3U2WA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and glucose or a glucal species
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
262
structure length
262
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2wA00
3I0GA 2AGDA 3V90A 1H5RB 2YQJA 1LZJA 3CKOA 5AJNA 3JUJA 2VFZA 1H7TA 5CQOA 4M4KA 1JVGA 3OKRA 1FR8A 3OH1A 2V0HA 2RIYA 1H7QA 2VS5A 2AM4A 1W77A 2GGQA 5L6VA 4Y6UA 5FYEA 1VPAA 2BO6A 4DECA 2QKXA 5CQLX 3I0JA 2JCLA 1JV3A 1VGWA 1NWGB 4NALA 4D0ZA 2BO4A 1H4EA 3FOQA 2O1FA 1ZJ2A 2P6WA 3BCVA 3I0FA 3IOHA 1VZUA 3Q4SA 4HO8A 4KXOA 5DDVA 1MP3A 1LVWA 5FV9A 2OI5A 2RJ1A 3N9WA 4EE3A 2RJ9A 3ZGFA 2P73A 5FTSA 4ARWA 4FRQA 1IINA 2E8BA 3V0LA 4Y62A 1S4OA 1MP5A 3USRA 4G3PA 2OEFA 4JD0A 3I0IX 2XMEA 4MYBA 3SXBA 1H5SA 4FCEA 1WSZA 3T7OA 1FR9A 4L41C 5C38A 1JYKA 2ICYA 4HO6A 1FOAA 3IOIA 1W57A 2GGOA 5I1FA 2AE7A 5FUHA 3USQA 4LW6A 2VD4A 4P00A 4E1KA 3R3IA 1R82A 1ON6A 2WAWA 4KC4A 4AAWA 2DPWA 4CVHA 3RMWA 3SX8A 2WGZA 1ZI3A 1HM9A 3ZLKA 2P72A 5C49A 1LZIA 5CQPA 1HV9A 1VGUA 3OC9A 4FRLA 5C47A 2A8WA 2FFUA 4Y63A 4ZDQA 3F1CA 4FRPA 4HO0A 3DJ4A 3O3PA 1MP4A 3HL3A 3I0DA 4XWIA 4D11C 1INIA 2PX7A 2RITA 3ZF8A 1G0RA 2WVLA 1H5TA 4EEAA 5C4CA 2YC5A 1E5KA 4HO2A 2ICXA 2O1GA 2A8UA 2Z87A 3LW6A 3POLA 4R7PA 1VZXA 2PGYA 4FRBA 4FRDA 2CU2A 5CMFX 1R81A 2FY7A 3TZTA 1TW5A 2X60A 2X5SA 3OAMA 1W55A 4HO4A 2W0VA 1GX0A 2Q4JA 2I5KA 5C8RA 3CU0A 1ZJ0A 5IDSA 2ZU8A 4DE7A 1R7YA 3OH0A 3Q80A 1ZCVA 4B2WA 2PA4A 2XWLA 4G3SA 2I7BA 2FFVA 2Y4LA 1ZI5A 1H5SD 1FRWA 4Y7UA 3RSBA 1TZFA 1FO8A 3ST8A 1V84A 2RIZA 4NAIA 3EE5A 5C3AA 1H4CA 1H5RA 2Y7AA 4ASJA 1WVCA 2YQHA 3I0EA 4JISA 4Y7TA 1V82A 1YP3A 3OH2A 4K6RA 4FRMA 2I5EA 4EEOA 1S4PA 2YQSA 3OGZA 4FRHA 2RJ8A 2Y4MA 4FROA 1TVYA 1VICA 1ZCYA 4M2BA 4KQLA 3U2VA 2D0JA 1OMZA 1XZ6A 4HO5A 4Y6NA 1H4DA 3U2UA 1NF5B 1YROB 1JVDA 2V0IA 4KNXA 1G95A 2ZU9A 4Y7FA 1ZHJA 1ZCTA 4AC3A 4GBPA 4CJ8A 1VGTA 3OH3A 4M28A 4Y9XA 5IFYA 4CJBA 4FQWA 2QGIA 3E26A 4UEGA 1EYRA 4DDZA 1H7FA 2AM5A 1HM0A 1FXJA 1PZYB 1V83A 4AYLA 4BMAA 3PKQA 1JV1A 2YQCA 5CMIA 4C2SA 3ZLLA 1R7UA 2RIXA 2WE9A 2YCMA 4G3QA 4Y64A 3SX5A 2QH5A 2V0LA 5EIYA 5FU0A 5C4DA 2FYBA 1SS9A 4EVWA 1ON8A 5C3DA 2BO7A 5DDTA 3PKPA 2JCOA 4B5BA 2AH9A 1FXOA 1LL0A 2XWNA 4KPZA 3SX3A 5HS2A 1XHBA 2MZBA 1HJLA 4G87A 2V0KA 4D11A 5JQQA 1LZ7A 4LW3A 1JYLA 5C1GA 2RJ5A 1NHEB 5C1LA 4EE5A 4KNRA 3D98A 3U2WA 3SXDA 2VS4A 5C4BA 4EEGA 2RJ6A 3U2TA 5CMGX 1R7VA 4B3UA 3SX7A 3TQDA 1IIMA 5AJOA 4NAKA 2OI6A 4IRPA 4FRAA 4B2XA 4CJCA 5J49A 2W0WA 1I52A 5IDTA 1QGQA 1GWVA 1H7GA 3SXAA 3D8VA 5EJZA 4FREA 4KC1A 4B4MA 4KT7A 5C4EA 4HG6A 3V8ZA 3QVBA 1ZCUA 3IOJA 4M2AA 1GA8A 3CKQA 2FYAA 1G23A 1YP4A 2OEGA 1ZJPA 2BO8A 1R7XA 3I0KA 5C36A 3ZGGA 1ZDFA 1NMMB 3I0HA 4D0TA 1H7LA 3KIAA 1VM8A 4HO3A 4D48A 1FGGA 3SXGA 1TW1A 3I0CA 5CMJA 3K8DA 2D7RA 4Y7VA 5L6SA 1S4NA 3T7NA 1K4VA 5FTVA 3CKNA 2FYDB 1ZJ1A 5C3BA 2Y4JA 3NGWA 3OH4A 1ZDGA 1WT2A 1O0RA 2FYCB 3V0MA 4B42A 1ZI4A 1ZI1A 1ZIZA 3Q7UA 1GX4A 1G1LA 4ECMA 3K8EA 4KPXA 1WT0A 5C1HA 2RJ4A 1NQIB 4ASYA 2RJ7A 1G9RA 1H7HA 2YESA 1FG5N 4B4GA 1EZIA 2OI7A 3RMVA 4AYJA 4EEMA 4HCQA 2VXLA 3JUKA 1ZJOA 3JTJA 2AECA 4MNDA 1R80A 2VSHA 3F1YA 1H5SB 1Z90A 4P02A 2AM3A 1G2VA 3BRKX 3V0NA 3DUVA 2XMHA 4EE4A 4J18A 4KRVA 5BXCA 3I0LA 5CQNX 3E25A 3SXCA 3DK5A 2YC3A 1LL2A 2UX8A 1G93A 1QGSA 4NANA 2O1HA 1FZWA 2WVKA 5FU8A 1H5SC 1O23B 1LL3A 4KC2A 1HJJA 2V0JA 2NXVA 2Y4KA 1G3LA 1HM8A 1OMXA 3FWWA 4BQHA 1O7OA 2ZU7A 3U0YA 1NKHB 2PGVA 1OQMB 3CKJA 2X65A 2VXMA 2D7IA 4Y7GA 3SPTA 1R7TA 2Y6PA 1GQCA 1H5TB 1VGZA 1FGXA 3D5NA 4B4BA 2APCA 4YS8A 3R2WA 3CKVA 2AESA 1G8OA 1QG8A 2E3DA 5C48A 2VSIA 2WEEA 4FCUA 1H3MA 3V0OA 1FO9A 2XWMA 1ZJ3A 1VH1A 1WT1A 2Z86A 1O7QA 1PZTA 1YP2A 3SXEA 1GQ9A 2VS3A 1WT3A 2X5ZA 2JCJA 5AJPA 2JCKA 1G97A 3PNNA 5CQMX 1QWJA 1H7EA 3CGXA 1VZTA 1INJA 1FWYA 3U2XA 4HO9A 1LZ0A 1KWSA 5C4FA 5EJ1A 2RJ0A 1MC3A 4HOCA 4IRQA 3T7MA 2WVMA 1VH3A 3U0XA 3V0QA 5CMHA 3GUEA 3V91A 3V0PA 1GWWA 3V8YA
