y9XA 2AM5A 4B4BA 5C38A 1O23B 5CMIA 5DDVA 2RJ5A 4DE7A 1H5RA 4Y7GA 1NKHB 2FYCB 3SXBA 5EJZA 3U0YA 3U2TA 1IIMA 4K6RA 1NQIB 2RIXA 1H4CA 1H3MA 1TVYA 3I0HA 1WT2A 3OGZA 2YESA 2XMEA 3CKNA 2OEGA 2AH9A 1TW5A 1VPAA 5CQNX 1O7QA 4YS8A 2P73A 3V0PA 3ZGFA 2FYDB 3OH0A 5C1GA 3ZGGA 3T7OA 3OKRA 1ZJ3A 3GUEA 3JTJA 1EZIA 1FWYA 2Z87A 4D0ZA 2I5EA 1S4PA 1ZCVA 4KC2A 1GX0A 1TW1A 2I5KA 2MZBA 2ZU9A 4MYBA 2DPWA 4CJCA 1WSZA 3JUJA 3V0NA 3TQDA 2RJ0A 2O1HA 2OI6A 1R7XA 2FFUA 4KPXA 5IDSA 2APCA 4AYLA 4Y62A 1V82A 3V0MA 1O7OA 2BO4A 2RIZA 2RJ8A 1FZWA 1JYLA 4G3PA 3SX3A 4J18A 3CKJA 4ZDQA 2WAWA 5FTVA 4KNXA 4P00A 5DDTA 5HS2A 1R7YA 3Q7UA 1O0RA 2P6WA 1TZFA
chains in the Genus database with same CATH superfamily
2Y7AA 2AESA 4P02A 2BO7A 3I0LA 4EEAA 1WT0A 4AYJA 1JV1A 4Y6NA 5C47A 3IOIA 2V0JA 5FV9A 4Y7UA 4FRMA 3POLA 4IRPA 1H5SC 4FRAA 1HM9A 1VGWA 3I0KA 4ASYA 5C36A 5CMJA 1QGSA 1VZUA 4KRVA 4EEGA 1FO8A 4G3QA 1H7FA 1ZCUA 1G23A 4R7PA 4Y63A 2JCOA 3SX8A 1FG5N 2VSHA 1GWWA 1SS9A 4Y7FA 4LW3A 2QGIA 4B4GA 2VS4A 1ZCYA 3FOQA 3OH2A 1H7QA 1VH1A 3U2XA 2Z86A 4JISA 2WEEA 2X60A 5C1LA 4CVHA 3PKPA 2YC3A 4DECA 4IRQA 2VS3A 4L41C 3SXEA 1FXOA 1GA8A 3ZLLA 1FGGA 1OMXA 2JCLA 1FOAA 4FRLA 5CQMX 4D11A 4FREA 2AE7A 4FCUA 2A8UA 4HO9A 2Y4JA 2PA4A 2Y6PA 1ZIZA 2E8BA 3OH3A 3V0OA 3OH4A 1R81A 2W0WA 3OH1A 1R80A 3ZF8A 5JQQA 1HJLA 3ZLKA 3CGXA 4KQLA 4Y7TA 3V90A 5L6VA 4ECMA 3DUVA 4DDZA 2PGYA 5FTSA 2FY7A 3Q80A 1WT3A 4FRPA 1YP3A 1LL2A 3I0JA 4B5BA 4HO3A 5I1FA 1W55A 3OAMA 4B3UA 2X5SA 3FWWA 3T7NA 4D48A 4KC4A 1ZJ0A 1LZIA 1H7LA 1GQCA 2WVMA 3PKQA 4KNRA 2WVLA 4KC1A 1H4EA 3E26A 1XZ6A 2ZU8A 2E3DA 5AJPA 1E5KA 2V0HA 1INJA 1R7TA 1S4NA 4FRQA 3D5NA 1H5SB 3SPTA 1Z90A 3LW6A 3HL3A 3V0LA 2FYAA 1QG8A 4M4KA 4B42A 4M2BA 2AGDA 1H7GA 2QH5A 2ZU7A 4MNDA 3RMVA 1MP3A 4B2XA 3CKVA 1NMMB 5FYEA 3SXDA 1ZCTA 3D98A 4Y7VA 4EVWA 4FQWA 1ZJ1A 4E1KA 1K4VA 5IFYA 1ON6A 1H5SA 1LZJA 3PNNA 4EE3A 2OI7A 1I52A 2Q4JA 4BMAA 2RJ6A 2OEFA 2WE9A 3TZTA 4HO0A 1WT1A 2YQCA 4KT7A 5CMHA 5CQOA 5D91A 4EE4A 2RJ7A 3V8YA 1H5SD 3RSBA 1QGQA 3IOJA 2XWLA 4EE5A 3DJ4A 1YP4A 3I0CA 1VGTA 4MIXA 4O6NA 3SXAA 2XWNA 1PZTA 1JVDA 5C4CA 1HM8A 1FR8A 1VZTA 2RJ4A 2P72A 1LL3A 1FR9A 3BCVA 1MC3A 3I0GA 1ZJOA 4GBPA 1XHBA 1H5TB 3T7MA 2V0LA 2Y4LA 2Y4MA 3KIAA 1GQ9A 5C4FA 4AC3A 4G3SA 4AAWA 1ZDGA 1GWVA 1ZI4A 2V0KA 1FRWA 2BO6A 2FFVA 4M2AA 4HO4A 1H4DA 1QWJA 2Y4KA 2XMHA 3DK5A 3U2VA 4NAIA 2UX8A 1FXJA 4HG6A 3R3IA 5CMGX 2J0BA 4CJBA 3NGWA 2JCKA 1VM8A 2VXLA 4Y6UA 4KXOA 1ZI1A 1LVWA 2YC5A 3I0IX 4HCQA 5AJOA 3E25A 1HJJA 2GGQA 2FYBA 1KWSA 5C4BA 2RJ1A 2RIYA 1LL0A 1H7HA 1H5TA 3BRKX 4HO8A 4NANA 3I0DA 3V0QA 3IOHA 5C48A 2VSIA 2YQSA 3SXCA 1JYKA 1OMZA 1G93A 4NAKA 1R7VA 4FCEA 1W77A 4EEOA 5C1HA 3QVBA 1OQMB 1ON8A 1W57A 2VD4A 3O3PA 1PZYB 1G2VA 1HM0A 4UEGA 4BQHA 3ST8A 1R7UA 2YCMA 3U2UA 4XWIA 2VK9A 1VZXA 3EE5A 2ICYA 3F1CA 5C8RA 5CQPA 5BXCA 2W0VA 1ZI5A 4B4MA 3U0XA 2I7BA 1IINA 1ZJ2A 1LZ7A 2PGVA 4Y64A 1NF5B 4CJ8A 1ZDFA 3U2WA 5C3DA 4FRHA 1GX4A 1G0RA 4HO2A 3D8VA 2CU2A 1MP4A 1VH3A 2YQHA 2WGZA 2ICXA 3I0FA 1FGXA 2D0JA 3I0EA 3V91A 5C4DA 2AM4A 1JV3A 3K8EA 5CQLX 3K8DA 4HO5A 2X65A 1G3LA 1G97A 5C4EA 5IDTA 2RJ9A 4C2SA 1MP5A 2D7RA 