3U2WA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and glucose or a glucal species
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
262
structure length
262
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2wA00
1O7QA 3TZTA 4BQHA 2Z86A 2FYBA 2AM5A 1IIMA 5C4EA 3V0LA 1ZJ3A 2I5KA 2V0IA 3I0FA 1H5TB 2W0VA 3SXBA 3U2WA 1FR8A 5AJPA 4EVWA 4FROA 1R7YA 3FOQA 4FQWA 5IFYA 2ZU8A 3OKRA 3OC9A 4AYJA 2PGVA 1TVYA 1YP3A 1OQMB 3CU0A 4J18A 5C8RA 1ZJ0A 1EYRA 2VFZA 4EEOA 1XHBA 5C4BA 1VGWA 4CJCA 5DDTA 4LW3A 1JVGA 3ZLLA 3E26A 1ZJOA 1GQCA 4G3PA 2XMHA 4UEGA 2JCKA 3CKVA 5J49A 2RJ0A 1G9RA 3U2XA 5HS2A 3EE5A 1QWJA 2O1GA 1WT3A 1JV3A 2RITA 4Y64A 1GWVA 5L6SA 3DK5A 2RIYA 2RIXA 4KC1A 3SXCA 1GQ9A 3CKOA 4Y7FA 1ZCVA 3BCVA 4M28A 2D7RA 1H4DA 4EEGA 1NHEB 3CGXA 2QGIA 3HL3A 1G97A 1O7OA 2QKXA 4FRQA 4YS8A 2FYCB 2WVKA 3I0DA 5C3DA 3SXDA 1MP3A 3GUEA 4Y7TA 1HJLA 4FCUA 1NWGB 2AGDA 2RJ8A 5BXCA 2PGYA 4E1KA 1ZCYA 4KPXA 3JTJA 1JYKA 2V0JA 3O3PA 5CMJA 5C1LA 1VH3A 1SS9A 2O1HA 2NXVA 5CMGX 1LZJA 3U0XA 4B5BA 1VZXA 5CMFX 5I1FA 1VZUA 1FR9A 1GA8A 5FU8A 3K8EA 4HO0A 4Y62A 2DPWA 2FFVA 3U0YA 5EJ1A 1GWWA 5C1GA 5C4DA 1ZI1A 5CQMX 2YQSA 2JCJA 2ZU7A 1FO9A 3I0IX 4NAIA 3V8YA 2OI7A 3BRKX 4NAKA 2W0WA 1H5SD 1YP2A 2I7BA 4XWIA 4NANA 2WGZA 1ZDGA 5C3BA 2OEFA 1G1LA 3NGWA 4R7PA 2XWNA 1H5TA 2VXMA 5CQLX 1H4CA 1R7VA 4NALA 1FWYA 3V0OA 1LL2A 1OMZA 3I0HA 5CQPA 2ICYA 1H7FA 2FFUA 3I0GA 1LVWA 5CQNX 5C49A 1LL0A 2A8UA 2AM3A 4HO5A 1G8OA 1H7TA 1O0RA 5FU0A 1FO8A 2RJ9A 1WSZA 2YESA 1NF5B 1R7UA 3Q80A 2Y7AA 1ZI4A 3D98A 1QGQA 3SX3A 4AC3A 3IOIA 1JVDA 4MYBA 2UX8A 2CU2A 3OH0A 4KT7A 1H7EA 1I52A 1W57A 4P00A 1ZJ1A 2P73A 2RJ7A 4IRPA 2RIZA 4KXOA 4Y7VA 1YP4A 4M2AA 2RJ6A 4AYLA 4B4GA 3RSBA 1VZTA 4Y9XA 1G95A 1S4PA 1LL3A 2WVMA 4FRLA 2RJ1A 3RMVA 2WEEA 4CVHA 4D11C 