chains in the Genus database with same CATH superfamily
3I0GA 2AGDA 3V90A 1H5RB 2YQJA 1LZJA 3CKOA 5AJNA 3JUJA 2VFZA 1H7TA 5CQOA 4M4KA 1JVGA 3OKRA 1FR8A 3OH1A 2V0HA 2RIYA 1H7QA 2VS5A 2AM4A 1W77A 2GGQA 5L6VA 4Y6UA 5FYEA 1VPAA 2BO6A 4DECA 2QKXA 5CQLX 3I0JA 5D91A 2JCLA 1JV3A 1VGWA 1NWGB 4NALA 4D0ZA 2BO4A 5D92A 1H4EA 3FOQA 2O1FA 1ZJ2A 2P6WA 3BCVA 3I0FA 3IOHA 1VZUA 3Q4SA 4HO8A 4KXOA 5DDVA 1MP3A 1LVWA 5FV9A 2OI5A 2RJ1A 3N9WA 4EE3A 2RJ9A 3ZGFA 2P73A 5FTSA 4ARWA 4FRQA 1IINA 2E8BA 3V0LA 4Y62A 1S4OA 1MP5A 3USRA 4G3PA 2OEFA 4JD0A 3I0IX 2XMEA 4MYBA 3SXBA 1H5SA 4FCEA 1WSZA 3T7OA 1FR9A 4L41C 5C38A 1JYKA 2ICYA 4HO6A 1FOAA 3IOIA 1W57A 2GGOA 5I1FA 2AE7A 5FUHA 3USQA 4LW6A 2VD4A 4P00A 4E1KA 3R3IA 1R82A 1ON6A 2WAWA 4KC4A 4AAWA 2DPWA 4CVHA 3RMWA 3SX8A 2WGZA 1ZI3A 1HM9A 3ZLKA 2P72A 5C49A 1LZIA 5CQPA 1HV9A 1VGUA 3OC9A 4FRLA 5C47A 2A8WA 2FFUA 4Y63A 4ZDQA 3F1CA 4FRPA 4HO0A 3DJ4A 3O3PA 1MP4A 3HL3A 3I0DA 4XWIA 4D11C 1INIA 2PX7A 2RITA 3ZF8A 1G0RA 2WVLA 1H5TA 4EEAA 5C4CA 2YC5A 1E5KA 4HO2A 2ICXA 2O1GA 2A8UA 2Z87A 3LW6A 3POLA 4R7PA 1VZXA 2PGYA 4FRBA 4FRDA 2CU2A 5CMFX 1R81A 2FY7A 3TZTA 1TW5A 2X60A 2X5SA 3OAMA 1W55A 4HO4A 2W0VA 1GX0A 2Q4JA 2I5KA 5C8RA 3CU0A 1ZJ0A 5IDSA 2ZU8A 4DE7A 1R7YA 3OH0A 3Q80A 1ZCVA 4B2WA 2PA4A 2XWLA 4G3SA 2I7BA 2FFVA 2Y4LA 1ZI5A 1H5SD 1FRWA 4Y7UA 3RSBA 1TZFA 1FO8A 3ST8A 1V84A 2RIZA 4NAIA 3EE5A 5C3AA 1H4CA 1H5RA 2Y7AA 4ASJA 1WVCA 2YQHA 3I0EA 4JISA 4Y7TA 1V82A 1YP3A 3OH2A 4K6RA 4FRMA 2I5EA 4EEOA 1S4PA 2YQSA 3OGZA 4FRHA 2RJ8A 2Y4MA 4O6MA 4FROA 1TVYA 1VICA 1ZCYA 4M2BA 4KQLA 3U2VA 2D0JA 1OMZA 1XZ6A 4HO5A 4Y6NA 1H4DA 3U2UA 1NF5B 1YROB 1JVDA 2V0IA 4KNXA 1G95A 2ZU9A 4Y7FA 1ZHJA 1ZCTA 4AC3A 2VK9A 4GBPA 4CJ8A 1VGTA 3OH3A 4M28A 4Y9XA 5IFYA 4CJBA 4FQWA 2QGIA 3E26A 4UEGA 1EYRA 4DDZA 1H7FA 2AM5A 1HM0A 1FXJA 1PZYB 1V83A 4AYLA 4BMAA 3PKQA 1JV1A 2YQCA 5CMIA 4C2SA 3ZLLA 1R7UA 2RIXA 2WE9A 2YCMA 4G3QA 4Y64A 3SX5A 2QH5A 2V0LA 5EIYA 5FU0A 4FIYA 5C4DA 2FYBA 1SS9A 4EVWA 2C0NA 1ON8A 5C3DA 2BO7A 5DDTA 3PKPA 2JCOA 4B5BA 2AH9A 1FXOA 1LL0A 2XWNA 4KPZA 3SX3A 5HS2A 1XHBA 2MZBA 1HJLA 4G87A 2V0KA 4D11A 5JQQA 1LZ7A 4LW3A 1JYLA 5C1GA 2RJ5A 1NHEB 5C1LA 4EE5A 4KNRA 3D98A 3U2WA 3SXDA 2VS4A 5C4BA 4EEGA 2RJ6A 3U2TA 4FIXA 5CMGX 1R7VA 4B3UA 3SX7A 3TQDA 1IIMA 5AJOA 4NAKA 2OI6A 4IRPA 4FRAA 4B2XA 4CJCA 5J49A 2W0WA 1I52A 5IDTA 1QGQA 1GWVA 1H7GA 3SXAA 3D8VA 5EJZA 4FREA 4KC1A 4B4MA 4KT7A 5C4EA 4HG6A 4O6NA 3V8ZA 3QVBA 1ZCUA 3IOJA 4M2AA 3CKQA 1GA8A 2FYAA 1G23A 1YP4A 2OEGA 1ZJPA 2BO8A 1R7XA 3I0KA 5C36A 3ZGGA 1ZDFA 1NMMB 3I0HA 4D0TA 1H7LA 3KIAA 1VM8A 4HO3A 4D48A 1FGGA 3SXGA 1TW1A 3I0CA 5CMJA 3K8DA 2D7RA 4Y7VA 5L6SA 1S4NA 2J0BA 3T7NA 1K4VA 5FTVA 3CKNA 2FYDB 1ZJ1A 5C3BA 2Y4JA 3NGWA 3OH4A 1ZDGA 1WT2A 1O0RA 2FYCB 3V0MA 4B42A 4Q7CA 1ZI4A 1ZI1A 1ZIZA 3Q7UA 1GX4A 1G1LA 4ECMA 3K8EA 4KPXA 1WT0A 5C1HA 2RJ4A 1NQIB 4ASYA 2RJ7A 1G9RA 1H7HA 2YESA 1FG5N 4B4GA 1EZIA 2OI7A 3RMVA 4AYJA 4EEMA 4HCQA 2VXLA 3JUKA 1ZJOA 3JTJA 2AECA 4MNDA 1R80A 2VSHA 3F1YA 1H5SB 1Z90A 4P02A 2AM3A 1G2VA 3BRKX 3V0NA 3DUVA 2XMHA 4EE4A 4J18A 4KRVA 5BXCA 3I0LA 5CQNX 3E25A 3SXCA 3DK5A 2YC3A 1LL2A 2UX8A 1G93A 1QGSA 4NANA 2O1HA 1FZWA 2WVKA 5FU8A 1H5SC 1O23B 1LL3A 