4FRDA 2YQJA 3USQA 4JD0A 4FROA 5AJNA 2VXMA 3F1YA 1NWGB 2O1FA 2RITA 2XWMA 1V84A 1HV9A 4HOCA 5EJ1A 5FU0A 4EEMA 3USRA 1H7TA 1ZJPA 3R2WA 3JUKA 1NHEB 1INIA 5FU8A 1EYRA 1G9RA 3SX5A 5J49A 5CMFX 2V0IA 2WVKA 1G95A 1ZI3A 2C0NA 2A8WA 2VFZA 4ASJA 1YP2A 5L6SA 4LW6A 2QKXA 1H7EA 2PX7A 1JVGA 1YROB 2AM3A 4G87A 4B2WA 3CKQA 2GGOA 1R82A 1H5RB 2VS5A 2O1GA 2BO8A 3SXGA 4FIXA 4FRBA 5EIYA 3Q4SA 3V8ZA 1VGUA 3SX7A 3CU0A 5FUHA 1S4OA 5C3AA 1FO9A 4HO6A 4M28A 1LZ0A 1ZHJA 1VICA 5C49A 4D0TA 4KPZA 4ARWA 2AECA 2J0AA 3CKOA 5C3BA 1VGZA 4D11C 1G8OA 1G1LA 5D92A 3N9WA 1V83A 4NALA 2X5ZA 2D7IA 3OC9A 2JCJA 3RMWA 2NXVA 2OI5A 1WVCA 4Y9XA 2AM5A 4B4BA 5C38A 1O23B 5CMIA 5DDVA 2RJ5A 4DE7A 1H5RA 4Y7GA 1NKHB 2FYCB 3SXBA 5EJZA 3U0YA 3U2TA 1IIMA 4K6RA 1NQIB 2RIXA 1H4CA 1H3MA 1TVYA 3I0HA 1WT2A 3OGZA 2YESA 2XMEA 3CKNA 2OEGA 2AH9A 1TW5A 1VPAA 5CQNX 4FIYA 1O7QA 4YS8A 2P73A 3V0PA 3ZGFA 2FYDB 3OH0A 4Q7CA 5C1GA 3ZGGA 3T7OA 3OKRA 1ZJ3A 3GUEA 3JTJA 1EZIA 1FWYA 2Z87A 4D0ZA 2I5EA 1S4PA 4O6MA 1ZCVA 4KC2A 1GX0A 1TW1A 2I5KA 2MZBA 2ZU9A 4MYBA 2DPWA 4CJCA 1WSZA 3JUJA 3V0NA 3TQDA 2RJ0A 2O1HA 2OI6A 1R7XA 2FFUA 4KPXA 5IDSA 2APCA 4AYLA 4Y62A 1V82A 3V0MA 1O7OA 2BO4A 2RIZA 2RJ8A 1FZWA 1JYLA 4G3PA 3SX3A 4J18A 3CKJA 4ZDQA 2WAWA 5FTVA 4KNXA 4P00A 5DDTA 5HS2A 1R7YA 3Q7UA 1O0RA 2P6WA 1TZFA
chains in the Genus database with same CATH topology
2Y7AA 2AESA 4P02A 2BO7A 3I0LA 4EEAA 1WT0A 4AYJA 1JV1A 4Y6NA 5C47A 3IOIA 2V0JA 5FV9A 4Y7UA 4FRMA 3POLA 4IRPA 1H5SC 4FRAA 1HM9A 1VGWA 3I0KA 4ASYA 5C36A 5CMJA 1QGSA 1VZUA 4KRVA 4EEGA 1FO8A 4G3QA 1H7FA 1ZCUA 1G23A 4R7PA 4Y63A 2JCOA 3SX8A 1FG5N 2VSHA 1GWWA 1SS9A 4Y7FA 4LW3A 2QGIA 4B4GA 2VS4A 1ZCYA 3FOQA 3OH2A 1H7QA 1VH1A 3U2XA 2Z86A 4JISA 2WEEA 2X60A 5C1LA 4CVHA 3PKPA 2YC3A 4DECA 4IRQA 2VS3A 4L41C 3SXEA 1FXOA 1GA8A 3ZLLA 1FGGA 1OMXA 2JCLA 1FOAA 4FRLA 5CQMX 4D11A 4FREA 2AE7A 4FCUA 2A8UA 4HO9A 2Y4JA 2PA4A 2Y6PA 1ZIZA 2E8BA 3OH3A 3V0OA 3OH4A 1R81A 2W0WA 3OH1A 1R80A 3ZF8A 5JQQA 1HJLA 3ZLKA 3CGXA 4KQLA 4Y7TA 3V90A 5L6VA 4ECMA 3DUVA 4DDZA 2PGYA 5FTSA 2FY7A 3Q80A 1WT3A 4FRPA 1YP3A 1LL2A 3I0JA 4B5BA 4HO3A 5I1FA 1W55A 3OAMA 4B3UA 2X5SA 3FWWA 3T7NA 4D48A 4KC4A 1ZJ0A 1LZIA 1H7LA 1GQCA 2WVMA 3PKQA 4KNRA 2WVLA 4KC1A 1H4EA 3E26A 1XZ6A 2ZU8A 2E3DA 5AJPA 1E5KA 2V0HA 1INJA 1R7TA 1S4NA 4FRQA 3D5NA 1H5SB 3SPTA 1Z90A 3LW6A 3HL3A 3V0LA 2FYAA 1QG8A 4M4KA 4B42A 4M2BA 2AGDA 1H7GA 2QH5A 2ZU7A 4MNDA 3RMVA 1MP3A 4B2XA 3CKVA 1NMMB 5FYEA 3SXDA 1ZCTA 3D98A 4Y7VA 4EVWA 4FQWA 1ZJ1A 4E1KA 1K4VA 5IFYA 1ON6A 1H5SA 1LZJA 3PNNA 4EE3A 2OI7A 1I52A 2Q4JA 4BMAA 2RJ6A 2OEFA 2WE9A 3TZTA 4HO0A 1WT1A 2YQCA 4KT7A 5CMHA 5CQOA 5D91A 4EE4A 2RJ7A 3V8YA 1H5SD 3RSBA 1QGQA 3IOJA 2XWLA 4EE5A 3DJ4A 1YP4A 3I0CA 1VGTA 4MIXA 4O6NA 3SXAA 2XWNA 1PZTA 1JVDA 5C4CA 1HM8A 1FR8A 1VZTA 2RJ4A 2P72A 1LL3A 1FR9A 3BCVA 1MC3A 3I0GA 1ZJOA 4GBPA 1XHBA 1H5TB 3T7MA 2V0LA 2Y4LA 2Y4MA 3KIAA 1GQ9A 5C4FA 4AC3A 4G3SA 4AAWA 1ZDGA 1GWVA 1ZI4A 2V0KA 1FRWA 2BO6A 2FFVA 4M2AA 4HO4A 1H4DA 1QWJA 2Y4KA 2XMHA 3DK5A 3U2VA 4NAIA 2UX8A 1FXJA 4HG6A 3R3IA 5CMGX 2J0BA 4CJBA 3NGWA 2JCKA 1VM8A 2VXLA 4Y6UA 4KXOA 1ZI1A 1LVWA 2YC5A 3I0IX 4HCQA 5AJOA 