3U2TA 4HO9A 3OH1A 4JISA 1FGGA 1HJJA 3Q4SA 5C3AA 1FGXA 2QH5A 4DDZA 3IOHA 2Y4JA 3KIAA 1NQIB 1V83A 2WVLA 3SX5A 2X5ZA 1XZ6A 4D0TA 3I0LA 2VS4A 4M2BA 2Z87A 4FRHA 1MC3A 3DUVA 1FXOA 2RJ5A 2X65A 4HOCA 1JYLA 3V0QA 1VM8A 4D48A 3V8ZA 5C36A 3CKNA 1ZCUA 1ZI3A 1ON8A 1FG5N 3U2VA 3CKQA 2VSIA 1TZFA 5AJOA 4B3UA 3JUKA 4C2SA 1ZI5A 3F1YA 5IDSA 3LW6A 1G3LA 2VXLA 1G2VA 4FRDA 4B2XA 2BO8A 3SXGA 2YCMA 3SXEA 3I0JA 4B4BA 2D0JA 3R2WA 2V0KA 4EEMA 1WT1A 2APCA 3V0NA 1H5RA 1ZJPA 4KC2A 3PKQA 2AH9A 5FYEA 4FRBA 2YQHA 3ST8A 3OH4A 1H7GA 1WT0A 4FRMA 2AE7A 2FY7A 1NMMB 2VD4A 1H5RB 2O1FA 4KRVA 5L6VA 5IDTA 3USQA 4HO6A 5AJNA 5C1HA 3OGZA 1O23B 1VPAA 2P6WA 2OI6A 1ZDFA 2JCOA 1V84A 1ZCTA 1E5KA 4EE5A 1PZYB 1PZTA 4FCEA 1H7LA 4FREA 4D11A 4CJBA 2GGOA 3SXAA 4HCQA 2P72A 1INIA 1NKHB 1MP5A 1LZ7A 2XWLA 4BMAA 3N9WA 2YC3A 3RMWA 1H5SC 4Y7GA 5JQQA 1S4OA 4KNRA 4HO4A 2YC5A 1GX0A 1G23A 1QG8A 5CMHA 1JV1A 4ASYA 1W77A 1R80A 3JUJA 3OH2A 4KQLA 4Y63A 1R81A 5C4FA 3D8VA 1HV9A 3R3IA 1VH1A 2AESA 4G3SA 4Y6UA 4CJ8A 5FTVA 1HM0A 1HM9A 1G0RA 3I0EA 4B2WA 3OAMA 5EJZA 3F1CA 2Y4KA 1ZIZA 4IRQA 5DDVA 2PA4A 2V0LA 3SX7A 2RJ4A 3TQDA 3CKJA 4FRAA 3ZGFA 1H7QA 1H7HA 3V0MA 3QVBA 4ECMA 1WT2A 1ZJ2A 2Q4JA 2E3DA 3ZLKA 1R7XA 2OI5A 2WE9A 3PKPA 1LZ0A 3ZF8A 3E25A 3PNNA 3T7MA 1VGUA 1VGZA 1WVCA 4D0ZA 2XMEA 5C47A 2ICXA 1K4VA 2A8WA 4G3QA 4DECA 4ARWA 1FXJA 3D5NA 1TW5A 5FUHA 3SPTA 3K8DA 5C38A 2JCLA 3U2UA 4K6RA 2OEGA 2MZBA 5CQOA 5FV9A 1R82A 2AM4A 1LZIA 4GBPA 1OMXA 1IINA 3V0PA 1H5SA 1YROB 2Y4LA 3POLA 4B42A 1S4NA 1FZWA 3FWWA 2X60A 4G87A 2Y6PA 4Y6NA 3USRA 3V90A 1R7TA 1QGSA 3T7OA 2XWMA 2Y4MA 1W55A 1H5SB 4MNDA 1Z90A 2FYAA 5EIYA 1H4EA 2V0HA 1G93A 1FOAA 1KWSA 1ZHJA 2X5SA 4LW6A 3IOJA 1FRWA 2VS5A 4EE4A 2YQJA 4Y7UA 2VSHA 2WAWA 2ZU9A 3OH3A 4KPZA 1MP4A 4FRPA 4KNXA 4M4KA 4JD0A 