4KC2A 1HJJA 2V0JA 2NXVA 2Y4KA 1G3LA 1HM8A 1OMXA 3FWWA 4BQHA 1O7OA 2ZU7A 3U0YA 1NKHB 2PGVA 1OQMB 3CKJA 2X65A 2VXMA 2D7IA 4Y7GA 3SPTA 1R7TA 2Y6PA 1GQCA 1H5TB 1VGZA 1FGXA 3D5NA 4B4BA 2APCA 4YS8A 3R2WA 3CKVA 2AESA 1G8OA 1QG8A 2E3DA 5C48A 2VSIA 2WEEA 4FCUA 1H3MA 3V0OA 1FO9A 2XWMA 1ZJ3A 1VH1A 1WT1A 2Z86A 1O7QA 1PZTA 1YP2A 3SXEA 1GQ9A 2VS3A 1WT3A 2X5ZA 2J0AA 2JCJA 5AJPA 2JCKA 1G97A 3PNNA 5CQMX 1QWJA 1H7EA 3CGXA 1VZTA 1INJA 1FWYA 3U2XA 4HO9A 1LZ0A 1KWSA 5C4FA 5EJ1A 2RJ0A 1MC3A 4HOCA 4IRQA 3T7MA 2WVMA 1VH3A 3U0XA 3V0QA 5CMHA 3GUEA 3V91A 3V0PA 1GWWA 4MIXA 3V8YA
chains in the Genus database with same CATH topology
3I0GA 2AGDA 3V90A 1H5RB 2YQJA 1LZJA 3CKOA 5AJNA 3JUJA 2VFZA 1H7TA 5CQOA 4M4KA 1JVGA 3OKRA 1FR8A 3OH1A 2V0HA 2RIYA 1H7QA 2VS5A 2AM4A 1W77A 2GGQA 5L6VA 4Y6UA 5FYEA 1VPAA 2BO6A 4DECA 2QKXA 5CQLX 3I0JA 5D91A 2JCLA 1JV3A 1VGWA 1NWGB 4NALA 4D0ZA 2BO4A 5D92A 1H4EA 3FOQA 2O1FA 1ZJ2A 2P6WA 3BCVA 3I0FA 3IOHA 1VZUA 3Q4SA 4HO8A 4KXOA 5DDVA 1MP3A 1LVWA 5FV9A 2OI5A 2RJ1A 3N9WA 4EE3A 2RJ9A 3ZGFA 2P73A 5FTSA 4ARWA 4FRQA 1IINA 2E8BA 3V0LA 4Y62A 1S4OA 1MP5A 3USRA 4G3PA 2OEFA 4JD0A 3I0IX 2XMEA 4MYBA 3SXBA 1H5SA 4FCEA 1WSZA 3T7OA 1FR9A 4L41C 5C38A 1JYKA 2ICYA 4HO6A 1FOAA 3IOIA 1W57A 2GGOA 5I1FA 2AE7A 5FUHA 3USQA 4LW6A 2VD4A 4P00A 4E1KA 3R3IA 1R82A 1ON6A 2WAWA 4KC4A 4AAWA 2DPWA 4CVHA 3RMWA 3SX8A 2WGZA 1ZI3A 1HM9A 3ZLKA 2P72A 5C49A 1LZIA 5CQPA 1HV9A 1VGUA 3OC9A 4FRLA 5C47A 2A8WA 2FFUA 4Y63A 4ZDQA 3F1CA 4FRPA 4HO0A 3DJ4A 3O3PA 1MP4A 3HL3A 3I0DA 4XWIA 4D11C 1INIA 2PX7A 2RITA 3ZF8A 1G0RA 2WVLA 1H5TA 4EEAA 5C4CA 2YC5A 1E5KA 4HO2A 2ICXA 2O1GA 2A8UA 2Z87A 3LW6A 3POLA 4R7PA 1VZXA 2PGYA 4FRBA 4FRDA 2CU2A 5CMFX 1R81A 2FY7A 3TZTA 1TW5A 2X60A 2X5SA 3OAMA 1W55A 4HO4A 2W0VA 1GX0A 2Q4JA 2I5KA 5C8RA 3CU0A 1ZJ0A 5IDSA 2ZU8A 4DE7A 1R7YA 3OH0A 3Q80A 1ZCVA 4B2WA 2PA4A 2XWLA 4G3SA 2I7BA 2FFVA 2Y4LA 1ZI5A 1H5SD 1FRWA 4Y7UA 3RSBA 1TZFA 1FO8A 3ST8A 1V84A 2RIZA 4NAIA 3EE5A 5C3AA 1H4CA 1H5RA 2Y7AA 4ASJA 1WVCA 2YQHA 3I0EA 4JISA 4Y7TA 1V82A 1YP3A 3OH2A 4K6RA 4FRMA 2I5EA 4EEOA 1S4PA 2YQSA 3OGZA 4FRHA 2RJ8A 2Y4MA 4O6MA 4FROA 1TVYA 1VICA 1ZCYA 4M2BA 4KQLA 3U2VA 2D0JA 1OMZA 1XZ6A 4HO5A 4Y6NA 1H4DA 3U2UA 1NF5B 1YROB 1JVDA 2V0IA 4KNXA 1G95A 2ZU9A 4Y7FA 1ZHJA 1ZCTA 4AC3A 2VK9A 4GBPA 4CJ8A 1VGTA 3OH3A 4M28A 4Y9XA 5IFYA 4CJBA 4FQWA 2QGIA 3E26A 4UEGA 1EYRA 4DDZA 1H7FA 2AM5A 1HM0A 1FXJA 1PZYB 1V83A 4AYLA 4BMAA 3PKQA 1JV1A 2YQCA 5CMIA 4C2SA 3ZLLA 1R7UA 2RIXA 2WE9A 2YCMA 4G3QA 4Y64A 3SX5A 2QH5A 2V0LA 5EIYA 5FU0A 4FIYA 5C4DA 2FYBA 1SS9A 4EVWA 2C0NA 1ON8A 5C3DA 2BO7A 5DDTA 3PKPA 2JCOA 4B5BA 2AH9A 1FXOA 1LL0A 2XWNA 4KPZA 3SX3A 5HS2A 1XHBA 2MZBA 1HJLA 4G87A 2V0KA 4D11A 5JQQA 1LZ7A 4LW3A 1JYLA 5C1GA 2RJ5A 1NHEB 5C1LA 4EE5A 4KNRA 3D98A 3U2WA 3SXDA 2VS4A 5C4BA 4EEGA 2RJ6A 3U2TA 4FIXA 5CMGX 1R7VA 4B3UA 3SX7A 3TQDA 1IIMA 5AJOA 4NAKA 2OI6A 4IRPA 4FRAA 4B2XA 4CJCA 5J49A 2W0WA 1I52A 5IDTA 1QGQA 1GWVA 1H7GA 3SXAA 3D8VA 5EJZA 4FREA 4KC1A 4B4MA 4KT7A 5C4EA 4HG6A 4O6NA 3V8ZA 3QVBA 1ZCUA 3IOJA 4M2AA 3CKQA 1GA8A 2FYAA 1G23A 1YP4A 2OEGA 1ZJPA 2BO8A 1R7XA 3I0KA 5C36A 3ZGGA 1ZDFA 1NMMB 3I0HA 4D0TA 1H7LA 3KIAA 1VM8A 4HO3A 4D48A 1FGGA 3SXGA 1TW1A 3I0CA 5CMJA 3K8DA 2D7RA 4Y7VA 5L6SA 1S4NA 2J0BA 3T7NA 1K4VA 5FTVA 3CKNA 2FYDB 1ZJ1A 5C3BA 2Y4JA 3NGWA 3OH4A 1ZDGA 1WT2A 1O0RA 2FYCB 3V0MA 4B42A 4Q7CA 1ZI4A 1ZI1A 1ZIZA 3Q7UA 1GX4A 1G1LA 4ECMA 3K8EA 4KPXA 1WT0A 5C1HA 2RJ4A 1NQIB 4ASYA 2RJ7A 1G9RA 1H7HA 2YESA 1FG5N 4B4GA 1EZIA 2OI7A 3RMVA 4AYJA 4EEMA 4HCQA 2VXLA 3JUKA 