3E25A 1HJJA 2GGQA 2FYBA 1KWSA 5C4BA 2RJ1A 2RIYA 1LL0A 1H7HA 1H5TA 3BRKX 4HO8A 4NANA 3I0DA 3V0QA 3IOHA 5C48A 2VSIA 2YQSA 3SXCA 1JYKA 1OMZA 1G93A 4NAKA 1R7VA 4FCEA 1W77A 4EEOA 5C1HA 3QVBA 1OQMB 1ON8A 1W57A 2VD4A 3O3PA 1PZYB 1G2VA 1HM0A 4UEGA 4BQHA 3ST8A 1R7UA 2YCMA 3U2UA 4XWIA 2VK9A 1VZXA 3EE5A 2ICYA 3F1CA 5C8RA 5CQPA 5BXCA 2W0VA 1ZI5A 4B4MA 3U0XA 2I7BA 1IINA 1ZJ2A 1LZ7A 2PGVA 4Y64A 1NF5B 4CJ8A 1ZDFA 3U2WA 5C3DA 4FRHA 1GX4A 1G0RA 4HO2A 3D8VA 2CU2A 1MP4A 1VH3A 2YQHA 2WGZA 2ICXA 3I0FA 1FGXA 2D0JA 3I0EA 3V91A 5C4DA 2AM4A 1JV3A 3K8EA 5CQLX 3K8DA 4HO5A 2X65A 1G3LA 1G97A 5C4EA 5IDTA 2RJ9A 4C2SA 1MP5A 2D7RA 4FRDA 2YQJA 3USQA 4JD0A 4FROA 5AJNA 2VXMA 3F1YA 1NWGB 2O1FA 2RITA 2XWMA 1V84A 1HV9A 4HOCA 5EJ1A 5FU0A 4EEMA 3USRA 1H7TA 1ZJPA 3R2WA 3JUKA 1NHEB 1INIA 5FU8A 1EYRA 1G9RA 3SX5A 5J49A 5CMFX 2V0IA 2WVKA 1G95A 1ZI3A 2C0NA 2A8WA 2VFZA 4ASJA 1YP2A 5L6SA 4LW6A 2QKXA 1H7EA 2PX7A 1JVGA 1YROB 2AM3A 4G87A 4B2WA 3CKQA 2GGOA 1R82A 1H5RB 2VS5A 2O1GA 2BO8A 3SXGA 4FIXA 4FRBA 5EIYA 3Q4SA 3V8ZA 1VGUA 3SX7A 3CU0A 5FUHA 1S4OA 5C3AA 1FO9A 4HO6A 4M28A 1LZ0A 1ZHJA 1VICA 5C49A 4D0TA 4KPZA 4ARWA 2AECA 2J0AA 3CKOA 5C3BA 1VGZA 4D11C 1G8OA 1G1LA 5D92A 3N9WA 1V83A 4NALA 2X5ZA 2D7IA 3OC9A 2JCJA 3RMWA 2NXVA 2OI5A 1WVCA 4Y9XA 2AM5A 4B4BA 5C38A 1O23B 5CMIA 5DDVA 2RJ5A 4DE7A 1H5RA 4Y7GA 1NKHB 2FYCB 3SXBA 5EJZA 3U0YA 3U2TA 1IIMA 4K6RA 1NQIB 2RIXA 1H4CA 1H3MA 1TVYA 3I0HA 1WT2A 3OGZA 2YESA 2XMEA 3CKNA 2OEGA 2AH9A 1TW5A 1VPAA 5CQNX 4FIYA 1O7QA 4YS8A 2P73A 3V0PA 3ZGFA 2FYDB 3OH0A 4Q7CA 5C1GA 3ZGGA 3T7OA 3OKRA 1ZJ3A 3GUEA 3JTJA 1EZIA 1FWYA 2Z87A 4D0ZA 2I5EA 1S4PA 4O6MA 1ZCVA 4KC2A 1GX0A 1TW1A 2I5KA 2MZBA 2ZU9A 4MYBA 2DPWA 4CJCA 1WSZA 3JUJA 3V0NA 3TQDA 2RJ0A 2O1HA 2OI6A 1R7XA 2FFUA 4KPXA 5IDSA 2APCA 4AYLA 4Y62A 1V82A 3V0MA 1O7OA 2BO4A 2RIZA 2RJ8A 1FZWA 1JYLA 4G3PA 3SX3A 4J18A 3CKJA 4ZDQA 2WAWA 5FTVA 4KNXA 4P00A 5DDTA 5HS2A 1R7YA 3Q7UA 1O0RA 2P6WA 1TZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7A A;  2AES A;  4P02 A;  2BO7 A;  3I0L A;  4EEA A;  1WT0 A;  4AYJ A;  1JV1 A;  4Y6N A;  5C47 A;  3IOI A;  2V0J A;  5FV9 A;  4Y7U A;  4FRM A;  3POL A;  4IRP A;  1H5S C;  4FRA A;  1HM9 A;  1VGW A;  3I0K A;  4ASY A;  5C36 A;  5CMJ A;  1QGS A;  1VZU A;  4KRV A;  4EEG A;  1FO8 A;  4G3Q A;  1H7F A;  1ZCU A;  1G23 A;  4R7P A;  4Y63 A;  2JCO A;  3SX8 A;  1FG5 N;  2VSH A;  1GWW A;  1SS9 A;  4Y7F A;  4LW3 A;  2QGI A;  4B4G A;  2VS4 A;  1ZCY A;  3FOQ A;  3OH2 A;  1H7Q A;  1VH1 A;  3U2X A;  2Z86 A;  4JIS A;  2WEE A;  2X60 A;  5C1L A;  4CVH A;  3PKP A;  2YC3 A;  4DEC A;  4IRQ A;  2VS3 A;  4L41 C;  3SXE A;  1FXO A;  1GA8 A;  3ZLL A;  1FGG A;  1OMX A;  2JCL A;  1FOA A;  4FRL A;  5CQM X;  4D11 A;  4FRE A;  2AE7 A;  4FCU A;  2A8U A;  4HO9 A;  2Y4J A;  2PA4 A;  2Y6P A;  1ZIZ A;  2E8B A;  3OH3 A;  3V0O A;  3OH4 A;  1R81 A;  2W0W A;  3OH1 A;  1R80 A;  3ZF8 A;  5JQQ A;  1HJL A;  3ZLK A;  3CGX A;  4KQL A;  4Y7T A;  3V90 A;  5L6V A;  4ECM A;  3DUV A;  4DDZ A;  2PGY A;  5FTS A;  2FY7 A;  3Q80 A;  1WT3 A;  4FRP A;  1YP3 A;  1LL2 A;  3I0J A;  4B5B A;  4HO3 A;  5I1F A;  1W55 A;  