4L41C 4HO8A 4ZDQA 5C4CA 2FYDB 1TW1A 3DJ4A 3T7NA 1GX4A 3I0CA 3I0KA 4AAWA 4DE7A 1VGTA 4ASJA 4HO2A 1INJA 2YQCA 3ZGGA 1VICA 2BO7A 2BO6A 2AECA 4HG6A 2BO4A 4EE3A 1H3MA 2D7IA 2PX7A 5FTSA 4HO3A 4P02A 1V82A 4B4MA 2I5EA 1ON6A 3V91A 2E8BA 2VS3A 3Q7UA 3SX8A 5C48A 4EEAA 1HM8A 5CMIA 2GGQA 1EZIA 4KC4A
chains in the Genus database with same CATH superfamily
1O7QA 3TZTA 4BQHA 2Z86A 2FYBA 2AM5A 1IIMA 5C4EA 3V0LA 1ZJ3A 2I5KA 2V0IA 3I0FA 1H5TB 2W0VA 3SXBA 3U2WA 1FR8A 5AJPA 4EVWA 4FROA 1R7YA 3FOQA 4FQWA 2C0NA 5IFYA 2ZU8A 3OKRA 3OC9A 4AYJA 2PGVA 1TVYA 1YP3A 1OQMB 3CU0A 4J18A 4MIXA 1ZJ0A 5C8RA 1EYRA 2VFZA 4EEOA 1XHBA 5C4BA 1VGWA 4CJCA 5DDTA 4LW3A 1JVGA 3ZLLA 3E26A 1ZJOA 1GQCA 4G3PA 2XMHA 4UEGA 2JCKA 3CKVA 5J49A 2RJ0A 1G9RA 3U2XA 5HS2A 3EE5A 1QWJA 2O1GA 1WT3A 1JV3A 2RITA 4Y64A 1GWVA 5L6SA 3DK5A 2RIYA 2RIXA 4KC1A 3SXCA 1GQ9A 3CKOA 4Y7FA 1ZCVA 4Q7CA 3BCVA 4M28A 2D7RA 1H4DA 4EEGA 1NHEB 3CGXA 2QGIA 3HL3A 1G97A 1O7OA 2QKXA 4FRQA 4YS8A 2FYCB 2WVKA 3I0DA 5C3DA 3SXDA 1MP3A 3GUEA 4Y7TA 1HJLA 4FCUA 1NWGB 2AGDA 2RJ8A 5BXCA 2PGYA 4E1KA 1ZCYA 4KPXA 3JTJA 1JYKA 2V0JA 3O3PA 5CMJA 5C1LA 1VH3A 1SS9A 2O1HA 2NXVA 5CMGX 1LZJA 4O6MA 3U0XA 4B5BA 1VZXA 5CMFX 5I1FA 1VZUA 1FR9A 1GA8A 5FU8A 3K8EA 4HO0A 4Y62A 2DPWA 2FFVA 3U0YA 5EJ1A 1GWWA 5C1GA 5C4DA 1ZI1A 5CQMX 2YQSA 2JCJA 2ZU7A 1FO9A 3I0IX 4NAIA 3V8YA 2OI7A 3BRKX 4NAKA 2W0WA 1H5SD 1YP2A 2I7BA 4XWIA 4NANA 2WGZA 1ZDGA 5C3BA 2OEFA 1G1LA 3NGWA 2VK9A 4R7PA 2XWNA 1H5TA 2VXMA 5CQLX 1H4CA 1R7VA 4NALA 1FWYA 3V0OA 1LL2A 1OMZA 3I0HA 5CQPA 2ICYA 1H7FA 2FFUA 3I0GA 1LVWA 5CQNX 5C49A 1LL0A 2A8UA 2AM3A 4HO5A 1G8OA 1H7TA 1O0RA 5FU0A 1FO8A 2RJ9A 1WSZA 2YESA 1NF5B 1R7UA 3Q80A 2Y7AA 1ZI4A 3D98A 1QGQA 3SX3A 4AC3A 3IOIA 1JVDA 4MYBA 2UX8A 2J0AA 2CU2A 3OH0A 4KT7A 1H7EA 1I52A 1W57A 