1ZJOA 3JTJA 2AECA 4MNDA 1R80A 2VSHA 3F1YA 1H5SB 1Z90A 4P02A 2AM3A 1G2VA 3BRKX 3V0NA 3DUVA 2XMHA 4EE4A 4J18A 4KRVA 5BXCA 3I0LA 5CQNX 3E25A 3SXCA 3DK5A 2YC3A 1LL2A 2UX8A 1G93A 1QGSA 4NANA 2O1HA 1FZWA 2WVKA 5FU8A 1H5SC 1O23B 1LL3A 4KC2A 1HJJA 2V0JA 2NXVA 2Y4KA 1G3LA 1HM8A 1OMXA 3FWWA 4BQHA 1O7OA 2ZU7A 3U0YA 1NKHB 2PGVA 1OQMB 3CKJA 2X65A 2VXMA 2D7IA 4Y7GA 3SPTA 1R7TA 2Y6PA 1GQCA 1H5TB 1VGZA 1FGXA 3D5NA 4B4BA 2APCA 4YS8A 3R2WA 3CKVA 2AESA 1G8OA 1QG8A 2E3DA 5C48A 2VSIA 2WEEA 4FCUA 1H3MA 3V0OA 1FO9A 2XWMA 1ZJ3A 1VH1A 1WT1A 2Z86A 1O7QA 1PZTA 1YP2A 3SXEA 1GQ9A 2VS3A 1WT3A 2X5ZA 2J0AA 2JCJA 5AJPA 2JCKA 1G97A 3PNNA 5CQMX 1QWJA 1H7EA 3CGXA 1VZTA 1INJA 1FWYA 3U2XA 4HO9A 1LZ0A 1KWSA 5C4FA 5EJ1A 2RJ0A 1MC3A 4HOCA 4IRQA 3T7MA 2WVMA 1VH3A 3U0XA 3V0QA 5CMHA 3GUEA 3V91A 3V0PA 1GWWA 4MIXA 3V8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0G A;  2AGD A;  3V90 A;  1H5R B;  2YQJ A;  1LZJ A;  3CKO A;  5AJN A;  3JUJ A;  2VFZ A;  1H7T A;  5CQO A;  4M4K A;  1JVG A;  3OKR A;  1FR8 A;  3OH1 A;  2V0H A;  2RIY A;  1H7Q A;  2VS5 A;  2AM4 A;  1W77 A;  2GGQ A;  5L6V A;  4Y6U A;  5FYE A;  1VPA A;  2BO6 A;  4DEC A;  2QKX A;  5CQL X;  3I0J A;  2JCL A;  1JV3 A;  1VGW A;  1NWG B;  4NAL A;  4D0Z A;  2BO4 A;  1H4E A;  3FOQ A;  2O1F A;  1ZJ2 A;  2P6W A;  3BCV A;  3I0F A;  3IOH A;  1VZU A;  3Q4S A;  4HO8 A;  4KXO A;  5DDV A;  1MP3 A;  1LVW A;  5FV9 A;  2OI5 A;  2RJ1 A;  3N9W A;  4EE3 A;  2RJ9 A;  3ZGF A;  2P73 A;  5FTS A;  4ARW A;  4FRQ A;  1IIN A;  2E8B A;  3V0L A;  4Y62 A;  1S4O A;  1MP5 A;  3USR A;  4G3P A;  2OEF A;  4JD0 A;  3I0I X;  2XME A;  4MYB A;  3SXB A;  1H5S A;  4FCE A;  1WSZ A;  3T7O A;  1FR9 A;  4L41 C;  5C38 A;  1JYK A;  2ICY A;  4HO6 A;  1FOA A;  3IOI A;  1W57 A;  2GGO A;  5I1F A;  2AE7 A;  5FUH A;  3USQ A;  4LW6 A;  2VD4 A;  4P00 A;  4E1K A;  3R3I A;  1R82 A;  1ON6 A;  2WAW A;  4KC4 A;  4AAW A;  2DPW A;  4CVH A;  3RMW A;  3SX8 A;  2WGZ A;  1ZI3 A;  1HM9 A;  3ZLK A;  2P72 A;  5C49 A;  1LZI A;  5CQP A;  1HV9 A;  1VGU A;  3OC9 A;  4FRL A;  5C47 A;  2A8W A;  2FFU A;  4Y63 A;  4ZDQ A;  3F1C A;  4FRP A;  4HO0 A;  3DJ4 A;  3O3P A;  1MP4 A;  3HL3 A;  3I0D A;  4XWI A;  4D11 C;  1INI A;  2PX7 A;  2RIT A;  3ZF8 A;  1G0R A;  2WVL A;  1H5T A;  4EEA A;  5C4C A;  2YC5 A;  1E5K A;  4HO2 A;  2ICX A;  2O1G A;  2A8U A;  2Z87 A;  3LW6 A;  3POL A;  4R7P A;  1VZX A;  2PGY A;  4FRB A;  4FRD A;  2CU2 A;  5CMF X;  1R81 A;  2FY7 A;  3TZT A;  1TW5 A;  2X60 A;  2X5S A;  3OAM A;  1W55 A;  4HO4 A;  2W0V A;  1GX0 A;  2Q4J A;  2I5K A;  5C8R A;  3CU0 A;  1ZJ0 A;  5IDS A;  2ZU8 A;  4DE7 A;  1R7Y A;  3OH0 A;  3Q80 A;  1ZCV A;  4B2W A;  2PA4 A;  2XWL A;  4G3S A;  2I7B A;  2FFV A;  2Y4L A;  1ZI5 A;  1H5S D;  1FRW A;  4Y7U A;  3RSB A;  1TZF A;  1FO8 A;  3ST8 A;  1V84 A;  2RIZ A;  4NAI A;  3EE5 A;  5C3A A;  1H4C A;  1H5R A;  2Y7A A;  4ASJ A;  1WVC A;  2YQH A;  3I0E A;  4JIS A;  4Y7T A;  1V82 A;  1YP3 A;  3OH2 A;  4K6R A;  4FRM A;  2I5E A;  4EEO A;  1S4P A;  2YQS A;  3OGZ A;  4FRH A;  2RJ8 A;  2Y4M A;  4FRO A;  1TVY A;  1VIC A;  1ZCY A;  4M2B A;  4KQL A;  3U2V A;  2D0J A;  1OMZ A;  1XZ6 A;  4HO5 A;  4Y6N A;  1H4D A;  3U2U A;  1NF5 B;  1YRO B;  1JVD A;  2V0I A;  4KNX A;  1G95 A;  2ZU9 A;  4Y7F A;  1ZHJ A;  1ZCT A;  4AC3 A;  4GBP A;  4CJ8 A;  1VGT A;  3OH3 A;  4M28 A;  4Y9X A;  5IFY A;  4CJB A;  4FQW A;  2QGI A;  3E26 A;  4UEG A;  1EYR A;  4DDZ A;  1H7F A;  2AM5 A;  1HM0 A;  1FXJ A;  1PZY B;  1V83 A;  4AYL A;  4BMA A;  3PKQ A;  1JV1 A;  