3OAM A;  4B3U A;  2X5S A;  3FWW A;  3T7N A;  4D48 A;  4KC4 A;  1ZJ0 A;  1LZI A;  1H7L A;  1GQC A;  2WVM A;  3PKQ A;  4KNR A;  2WVL A;  4KC1 A;  1H4E A;  3E26 A;  1XZ6 A;  2ZU8 A;  2E3D A;  5AJP A;  1E5K A;  2V0H A;  1INJ A;  1R7T A;  1S4N A;  4FRQ A;  3D5N A;  1H5S B;  3SPT A;  1Z90 A;  3LW6 A;  3HL3 A;  3V0L A;  2FYA A;  1QG8 A;  4M4K A;  4B42 A;  4M2B A;  2AGD A;  1H7G A;  2QH5 A;  2ZU7 A;  4MND A;  3RMV A;  1MP3 A;  4B2X A;  3CKV A;  1NMM B;  5FYE A;  3SXD A;  1ZCT A;  3D98 A;  4Y7V A;  4EVW A;  4FQW A;  1ZJ1 A;  4E1K A;  1K4V A;  5IFY A;  1ON6 A;  1H5S A;  1LZJ A;  3PNN A;  4EE3 A;  2OI7 A;  1I52 A;  2Q4J A;  4BMA A;  2RJ6 A;  2OEF A;  2WE9 A;  3TZT A;  4HO0 A;  1WT1 A;  2YQC A;  4KT7 A;  5CMH A;  5CQO A;  4EE4 A;  2RJ7 A;  3V8Y A;  1H5S D;  3RSB A;  1QGQ A;  3IOJ A;  2XWL A;  4EE5 A;  3DJ4 A;  1YP4 A;  3I0C A;  1VGT A;  3SXA A;  2XWN A;  1PZT A;  1JVD A;  5C4C A;  1HM8 A;  1FR8 A;  1VZT A;  2RJ4 A;  2P72 A;  1LL3 A;  1FR9 A;  3BCV A;  1MC3 A;  3I0G A;  1ZJO A;  4GBP A;  1XHB A;  1H5T B;  3T7M A;  2V0L A;  2Y4L A;  2Y4M A;  3KIA A;  1GQ9 A;  5C4F A;  4AC3 A;  4G3S A;  4AAW A;  1ZDG A;  1GWV A;  1ZI4 A;  2V0K A;  1FRW A;  2BO6 A;  2FFV A;  4M2A A;  4HO4 A;  1H4D A;  1QWJ A;  2Y4K A;  2XMH A;  3DK5 A;  3U2V A;  4NAI A;  2UX8 A;  1FXJ A;  4HG6 A;  3R3I A;  5CMG X;  4CJB A;  3NGW A;  2JCK A;  1VM8 A;  2VXL A;  4Y6U A;  4KXO A;  1ZI1 A;  1LVW A;  2YC5 A;  3I0I X;  4HCQ A;  5AJO A;  3E25 A;  1HJJ A;  2GGQ A;  2FYB A;  1KWS A;  5C4B A;  2RJ1 A;  2RIY A;  1LL0 A;  1H7H A;  1H5T A;  3BRK X;  4HO8 A;  4NAN A;  3I0D A;  3V0Q A;  3IOH A;  5C48 A;  2VSI A;  2YQS A;  3SXC A;  1JYK A;  1OMZ A;  1G93 A;  4NAK A;  1R7V A;  4FCE A;  1W77 A;  4EEO A;  5C1H A;  3QVB A;  1OQM B;  1ON8 A;  1W57 A;  2VD4 A;  3O3P A;  1PZY B;  1G2V A;  1HM0 A;  4UEG A;  4BQH A;  3ST8 A;  1R7U A;  2YCM A;  3U2U A;  4XWI A;  3EE5 A;  1VZX A;  2ICY A;  3F1C A;  5C8R A;  5CQP A;  5BXC A;  2W0V A;  1ZI5 A;  4B4M A;  3U0X A;  2I7B A;  1IIN A;  1ZJ2 A;  1LZ7 A;  2PGV A;  4Y64 A;  1NF5 B;  4CJ8 A;  1ZDF A;  3U2W A;  5C3D A;  4FRH A;  1GX4 A;  1G0R A;  4HO2 A;  3D8V A;  2CU2 A;  1MP4 A;  1VH3 A;  2YQH A;  2WGZ A;  2ICX A;  3I0F A;  1FGX A;  2D0J A;  3I0E A;  3V91 A;  5C4D A;  2AM4 A;  1JV3 A;  3K8E A;  5CQL X;  3K8D A;  4HO5 A;  2X65 A;  1G3L A;  1G97 A;  5C4E A;  5IDT A;  2RJ9 A;  4C2S A;  1MP5 A;  2D7R A;  4FRD A;  2YQJ A;  3USQ A;  4JD0 A;  4FRO A;  5AJN A;  2VXM A;  3F1Y A;  1NWG B;  2O1F A;  2RIT A;  2XWM A;  1V84 A;  1HV9 A;  4HOC A;  5EJ1 A;  5FU0 A;  4EEM A;  3USR A;  1H7T A;  1ZJP A;  3R2W A;  3JUK A;  1NHE B;  1INI A;  5FU8 A;  1EYR A;  1G9R A;  3SX5 A;  5J49 A;  5CMF X;  2V0I A;  2WVK A;  1G95 A;  1ZI3 A;  2A8W A;  2VFZ A;  4ASJ A;  1YP2 A;  5L6S A;  4LW6 A;  2QKX A;  1H7E A;  2PX7 A;  1JVG A;  1YRO B;  2AM3 A;  4G87 A;  4B2W A;  3CKQ A;  2GGO A;  1R82 A;  1H5R B;  2VS5 A;  2O1G A;  2BO8 A;  3SXG A;  4FRB A;  5EIY A;  3Q4S A;  3V8Z A;  1VGU A;  3SX7 A;  3CU0 A;  5FUH A;  1S4O A;  5C3A A;  1FO9 A;  4HO6 A;  4M28 A;  1LZ0 A;  1ZHJ A;  1VIC