4P00A 1ZJ1A 2P73A 2RJ7A 4IRPA 2RIZA 4KXOA 4Y7VA 1YP4A 4M2AA 2RJ6A 4AYLA 4B4GA 3RSBA 1VZTA 4Y9XA 1G95A 1S4PA 1LL3A 2WVMA 4FRLA 2RJ1A 3RMVA 2WEEA 4CVHA 4D11C 3U2TA 4HO9A 3OH1A 4JISA 1FGGA 1HJJA 3Q4SA 5C3AA 1FGXA 2QH5A 4DDZA 3IOHA 2Y4JA 3KIAA 1NQIB 1V83A 2WVLA 3SX5A 2X5ZA 1XZ6A 4D0TA 3I0LA 2VS4A 4M2BA 2Z87A 4FRHA 1MC3A 3DUVA 1FXOA 2RJ5A 2X65A 4HOCA 1JYLA 3V0QA 1VM8A 4D48A 3V8ZA 5C36A 3CKNA 1ZCUA 1ZI3A 1ON8A 1FG5N 3U2VA 3CKQA 2VSIA 1TZFA 5AJOA 4B3UA 3JUKA 4C2SA 1ZI5A 3F1YA 5IDSA 3LW6A 1G3LA 2VXLA 1G2VA 4FRDA 4B2XA 2BO8A 3SXGA 2YCMA 3SXEA 3I0JA 4B4BA 2D0JA 3R2WA 2V0KA 4EEMA 1WT1A 2APCA 3V0NA 1H5RA 1ZJPA 4KC2A 3PKQA 2AH9A 5FYEA 4FRBA 2YQHA 3ST8A 3OH4A 1H7GA 1WT0A 4FRMA 2AE7A 2FY7A 1NMMB 2VD4A 1H5RB 2O1FA 4KRVA 5L6VA 5IDTA 3USQA 4FIYA 4HO6A 5AJNA 5C1HA 3OGZA 1O23B 1VPAA 2P6WA 2OI6A 1ZDFA 2JCOA 1V84A 1ZCTA 1E5KA 4EE5A 1PZYB 1PZTA 4FCEA 1H7LA 4FREA 4D11A 4CJBA 2GGOA 3SXAA 4HCQA 2P72A 1INIA 1NKHB 1MP5A 1LZ7A 2XWLA 4BMAA 3N9WA 2YC3A 3RMWA 1H5SC 4Y7GA 5JQQA 1S4OA 4KNRA 4HO4A 2YC5A 1GX0A 1G23A 1QG8A 5CMHA 1JV1A 4ASYA 1W77A 1R80A 3JUJA 3OH2A 4KQLA 4Y63A 1R81A 5C4FA 3D8VA 1HV9A 3R3IA 1VH1A 2AESA 4G3SA 4Y6UA 4CJ8A 5FTVA 1HM0A 1HM9A 1G0RA 3I0EA 4B2WA 3OAMA 5EJZA 3F1CA 2Y4KA 1ZIZA 4IRQA 5DDVA 2PA4A 2V0LA 3SX7A 2RJ4A 3TQDA 3CKJA 4FRAA 3ZGFA 1H7QA 1H7HA 3V0MA 3QVBA 4ECMA 1WT2A 1ZJ2A 2Q4JA 2E3DA 3ZLKA 1R7XA 2OI5A 2WE9A 3PKPA 1LZ0A 3ZF8A 3E25A 3PNNA 3T7MA 1VGUA 1VGZA 1WVCA 4D0ZA 2XMEA 5C47A 2ICXA 1K4VA 2A8WA 4G3QA 4DECA 4ARWA 1FXJA 3D5NA 1TW5A 5FUHA 3SPTA 3K8DA 5C38A 2JCLA 3U2UA 4K6RA 2OEGA 2MZBA 5CQOA 5FV9A 1R82A 2AM4A 1LZIA 4GBPA 1OMXA 5D91A 1IINA 3V0PA 1H5SA 1YROB 2Y4LA 3POLA 4B42A 1S4NA 1FZWA 3FWWA 2X60A 4G87A 2Y6PA 4Y6NA 3USRA 3V90A 1R7TA 1QGSA 3T7OA 2XWMA 2Y4MA 1W55A 1H5SB 4MNDA 