2YQC A;  5CMI A;  4C2S A;  3ZLL A;  1R7U A;  2RIX A;  2WE9 A;  2YCM A;  4G3Q A;  4Y64 A;  3SX5 A;  2QH5 A;  2V0L A;  5EIY A;  5FU0 A;  5C4D A;  2FYB A;  1SS9 A;  4EVW A;  1ON8 A;  5C3D A;  2BO7 A;  5DDT A;  3PKP A;  2JCO A;  4B5B A;  2AH9 A;  1FXO A;  1LL0 A;  2XWN A;  4KPZ A;  3SX3 A;  5HS2 A;  1XHB A;  2MZB A;  1HJL A;  4G87 A;  2V0K A;  4D11 A;  5JQQ A;  1LZ7 A;  4LW3 A;  1JYL A;  5C1G A;  2RJ5 A;  1NHE B;  5C1L A;  4EE5 A;  4KNR A;  3D98 A;  3U2W A;  3SXD A;  2VS4 A;  5C4B A;  4EEG A;  2RJ6 A;  3U2T A;  5CMG X;  1R7V A;  4B3U A;  3SX7 A;  3TQD A;  1IIM A;  5AJO A;  4NAK A;  2OI6 A;  4IRP A;  4FRA A;  4B2X A;  4CJC A;  5J49 A;  2W0W A;  1I52 A;  5IDT A;  1QGQ A;  1GWV A;  1H7G A;  3SXA A;  3D8V A;  5EJZ A;  4FRE A;  4KC1 A;  4B4M A;  4KT7 A;  5C4E A;  4HG6 A;  3V8Z A;  3QVB A;  1ZCU A;  3IOJ A;  4M2A A;  1GA8 A;  3CKQ A;  2FYA A;  1G23 A;  1YP4 A;  2OEG A;  1ZJP A;  2BO8 A;  1R7X A;  3I0K A;  5C36 A;  3ZGG A;  1ZDF A;  1NMM B;  3I0H A;  4D0T A;  1H7L A;  3KIA A;  1VM8 A;  4HO3 A;  4D48 A;  1FGG A;  3SXG A;  1TW1 A;  3I0C A;  5CMJ A;  3K8D A;  2D7R A;  4Y7V A;  5L6S A;  1S4N A;  3T7N A;  1K4V A;  5FTV A;  3CKN A;  2FYD B;  1ZJ1 A;  5C3B A;  2Y4J A;  3NGW A;  3OH4 A;  1ZDG A;  1WT2 A;  1O0R A;  2FYC B;  3V0M A;  4B42 A;  1ZI4 A;  1ZI1 A;  1ZIZ A;  3Q7U A;  1GX4 A;  1G1L A;  4ECM A;  3K8E A;  4KPX A;  1WT0 A;  5C1H A;  2RJ4 A;  1NQI B;  4ASY A;  2RJ7 A;  1G9R A;  1H7H A;  2YES A;  1FG5 N;  4B4G A;  1EZI A;  2OI7 A;  3RMV A;  4AYJ A;  4EEM A;  4HCQ A;  2VXL A;  3JUK A;  1ZJO A;  3JTJ A;  2AEC A;  4MND A;  1R80 A;  2VSH A;  3F1Y A;  1H5S B;  1Z90 A;  4P02 A;  2AM3 A;  1G2V A;  3BRK X;  3V0N A;  3DUV A;  2XMH A;  4EE4 A;  4J18 A;  4KRV A;  5BXC A;  3I0L A;  5CQN X;  3E25 A;  3SXC A;  3DK5 A;  2YC3 A;  1LL2 A;  2UX8 A;  1G93 A;  1QGS A;  4NAN A;  2O1H A;  1FZW A;  2WVK A;  5FU8 A;  1H5S C;  1O23 B;  1LL3 A;  4KC2 A;  1HJJ A;  2V0J A;  2NXV A;  2Y4K A;  1G3L A;  1HM8 A;  1OMX A;  3FWW A;  4BQH A;  1O7O A;  2ZU7 A;  3U0Y A;  1NKH B;  2PGV A;  1OQM B;  3CKJ A;  2X65 A;  2VXM A;  2D7I A;  4Y7G A;  3SPT A;  1R7T A;  2Y6P A;  1GQC A;  1H5T B;  1VGZ A;  1FGX A;  3D5N A;  4B4B A;  2APC A;  4YS8 A;  3R2W A;  3CKV A;  2AES A;  1G8O A;  1QG8 A;  2E3D A;  5C48 A;  2VSI A;  2WEE A;  4FCU A;  1H3M A;  3V0O A;  1FO9 A;  2XWM A;  1ZJ3 A;  1VH1 A;  1WT1 A;  2Z86 A;  1O7Q A;  1PZT A;  1YP2 A;  3SXE A;  1GQ9 A;  2VS3 A;  1WT3 A;  2X5Z A;  2JCJ A;  5AJP A;  2JCK A;  1G97 A;  3PNN A;  5CQM X;  1QWJ A;  1H7E A;  3CGX A;  1VZT A;  1INJ A;  1FWY A;  3U2X A;  4HO9 A;  1LZ0 A;  1KWS A;  5C4F A;  5EJ1 A;  2RJ0 A;  1MC3 A;  4HOC A;  4IRQ A;  3T7M A;  2WVM A;  1VH3 A;  3U0X A;  3V0Q A;  5CMH A;  3GUE A;  3V91 A;  3V0P A;  1GWW A;  3V8Y A; 
#chains in the Genus database with same CATH topology
 3I0G A;  2AGD A;  3V90 A;  1H5R B;  2YQJ A;  1LZJ A;  3CKO A;  5AJN A;  3JUJ A;  2VFZ A;  1H7T A;  5CQO A;  4M4K A;  1JVG A;  3OKR A;  1FR8 A;  3OH1 A;  2V0H A;  2RIY A;  1H7Q A;  2VS5 A;  2AM4 A;  1W77 A;  2GGQ A;  5L6V A;  4Y6U A;  5FYE A;  1VPA A;  2BO6 A;  4DEC A;  2QKX A;  5CQL X;  3I0J A;  5D91 A;  2JCL A;  1JV3 A;  1VGW A;  1NWG B;  4NAL A;  4D0Z A;  2BO4 A;  5D92 A;  1H4E A;  3FOQ A;  2O1F A;  1ZJ2 A;  2P6W A;  3BCV A;  3I0F A;  3IOH A;  1VZU A;  3Q4S A;  4HO8 A;  4KXO A;  5DDV A;  1MP3 A;  1LVW A;  5FV9 A;  2OI5 A;  2RJ1 A;  3N9W A;  4EE3 A;  2RJ9 A;  3ZGF A;  2P73 A;  5FTS A;  4ARW A;  4FRQ A;  1IIN A;  2E8B