A;  5C49 A;  4D0T A;  4KPZ A;  4ARW A;  2AEC A;  3CKO A;  5C3B A;  1VGZ A;  4D11 C;  1G8O A;  1G1L A;  3N9W A;  1V83 A;  4NAL A;  2X5Z A;  2D7I A;  3OC9 A;  2JCJ A;  3RMW A;  2NXV A;  2OI5 A;  1WVC A;  4Y9X A;  2AM5 A;  4B4B A;  5C38 A;  1O23 B;  5CMI A;  5DDV A;  2RJ5 A;  4DE7 A;  1H5R A;  4Y7G A;  1NKH B;  2FYC B;  3SXB A;  5EJZ A;  3U0Y A;  3U2T A;  1IIM A;  4K6R A;  1NQI B;  2RIX A;  1H4C A;  1H3M A;  1TVY A;  3I0H A;  1WT2 A;  3OGZ A;  2YES A;  2XME A;  3CKN A;  2OEG A;  2AH9 A;  1TW5 A;  1VPA A;  5CQN X;  1O7Q A;  4YS8 A;  2P73 A;  3V0P A;  3ZGF A;  2FYD B;  3OH0 A;  5C1G A;  3ZGG A;  3T7O A;  3OKR A;  1ZJ3 A;  3GUE A;  3JTJ A;  1EZI A;  1FWY A;  2Z87 A;  4D0Z A;  2I5E A;  1S4P A;  1ZCV A;  4KC2 A;  1GX0 A;  1TW1 A;  2I5K A;  2MZB A;  2ZU9 A;  4MYB A;  2DPW A;  4CJC A;  1WSZ A;  3JUJ A;  3V0N A;  3TQD A;  2RJ0 A;  2O1H A;  2OI6 A;  1R7X A;  2FFU A;  4KPX A;  5IDS A;  2APC A;  4AYL A;  4Y62 A;  1V82 A;  3V0M A;  1O7O A;  2BO4 A;  2RIZ A;  2RJ8 A;  1FZW A;  1JYL A;  4G3P A;  3SX3 A;  4J18 A;  3CKJ A;  4ZDQ A;  2WAW A;  5FTV A;  4KNX A;  4P00 A;  5DDT A;  5HS2 A;  1R7Y A;  3Q7U A;  1O0R A;  2P6W A;  1TZF A; 
#chains in the Genus database with same CATH topology
 2Y7A A;  2AES A;  4P02 A;  2BO7 A;  3I0L A;  4EEA A;  1WT0 A;  4AYJ A;  1JV1 A;  4Y6N A;  5C47 A;  3IOI A;  2V0J A;  5FV9 A;  4Y7U A;  4FRM A;  3POL A;  4IRP A;  1H5S C;  4FRA A;  1HM9 A;  1VGW A;  3I0K A;  4ASY A;  5C36 A;  5CMJ A;  1QGS A;  1VZU A;  4KRV A;  4EEG A;  1FO8 A;  4G3Q A;  1H7F A;  1ZCU A;  1G23 A;  4R7P A;  4Y63 A;  2JCO A;  3SX8 A;  1FG5 N;  2VSH A;  1GWW A;  1SS9 A;  4Y7F A;  4LW3 A;  2QGI A;  4B4G A;  2VS4 A;  1ZCY A;  3FOQ A;  3OH2 A;  1H7Q A;  1VH1 A;  3U2X A;  2Z86 A;  4JIS A;  2WEE A;  2X60 A;  5C1L A;  4CVH A;  3PKP A;  2YC3 A;  4DEC A;  4IRQ A;  2VS3 A;  4L41 C;  3SXE A;  1FXO A;  1GA8 A;  3ZLL A;  1FGG A;  1OMX A;  2JCL A;  1FOA A;  4FRL A;  5CQM X;  4D11 A;  4FRE A;  2AE7 A;  4FCU A;  2A8U A;  4HO9 A;  2Y4J A;  2PA4 A;  2Y6P A;  1ZIZ A;  2E8B A;  3OH3 A;  3V0O A;  3OH4 A;  1R81 A;  2W0W A;  3OH1 A;  1R80 A;  3ZF8 A;  5JQQ A;  1HJL A;  3ZLK A;  3CGX A;  4KQL A;  4Y7T A;  3V90 A;  5L6V A;  4ECM A;  3DUV A;  4DDZ A;  2PGY A;  5FTS A;  2FY7 A;  3Q80 A;  1WT3 A;  4FRP A;  1YP3 A;  1LL2 A;  3I0J A;  4B5B A;  4HO3 A;  5I1F A;  1W55 A;  3OAM A;  4B3U A;  2X5S A;  3FWW A;  3T7N A;  4D48 A;  4KC4 A;  1ZJ0 A;  1LZI A;  1H7L A;  1GQC A;  2WVM A;  3PKQ A;  4KNR A;  2WVL A;  4KC1 A;  1H4E A;  3E26 A;  1XZ6 A;  2ZU8 A;  2E3D A;  5AJP A;  1E5K A;  2V0H A;  1INJ A;  1R7T A;  1S4N A;  4FRQ A;  3D5N A;  1H5S B;  3SPT A;  1Z90 A;  3LW6 A;  3HL3 A;  3V0L A;  2FYA A;  1QG8 A;  4M4K A;  4B42 A;  4M2B A;  2AGD A;  1H7G A;  2QH5 A;  2ZU7 A;  4MND A;  3RMV A;  1MP3 A;  4B2X A;  3CKV A;  1NMM B;  5FYE A;  3SXD A;  1ZCT A;  3D98 A;  4Y7V A;  4EVW A;  4FQW A;  1ZJ1 A;  4E1K A;  1K4V A;  5IFY A;  1ON6 A;  1H5S A;  1LZJ A;  3PNN A;  4EE3 A;  2OI7 A;  1I52 A;  2Q4J A;  4BMA A;  2RJ6 A;  2OEF A;  2WE9 A;  3TZT A;  4HO0 A;  1WT1 A;  2YQC A;  4KT7 