A;  3V0L A;  4Y62 A;  1S4O A;  1MP5 A;  3USR A;  4G3P A;  2OEF A;  4JD0 A;  3I0I X;  2XME A;  4MYB A;  3SXB A;  1H5S A;  4FCE A;  1WSZ A;  3T7O A;  1FR9 A;  4L41 C;  5C38 A;  1JYK A;  2ICY A;  4HO6 A;  1FOA A;  3IOI A;  1W57 A;  2GGO A;  5I1F A;  2AE7 A;  5FUH A;  3USQ A;  4LW6 A;  2VD4 A;  4P00 A;  4E1K A;  3R3I A;  1R82 A;  1ON6 A;  2WAW A;  4KC4 A;  4AAW A;  2DPW A;  4CVH A;  3RMW A;  3SX8 A;  2WGZ A;  1ZI3 A;  1HM9 A;  3ZLK A;  2P72 A;  5C49 A;  1LZI A;  5CQP A;  1HV9 A;  1VGU A;  3OC9 A;  4FRL A;  5C47 A;  2A8W A;  2FFU A;  4Y63 A;  4ZDQ A;  3F1C A;  4FRP A;  4HO0 A;  3DJ4 A;  3O3P A;  1MP4 A;  3HL3 A;  3I0D A;  4XWI A;  4D11 C;  1INI A;  2PX7 A;  2RIT A;  3ZF8 A;  1G0R A;  2WVL A;  1H5T A;  4EEA A;  5C4C A;  2YC5 A;  1E5K A;  4HO2 A;  2ICX A;  2O1G A;  2A8U A;  2Z87 A;  3LW6 A;  3POL A;  4R7P A;  1VZX A;  2PGY A;  4FRB A;  4FRD A;  2CU2 A;  5CMF X;  1R81 A;  2FY7 A;  3TZT A;  1TW5 A;  2X60 A;  2X5S A;  3OAM A;  1W55 A;  4HO4 A;  2W0V A;  1GX0 A;  2Q4J A;  2I5K A;  5C8R A;  3CU0 A;  1ZJ0 A;  5IDS A;  2ZU8 A;  4DE7 A;  1R7Y A;  3OH0 A;  3Q80 A;  1ZCV A;  4B2W A;  2PA4 A;  2XWL A;  4G3S A;  2I7B A;  2FFV A;  2Y4L A;  1ZI5 A;  1H5S D;  1FRW A;  4Y7U A;  3RSB A;  1TZF A;  1FO8 A;  3ST8 A;  1V84 A;  2RIZ A;  4NAI A;  3EE5 A;  5C3A A;  1H4C A;  1H5R A;  2Y7A A;  4ASJ A;  1WVC A;  2YQH A;  3I0E A;  4JIS A;  4Y7T A;  1V82 A;  1YP3 A;  3OH2 A;  4K6R A;  4FRM A;  2I5E A;  4EEO A;  1S4P A;  2YQS A;  3OGZ A;  4FRH A;  2RJ8 A;  2Y4M A;  4O6M A;  4FRO A;  1TVY A;  1VIC A;  1ZCY A;  4M2B A;  4KQL A;  3U2V A;  2D0J A;  1OMZ A;  1XZ6 A;  4HO5 A;  4Y6N A;  1H4D A;  3U2U A;  1NF5 B;  1YRO B;  1JVD A;  2V0I A;  4KNX A;  1G95 A;  2ZU9 A;  4Y7F A;  1ZHJ A;  1ZCT A;  4AC3 A;  2VK9 A;  4GBP A;  4CJ8 A;  1VGT A;  3OH3 A;  4M28 A;  4Y9X A;  5IFY A;  4CJB A;  4FQW A;  2QGI A;  3E26 A;  4UEG A;  1EYR A;  4DDZ A;  1H7F A;  2AM5 A;  1HM0 A;  1FXJ A;  1PZY B;  1V83 A;  4AYL A;  4BMA A;  3PKQ A;  1JV1 A;  2YQC A;  5CMI A;  4C2S A;  3ZLL A;  1R7U A;  2RIX A;  2WE9 A;  2YCM A;  4G3Q A;  4Y64 A;  3SX5 A;  2QH5 A;  2V0L A;  5EIY A;  5FU0 A;  4FIY A;  5C4D A;  2FYB A;  1SS9 A;  4EVW A;  2C0N A;  1ON8 A;  5C3D A;  2BO7 A;  5DDT A;  3PKP A;  2JCO A;  4B5B A;  2AH9 A;  1FXO A;  1LL0 A;  2XWN A;  4KPZ A;  3SX3 A;  5HS2 A;  1XHB A;  2MZB A;  1HJL A;  4G87 A;  2V0K A;  4D11 A;  5JQQ A;  1LZ7 A;  4LW3 A;  1JYL A;  5C1G A;  2RJ5 A;  1NHE B;  5C1L A;  4EE5 A;  4KNR A;  3D98 A;  3U2W A;  3SXD A;  2VS4 A;  5C4B A;  4EEG A;  2RJ6 A;  3U2T A;  4FIX A;  5CMG X;  1R7V A;  4B3U A;  3SX7 A;  3TQD A;  1IIM A;  5AJO A;  4NAK A;  2OI6 A;  4IRP A;  4FRA A;  4B2X A;  4CJC A;  5J49 A;  2W0W A;  1I52 A;  5IDT A;  1QGQ A;  1GWV A;  1H7G A;  3SXA A;  3D8V A;  5EJZ A;  4FRE A;  4KC1 A;  4B4M A;  4KT7 A;  5C4E A;  4HG6 A;  4O6N A;  3V8Z A;  3QVB A;  1ZCU A;  3IOJ A;  4M2A A;  3CKQ A;  1GA8 A;  2FYA A;  1G23 A;  1YP4 A;  2OEG A;  1ZJP A;  2BO8 A;  1R7X A;  3I0K A;  5C36 A;  3ZGG A;  1ZDF A;  1NMM B;  3I0H A;  4D0T A;  1H7L A;  3KIA A;  1VM8 A;  4HO3 A;  4D48 A;  1FGG A;  3SXG A;  1TW1 A;  3I0C A;  5CMJ A;  3K8D A;  2D7R A;  4Y7V A;  5L6S A;  1S4N A;  2J0B A;  3T7N A;  1K4V A;  5FTV A;  3CKN A;  2FYD B;  1ZJ1 A;  5C3B A;  2Y4J A;  3NGW A;  3OH4 A;  1ZDG A;  1WT2 A;  1O0R A;  2FYC B;  3V0M A;  4B42 A;  4Q7C A;  1ZI4 A;  1ZI1 A;  1ZIZ A;  3Q7U A;  1GX4 A;  1G1L A;  4ECM A;  3K8E A;  4KPX A;  1WT0 A;  5C1H A;  2RJ4 A;  1NQI B;  4ASY A;  2RJ7 A;  1G9R A;  1H7H A;  2YES A;  1FG5 N;  4B4G A;  1EZI A;  2OI7 A;  3RMV A;  4AYJ A;  4EEM A;  4HCQ A;  2VXL A;  3JUK A;  1ZJO A;  3JTJ A;  2AEC A;  4MND A;  1R80 A;  2VSH A;  3F1Y A;  1H5S B;  1Z90 A;  4P02 A;  2AM3 A;  1G2V A;  3BRK X;  3V0N A;  3DUV A;  2XMH A;  4EE4 A;  4J18 A;  4KRV A;  5BXC A;  3I0L A;  5CQN X;  3E25 A;  3SXC A;  3DK5 A;  2YC3 A;  1LL2 A;  2UX8 A;  1G93 A;  1QGS A;  4NAN A;  2O1H A;  1FZW A;  2WVK A;  5FU8 A;  1H5S C;  1O23 B;  1LL3 A;  4KC2 A;  1HJJ A;  2V0J A;  2NXV A;  2Y4K A;  1G3L A;  1HM8 A;  1OMX A;  3FWW A;  4BQH A;  1O7O A;  2ZU7 A;  3U0Y A;  1NKH B;  2PGV A;  1OQM B;  3CKJ A;  2X65 A;  2VXM A;  2D7I A;  4Y7G A;  3SPT A;  1R7T A;  2Y6P A;  1GQC A;  1H5T B;  1VGZ A;  1FGX A;  3D5N A;  4B4B A;  2APC A;  4YS8 A;  3R2W A;  3CKV A;  2AES A;  1G8O A;  1QG8 A;  2E3D A;  5C48 A;  2VSI A;  2WEE A;  4FCU A;  1H3M A;  3V0O A;  1FO9 A;  2XWM A;  1ZJ3 A;  1VH1 A;  1WT1 A;  2Z86 A;  1O7Q A;  1PZT A;  1YP2 A;  3SXE A;  1GQ9 A;  2VS3 A;  1WT3 A;  2X5Z A;  2J0A A;  2JCJ A;  5AJP A;  2JCK A;  1G97 A;  3PNN A;  5CQM X;  1QWJ A;  1H7E A;  3CGX A;  1VZT A;  1INJ A;  1FWY A;  3U2X A;  4HO9 A;  1LZ0 A;  1KWS A;  5C4F A;  5EJ1 A;  2RJ0 A;  1MC3 A;  4HOC A;  4IRQ A;  3T7M A;  2WVM A;  1VH3 A;  3U0X A;  3V0Q A;  5CMH A;  3GUE A;  3V91 A;  3V0P A;  1GWW A;  4MIX A;  3V8Y A; 
#chains in the Genus database with same CATH homology
 3I0G A;  2AGD A;  3V90 A;  1H5R B;  2YQJ A;  1LZJ A;  3CKO A;  5AJN A;  3JUJ A;  2VFZ A;  1H7T A;  5CQO A;  4M4K A;  1JVG A;  3OKR A;  1FR8 A;  3OH1 A;  2V0H A;  2RIY A;  1H7Q A;  2VS5 A;  2AM4 A;  1W77 A;  2GGQ A;  5L6V A;  4Y6U A;  5FYE A;  1VPA A;  2BO6 A;  4DEC A;  2QKX A;  5CQL X;  3I0J A;  5D91 A;  2JCL A;  1JV3 A;  1VGW A;  1NWG B;  4NAL A;  4D0Z A;  2BO4 A;  5D92 A;  1H4E A;  3FOQ A;  2O1F A;  1ZJ2 A;  2P6W A;  3BCV A;  3I0F A;  3IOH A;  1VZU A;  3Q4S A;  4HO8 A;  4KXO A;  5DDV A;  1MP3 A;  1LVW A;  5FV9 A;  2OI5 A;  2RJ1 A;  3N9W A;  4EE3 A;  2RJ9 A;  3ZGF A;  2P73 A;  5FTS A;  4ARW A;  4FRQ A;  1IIN A;  2E8B A;  3V0L A;  4Y62 A;  1S4O A;  1MP5 A;  3USR A;  4G3P A;  2OEF A;  4JD0 A;  3I0I X;  2XME A;  4MYB A;  3SXB A;  1H5S A;  4FCE A;  1WSZ A;  3T7O A;  1FR9 A;  4L41 C;  5C38 A;  1JYK A;  2ICY A;  4HO6 A;  1FOA A;  3IOI A;  1W57 A;  2GGO A;  5I1F A;  2AE7 A;  5FUH A;  3USQ A;  4LW6 A;  2VD4 A;  4P00 A;  4E1K A;  3R3I A;  1R82 A;  1ON6 A;  2WAW A;  4KC4 A;  4AAW A;  2DPW A;  4CVH A;  3RMW A;  3SX8 A;  2WGZ A;  1ZI3 A;  1HM9 A;  3ZLK A;  2P72 A;  5C49 A;  1LZI A;  5CQP A;  1HV9 A;  1VGU A;  3OC9 A;  4FRL A;  5C47 A;  2A8W A;  2FFU A;  4Y63 A;  4ZDQ A;  3F1C A;  4FRP A;  4HO0 A;  3DJ4 A;  3O3P A;  1MP4 A;  3HL3 A;  3I0D A;  4XWI A;  4D11 C;  1INI A;  2PX7 A;  2RIT A;  3ZF8 A;  1G0R A;  2WVL A;  1H5T A;  4EEA A;  5C4C A;  2YC5 A;  1E5K A;  4HO2 A;  2ICX A;  2O1G A;  2A8U A;  2Z87 A;  3LW6 A;  3POL A;  4R7P A;  1VZX A;  2PGY A;  4FRB A;  4FRD A;  2CU2 A;  5CMF X;  1R81 A;  2FY7 A;  3TZT A;  1TW5 A;  2X60 A;  2X5S A;  3OAM A;  1W55 A;  4HO4 A;  2W0V A;  1GX0 A;  2Q4J A;  2I5K A;  5C8R A;  3CU0 A;  1ZJ0 A;  5IDS A;  2ZU8 A;  4DE7 A;  1R7Y A;  3OH0 A;  3Q80 A;  1ZCV A;  4B2W A;  2PA4 A;  2XWL A;  4G3S A;  2I7B A;  2FFV A;  2Y4L A;  1ZI5 A;  1H5S D;  1FRW A;  4Y7U A;  3RSB A;  1TZF A;  1FO8 A;  3ST8 A;  1V84 A;  2RIZ A;  4NAI A;  3EE5 A;  5C3A A;  1H4C A;  1H5R A;  2Y7A A;  4ASJ A;  1WVC A;  2YQH A;  3I0E A;  4JIS A;  4Y7T A;  1V82 A;  1YP3 A;  