A;  5CMH A;  5CQO A;  5D91 A;  4EE4 A;  2RJ7 A;  3V8Y A;  1H5S D;  3RSB A;  1QGQ A;  3IOJ A;  2XWL A;  4EE5 A;  3DJ4 A;  1YP4 A;  3I0C A;  1VGT A;  4MIX A;  4O6N A;  3SXA A;  2XWN A;  1PZT A;  1JVD A;  5C4C A;  1HM8 A;  1FR8 A;  1VZT A;  2RJ4 A;  2P72 A;  1LL3 A;  1FR9 A;  3BCV A;  1MC3 A;  3I0G A;  1ZJO A;  4GBP A;  1XHB A;  1H5T B;  3T7M A;  2V0L A;  2Y4L A;  2Y4M A;  3KIA A;  1GQ9 A;  5C4F A;  4AC3 A;  4G3S A;  4AAW A;  1ZDG A;  1GWV A;  1ZI4 A;  2V0K A;  1FRW A;  2BO6 A;  2FFV A;  4M2A A;  4HO4 A;  1H4D A;  1QWJ A;  2Y4K A;  2XMH A;  3DK5 A;  3U2V A;  4NAI A;  2UX8 A;  1FXJ A;  4HG6 A;  3R3I A;  5CMG X;  2J0B A;  4CJB A;  3NGW A;  2JCK A;  1VM8 A;  2VXL A;  4Y6U A;  4KXO A;  1ZI1 A;  1LVW A;  2YC5 A;  3I0I X;  4HCQ A;  5AJO A;  3E25 A;  1HJJ A;  2GGQ A;  2FYB A;  1KWS A;  5C4B A;  2RJ1 A;  2RIY A;  1LL0 A;  1H7H A;  1H5T A;  3BRK X;  4HO8 A;  4NAN A;  3I0D A;  3V0Q A;  3IOH A;  5C48 A;  2VSI A;  2YQS A;  3SXC A;  1JYK A;  1OMZ A;  1G93 A;  4NAK A;  1R7V A;  4FCE A;  1W77 A;  4EEO A;  5C1H A;  3QVB A;  1OQM B;  1ON8 A;  1W57 A;  2VD4 A;  3O3P A;  1PZY B;  1G2V A;  1HM0 A;  4UEG A;  4BQH A;  3ST8 A;  1R7U A;  2YCM A;  3U2U A;  4XWI A;  2VK9 A;  1VZX A;  3EE5 A;  2ICY A;  3F1C A;  5C8R A;  5CQP A;  5BXC A;  2W0V A;  1ZI5 A;  4B4M A;  3U0X A;  2I7B A;  1IIN A;  1ZJ2 A;  1LZ7 A;  2PGV A;  4Y64 A;  1NF5 B;  4CJ8 A;  1ZDF A;  3U2W A;  5C3D A;  4FRH A;  1GX4 A;  1G0R A;  4HO2 A;  3D8V A;  2CU2 A;  1MP4 A;  1VH3 A;  2YQH A;  2WGZ A;  2ICX A;  3I0F A;  1FGX A;  2D0J A;  3I0E A;  3V91 A;  5C4D A;  2AM4 A;  1JV3 A;  3K8E A;  5CQL X;  3K8D A;  4HO5 A;  2X65 A;  1G3L A;  1G97 A;  5C4E A;  5IDT A;  2RJ9 A;  4C2S A;  1MP5 A;  2D7R A;  4FRD A;  2YQJ A;  3USQ A;  4JD0 A;  4FRO A;  5AJN A;  2VXM A;  3F1Y A;  1NWG B;  2O1F A;  2RIT A;  2XWM A;  1V84 A;  1HV9 A;  4HOC A;  5EJ1 A;  5FU0 A;  4EEM A;  3USR A;  1H7T A;  1ZJP A;  3R2W A;  3JUK A;  1NHE B;  1INI A;  5FU8 A;  1EYR A;  1G9R A;  3SX5 A;  5J49 A;  5CMF X;  2V0I A;  2WVK A;  1G95 A;  1ZI3 A;  2C0N A;  2A8W A;  2VFZ A;  4ASJ A;  1YP2 A;  5L6S A;  4LW6 A;  2QKX A;  1H7E A;  2PX7 A;  1JVG A;  1YRO B;  2AM3 A;  4G87 A;  4B2W A;  3CKQ A;  2GGO A;  1R82 A;  1H5R B;  2VS5 A;  2O1G A;  2BO8 A;  3SXG A;  4FIX A;  4FRB A;  5EIY A;  3Q4S A;  3V8Z A;  1VGU A;  3SX7 A;  3CU0 A;  5FUH A;  1S4O A;  5C3A A;  1FO9 A;  4HO6 A;  4M28 A;  1LZ0 A;  1ZHJ A;  1VIC A;  5C49 A;  4D0T A;  4KPZ A;  4ARW A;  2AEC A;  2J0A A;  3CKO A;  5C3B A;  1VGZ A;  4D11 C;  1G8O A;  1G1L A;  5D92 A;  3N9W A;  1V83 A;  4NAL A;  2X5Z A;  2D7I A;  3OC9 A;  2JCJ A;  3RMW A;  2NXV A;  2OI5 A;  1WVC A;  4Y9X A;  2AM5 A;  4B4B A;  5C38 A;  1O23 B;  5CMI A;  5DDV A;  2RJ5 A;  4DE7 A;  1H5R A;  4Y7G A;  1NKH B;  2FYC B;  3SXB A;  5EJZ A;  3U0Y A;  3U2T A;  1IIM A;  4K6R A;  1NQI B;  2RIX A;  1H4C A;  1H3M A;  1TVY A;  3I0H A;  1WT2 A;  3OGZ A;  2YES A;  2XME A;  3CKN A;  2OEG A;  2AH9 A;  1TW5 A;  1VPA A;  5CQN X;  4FIY A;  1O7Q A;  4YS8 A;  2P73 A;  3V0P A;  3ZGF A;  2FYD B;  3OH0 A;  4Q7C A;  5C1G A;  3ZGG A;  3T7O A;  3OKR A;  1ZJ3 A;  3GUE A;  3JTJ A;  1EZI A;  1FWY A;  2Z87 A;  4D0Z A;  2I5E A;  1S4P A;  4O6M A;  1ZCV A;  4KC2 A;  1GX0 A;  1TW1 A;  2I5K A;  2MZB A;  2ZU9 A;  4MYB A;  2DPW A;  4CJC A;  1WSZ A;  3JUJ A;  3V0N A;  3TQD A;  2RJ0 A;  2O1H A;  2OI6 A;  1R7X A;  2FFU A;  4KPX A;  5IDS A;  2APC A;  4AYL A;  4Y62 A;  1V82 A;  3V0M A;  1O7O A;  2BO4 A;  2RIZ A;  2RJ8 A;  1FZW A;  1JYL A;  4G3P A;  3SX3 A;  4J18 A;  3CKJ A;  4ZDQ A;  2WAW A;  5FTV A;  4KNX A;  4P00 A;  5DDT A;  5HS2 A;  1R7Y A;  3Q7U A;  1O0R A;  2P6W A;  1TZF A; 
#chains in the Genus database with same CATH homology
 2Y7A A;  2AES A;  4P02 A;  2BO7 A;  3I0L A;  4EEA A;  1WT0 A;  4AYJ A;  1JV1 A;  4Y6N A;  5C47 A;  3IOI A;  2V0J A;  5FV9 A;  4Y7U A;  4FRM A;  3POL A;  4IRP A;  1H5S C;  4FRA A;  1HM9 A;  1VGW A;  3I0K A;  4ASY A;  5C36 A;  5CMJ A;  1QGS A;  1VZU A;  4KRV A;  4EEG A;  1FO8 A;  4G3Q A;  1H7F A;  1ZCU A;  1G23 A;  4R7P A;  4Y63 A;  2JCO A;  3SX8 A;  1FG5 N;  2VSH A;  1GWW A;  1SS9 A;  4Y7F A;  4LW3 A;  2QGI A;  4B4G A;  2VS4 A;  1ZCY A;  3FOQ A;  3OH2 A;  1H7Q A;  1VH1 A;  3U2X A;  2Z86 A;  4JIS A;  2WEE A;  2X60 A;  5C1L A;  4CVH A;  3PKP A;  2YC3 A;  4DEC A;  4IRQ A;  2VS3 A;  4L41 C;  3SXE A;  1FXO A;  1GA8 A;  3ZLL A;  1FGG A;  1OMX A;  2JCL A;  1FOA A;  4FRL A;  5CQM X;  4D11 A;  4FRE A;  2AE7 A;  4FCU A;  2A8U A;  4HO9 A;  2Y4J A;  2PA4 A;  2Y6P A;  1ZIZ A;  2E8B A;  3OH3 A;  3V0O A;  3OH4 A;  1R81 A;  2W0W A;  3OH1 A;  1R80 A;  3ZF8 A;  5JQQ A;  1HJL A;  3ZLK A;  3CGX A;  4KQL A;  4Y7T A;  3V90 A;  5L6V A;  4ECM A;  3DUV A;  4DDZ A;  2PGY A;  5FTS A;  2FY7 A;  3Q80 A;  1WT3 A;  4FRP A;  1YP3 A;  1LL2 A;  3I0J A;  4B5B A;  4HO3 A;  5I1F A;  1W55 A;  3OAM A;  4B3U A;  2X5S A;  3FWW A;  3T7N A;  4D48 A;  4KC4 A;  1ZJ0 A;  1LZI A;  1H7L A;  1GQC A;  2WVM A;  3PKQ A;  4KNR A;  2WVL A;  4KC1 A;  1H4E A;  3E26 A;  1XZ6 A;  2ZU8 A;  2E3D A;  5AJP A;  1E5K A;  2V0H A;  1INJ A;  1R7T A;  1S4N A;  4FRQ A;  3D5N A;  1H5S B;  3SPT A;  1Z90 A;  3LW6 A;  3HL3 A;  3V0L A;  2FYA A;  1QG8 A;  4M4K A;  4B42 A;  4M2B A;  2AGD A;  1H7G A;  2QH5 A;  2ZU7 A;  4MND A;  3RMV A;  1MP3 A;  4B2X A;  3CKV A;  1NMM B;  5FYE A;  3SXD A;  1ZCT A;  3D98 A;  4Y7V A;  4EVW A;  4FQW A;  1ZJ1 A;  4E1K A;  1K4V A;  5IFY A;  1ON6 A;  1H5S A;  1LZJ A;  3PNN A;  4EE3 A;  2OI7 A;  1I52 A;  2Q4J A;  4BMA A;  2RJ6 A;  2OEF A;  2WE9 A;  3TZT A;  4HO0 A;  1WT1 A;  2YQC A;  4KT7 A;  5CMH A;  5CQO A;  5D91 A;  4EE4 A;  2RJ7 A;  3V8Y A;  1H5S D;  3RSB A;  1QGQ A;  3IOJ A;  2XWL A;  4EE5 A;  3DJ4 A;  1YP4 A;  3I0C A;  1VGT A;  4MIX A;  4O6N A;  3SXA A;  2XWN A;  1PZT A;  1JVD A;  5C4C A;  1HM8 A;  1FR8 A;  1VZT A;  2RJ4 A;  2P72 A;  1LL3 A;  1FR9 A;  3BCV A;  1MC3 A;  3I0G A;  1ZJO A;  4GBP A;  1XHB A;  1H5T B;  3T7M A;  2V0L A;  2Y4L A;  2Y4M A;  3KIA A;  1GQ9 A;  5C4F A;  4AC3 A;  4G3S A;  4AAW A;  1ZDG A;  1GWV A;  1ZI4 A;  2V0K A;  1FRW A;  2BO6 A;  2FFV A;  4M2A A;  4HO4 A;  1H4D A;  1QWJ A;  2Y4K A;  2XMH A;  3DK5 A;  3U2V A;  4NAI A;  2UX8 A;  1FXJ A;  