3OH2 A;  4K6R A;  4FRM A;  2I5E A;  4EEO A;  1S4P A;  2YQS A;  3OGZ A;  4FRH A;  2RJ8 A;  2Y4M A;  4O6M A;  4FRO A;  1TVY A;  1VIC A;  1ZCY A;  4M2B A;  4KQL A;  3U2V A;  2D0J A;  1OMZ A;  1XZ6 A;  4HO5 A;  4Y6N A;  1H4D A;  3U2U A;  1NF5 B;  1YRO B;  1JVD A;  2V0I A;  4KNX A;  1G95 A;  2ZU9 A;  4Y7F A;  1ZHJ A;  1ZCT A;  4AC3 A;  2VK9 A;  4GBP A;  4CJ8 A;  1VGT A;  3OH3 A;  4M28 A;  4Y9X A;  5IFY A;  4CJB A;  4FQW A;  2QGI A;  3E26 A;  4UEG A;  1EYR A;  4DDZ A;  1H7F A;  2AM5 A;  1HM0 A;  1FXJ A;  1PZY B;  1V83 A;  4AYL A;  4BMA A;  3PKQ A;  1JV1 A;  2YQC A;  5CMI A;  4C2S A;  3ZLL A;  1R7U A;  2RIX A;  2WE9 A;  2YCM A;  4G3Q A;  4Y64 A;  3SX5 A;  2QH5 A;  2V0L A;  5EIY A;  5FU0 A;  4FIY A;  5C4D A;  2FYB A;  1SS9 A;  4EVW A;  2C0N A;  1ON8 A;  5C3D A;  2BO7 A;  5DDT A;  3PKP A;  2JCO A;  4B5B A;  2AH9 A;  1FXO A;  1LL0 A;  2XWN A;  4KPZ A;  3SX3 A;  5HS2 A;  1XHB A;  2MZB A;  1HJL A;  4G87 A;  2V0K A;  4D11 A;  5JQQ A;  1LZ7 A;  4LW3 A;  1JYL A;  5C1G A;  2RJ5 A;  1NHE B;  5C1L A;  4EE5 A;  4KNR A;  3D98 A;  3U2W A;  3SXD A;  2VS4 A;  5C4B A;  4EEG A;  2RJ6 A;  3U2T A;  4FIX A;  5CMG X;  1R7V A;  4B3U A;  3SX7 A;  3TQD A;  1IIM A;  5AJO A;  4NAK A;  2OI6 A;  4IRP A;  4FRA A;  4B2X A;  4CJC A;  5J49 A;  2W0W A;  1I52 A;  5IDT A;  1QGQ A;  1GWV A;  1H7G A;  3SXA A;  3D8V A;  5EJZ A;  4FRE A;  4KC1 A;  4B4M A;  4KT7 A;  5C4E A;  4HG6 A;  4O6N A;  3V8Z A;  3QVB A;  1ZCU A;  3IOJ A;  4M2A A;  3CKQ A;  1GA8 A;  2FYA A;  1G23 A;  1YP4 A;  2OEG A;  1ZJP A;  2BO8 A;  1R7X A;  3I0K A;  5C36 A;  3ZGG A;  1ZDF A;  1NMM B;  3I0H A;  4D0T A;  1H7L A;  3KIA A;  1VM8 A;  4HO3 A;  4D48 A;  1FGG A;  3SXG A;  1TW1 A;  3I0C A;  5CMJ A;  3K8D A;  2D7R A;  4Y7V A;  5L6S A;  1S4N A;  2J0B A;  3T7N A;  1K4V A;  5FTV A;  3CKN A;  2FYD B;  1ZJ1 A;  5C3B A;  2Y4J A;  3NGW A;  3OH4 A;  1ZDG A;  1WT2 A;  1O0R A;  2FYC B;  3V0M A;  4B42 A;  4Q7C A;  1ZI4 A;  1ZI1 A;  1ZIZ A;  3Q7U A;  1GX4 A;  1G1L A;  4ECM A;  3K8E A;  4KPX A;  1WT0 A;  5C1H A;  2RJ4 A;  1NQI B;  4ASY A;  2RJ7 A;  1G9R A;  1H7H A;  2YES A;  1FG5 N;  4B4G A;  1EZI A;  2OI7 A;  3RMV A;  4AYJ A;  4EEM A;  4HCQ A;  2VXL A;  3JUK A;  1ZJO A;  3JTJ A;  2AEC A;  4MND A;  1R80 A;  2VSH A;  3F1Y A;  1H5S B;  1Z90 A;  4P02 A;  2AM3 A;  1G2V A;  3BRK X;  3V0N A;  3DUV A;  2XMH A;  4EE4 A;  4J18 A;  4KRV A;  5BXC A;  3I0L A;  5CQN X;  3E25 A;  3SXC A;  3DK5 A;  2YC3 A;  1LL2 A;  2UX8 A;  1G93 A;  1QGS A;  4NAN A;  2O1H A;  1FZW A;  2WVK A;  5FU8 A;  1H5S C;  1O23 B;  1LL3 A;  4KC2 A;  1HJJ A;  2V0J A;  2NXV A;  2Y4K A;  1G3L A;  1HM8 A;  1OMX A;  3FWW A;  4BQH A;  1O7O A;  2ZU7 A;  3U0Y A;  1NKH B;  2PGV A;  1OQM B;  3CKJ A;  2X65 A;  2VXM A;  2D7I A;  4Y7G A;  3SPT A;  1R7T A;  2Y6P A;  1GQC A;  1H5T B;  1VGZ A;  1FGX A;  3D5N A;  4B4B A;  2APC A;  4YS8 A;  3R2W A;  3CKV A;  2AES A;  1G8O A;  1QG8 A;  2E3D A;  5C48 A;  2VSI A;  2WEE A;  4FCU A;  1H3M A;  3V0O A;  1FO9 A;  2XWM A;  1ZJ3 A;  1VH1 A;  1WT1 A;  2Z86 A;  1O7Q A;  1PZT A;  1YP2 A;  3SXE A;  1GQ9 A;  2VS3 A;  1WT3 A;  2X5Z A;  2J0A A;  2JCJ A;  5AJP A;  2JCK A;  1G97 A;  3PNN A;  5CQM X;  1QWJ A;  1H7E A;  3CGX A;  1VZT A;  1INJ A;  1FWY A;  3U2X A;  4HO9 A;  1LZ0 A;  1KWS A;  5C4F A;  5EJ1 A;  2RJ0 A;  1MC3 A;  4HOC A;  4IRQ A;  3T7M A;  2WVM A;  1VH3 A;  3U0X A;  3V0Q A;  5CMH A;  3GUE A;  3V91 A;  3V0P A;  1GWW A;  4MIX A;  3V8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...