4HG6 A;  3R3I A;  5CMG X;  2J0B A;  4CJB A;  3NGW A;  2JCK A;  1VM8 A;  2VXL A;  4Y6U A;  4KXO A;  1ZI1 A;  1LVW A;  2YC5 A;  3I0I X;  4HCQ A;  5AJO A;  3E25 A;  1HJJ A;  2GGQ A;  2FYB A;  1KWS A;  5C4B A;  2RJ1 A;  2RIY A;  1LL0 A;  1H7H A;  1H5T A;  3BRK X;  4HO8 A;  4NAN A;  3I0D A;  3V0Q A;  3IOH A;  5C48 A;  2VSI A;  2YQS A;  3SXC A;  1JYK A;  1OMZ A;  1G93 A;  4NAK A;  1R7V A;  4FCE A;  1W77 A;  4EEO A;  5C1H A;  3QVB A;  1OQM B;  1ON8 A;  1W57 A;  2VD4 A;  3O3P A;  1PZY B;  1G2V A;  1HM0 A;  4UEG A;  4BQH A;  3ST8 A;  1R7U A;  2YCM A;  3U2U A;  4XWI A;  2VK9 A;  1VZX A;  3EE5 A;  2ICY A;  3F1C A;  5C8R A;  5CQP A;  5BXC A;  2W0V A;  1ZI5 A;  4B4M A;  3U0X A;  2I7B A;  1IIN A;  1ZJ2 A;  1LZ7 A;  2PGV A;  4Y64 A;  1NF5 B;  4CJ8 A;  1ZDF A;  3U2W A;  5C3D A;  4FRH A;  1GX4 A;  1G0R A;  4HO2 A;  3D8V A;  2CU2 A;  1MP4 A;  1VH3 A;  2YQH A;  2WGZ A;  2ICX A;  3I0F A;  1FGX A;  2D0J A;  3I0E A;  3V91 A;  5C4D A;  2AM4 A;  1JV3 A;  3K8E A;  5CQL X;  3K8D A;  4HO5 A;  2X65 A;  1G3L A;  1G97 A;  5C4E A;  5IDT A;  2RJ9 A;  4C2S A;  1MP5 A;  2D7R A;  4FRD A;  2YQJ A;  3USQ A;  4JD0 A;  4FRO A;  5AJN A;  2VXM A;  3F1Y A;  1NWG B;  2O1F A;  2RIT A;  2XWM A;  1V84 A;  1HV9 A;  4HOC A;  5EJ1 A;  5FU0 A;  4EEM A;  3USR A;  1H7T A;  1ZJP A;  3R2W A;  3JUK A;  1NHE B;  1INI A;  5FU8 A;  1EYR A;  1G9R A;  3SX5 A;  5J49 A;  5CMF X;  2V0I A;  2WVK A;  1G95 A;  1ZI3 A;  2C0N A;  2A8W A;  2VFZ A;  4ASJ A;  1YP2 A;  5L6S A;  4LW6 A;  2QKX A;  1H7E A;  2PX7 A;  1JVG A;  1YRO B;  2AM3 A;  4G87 A;  4B2W A;  3CKQ A;  2GGO A;  1R82 A;  1H5R B;  2VS5 A;  2O1G A;  2BO8 A;  3SXG A;  4FIX A;  4FRB A;  5EIY A;  3Q4S A;  3V8Z A;  1VGU A;  3SX7 A;  3CU0 A;  5FUH A;  1S4O A;  5C3A A;  1FO9 A;  4HO6 A;  4M28 A;  1LZ0 A;  1ZHJ A;  1VIC A;  5C49 A;  4D0T A;  4KPZ A;  4ARW A;  2AEC A;  2J0A A;  3CKO A;  5C3B A;  1VGZ A;  4D11 C;  1G8O A;  1G1L A;  5D92 A;  3N9W A;  1V83 A;  4NAL A;  2X5Z A;  2D7I A;  3OC9 A;  2JCJ A;  3RMW A;  2NXV A;  2OI5 A;  1WVC A;  4Y9X A;  2AM5 A;  4B4B A;  5C38 A;  1O23 B;  5CMI A;  5DDV A;  2RJ5 A;  4DE7 A;  1H5R A;  4Y7G A;  1NKH B;  2FYC B;  3SXB A;  5EJZ A;  3U0Y A;  3U2T A;  1IIM A;  4K6R A;  1NQI B;  2RIX A;  1H4C A;  1H3M A;  1TVY A;  3I0H A;  1WT2 A;  3OGZ A;  2YES A;  2XME A;  3CKN A;  2OEG A;  2AH9 A;  1TW5 A;  1VPA A;  5CQN X;  4FIY A;  1O7Q A;  4YS8 A;  2P73 A;  3V0P A;  3ZGF A;  2FYD B;  3OH0 A;  4Q7C A;  5C1G A;  3ZGG A;  3T7O A;  3OKR A;  1ZJ3 A;  3GUE A;  3JTJ A;  1EZI A;  1FWY A;  2Z87 A;  4D0Z A;  2I5E A;  1S4P A;  4O6M A;  1ZCV A;  4KC2 A;  1GX0 A;  1TW1 A;  2I5K A;  2MZB A;  2ZU9 A;  4MYB A;  2DPW A;  4CJC A;  1WSZ A;  3JUJ A;  3V0N A;  3TQD A;  2RJ0 A;  2O1H A;  2OI6 A;  1R7X A;  2FFU A;  4KPX A;  5IDS A;  2APC A;  4AYL A;  4Y62 A;  1V82 A;  3V0M A;  1O7O A;  2BO4 A;  2RIZ A;  2RJ8 A;  1FZW A;  1JYL A;  4G3P A;  3SX3 A;  4J18 A;  3CKJ A;  4ZDQ A;  2WAW A;  5FTV A;  4KNX A;  4P00 A;  5DDT A;  5HS2 A;  1R7Y A;  3Q7U A;  1O0R A;  2P6W A;  1TZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...