1Z90A 2FYAA 5EIYA 1H4EA 2V0HA 1G93A 1FOAA 4O6NA 1KWSA 1ZHJA 2X5SA 4LW6A 3IOJA 1FRWA 2VS5A 4EE4A 2YQJA 4Y7UA 2VSHA 2WAWA 2ZU9A 3OH3A 4KPZA 1MP4A 4FRPA 5D92A 4KNXA 4M4KA 4JD0A 4L41C 4HO8A 4ZDQA 5C4CA 2FYDB 1TW1A 3DJ4A 3T7NA 1GX4A 3I0CA 3I0KA 4AAWA 4DE7A 1VGTA 4ASJA 4HO2A 1INJA 2YQCA 3ZGGA 1VICA 4FIXA 2BO7A 2BO6A 2AECA 4HG6A 2BO4A 4EE3A 1H3MA 2D7IA 2PX7A 5FTSA 4HO3A 4P02A 1V82A 4B4MA 2I5EA 2J0BA 1ON6A 3V91A 2E8BA 2VS3A 3Q7UA 3SX8A 5C48A 4EEAA 1HM8A 5CMIA 2GGQA 1EZIA 4KC4A
chains in the Genus database with same CATH topology
1O7QA 3TZTA 4BQHA 2Z86A 2FYBA 2AM5A 1IIMA 5C4EA 3V0LA 1ZJ3A 2I5KA 2V0IA 3I0FA 1H5TB 2W0VA 3SXBA 3U2WA 1FR8A 5AJPA 4EVWA 4FROA 1R7YA 3FOQA 4FQWA 2C0NA 5IFYA 2ZU8A 3OKRA 3OC9A 4AYJA 2PGVA 1TVYA 1YP3A 1OQMB 3CU0A 4J18A 4MIXA 1ZJ0A 5C8RA 1EYRA 2VFZA 4EEOA 1XHBA 5C4BA 1VGWA 4CJCA 5DDTA 4LW3A 1JVGA 3ZLLA 3E26A 1ZJOA 1GQCA 4G3PA 2XMHA 4UEGA 2JCKA 3CKVA 5J49A 2RJ0A 1G9RA 3U2XA 5HS2A 3EE5A 1QWJA 2O1GA 1WT3A 1JV3A 2RITA 4Y64A 1GWVA 5L6SA 3DK5A 2RIYA 2RIXA 4KC1A 3SXCA 1GQ9A 3CKOA 4Y7FA 1ZCVA 4Q7CA 3BCVA 4M28A 2D7RA 1H4DA 4EEGA 1NHEB 3CGXA 2QGIA 3HL3A 1G97A 1O7OA 2QKXA 4FRQA 4YS8A 2FYCB 2WVKA 3I0DA 5C3DA 3SXDA 1MP3A 3GUEA 4Y7TA 1HJLA 4FCUA 1NWGB 2AGDA 2RJ8A 5BXCA 2PGYA 4E1KA 1ZCYA 4KPXA 3JTJA 1JYKA 2V0JA 3O3PA 5CMJA 5C1LA 1VH3A 1SS9A 2O1HA 2NXVA 5CMGX 1LZJA 4O6MA 3U0XA 4B5BA 1VZXA 5CMFX 5I1FA 1VZUA 1FR9A 1GA8A 5FU8A 3K8EA 4HO0A 4Y62A 2DPWA 2FFVA 3U0YA 5EJ1A 1GWWA 5C1GA 5C4DA 1ZI1A 5CQMX 2YQSA 2JCJA 2ZU7A 1FO9A 3I0IX 4NAIA 3V8YA 2OI7A 3BRKX 4NAKA 2W0WA 1H5SD 1YP2A 2I7BA 4XWIA 4NANA 2WGZA 1ZDGA 5C3BA 2OEFA 1G1LA 3NGWA 2VK9A 4R7PA 2XWNA 1H5TA 2VXMA 5CQLX 1H4CA 1R7VA 4NALA 1FWYA 3V0OA 1LL2A 1OMZA 3I0HA 5CQPA 2ICYA 1H7FA 2FFUA 3I0GA 1LVWA 5CQNX 5C49A 1LL0A 2A8UA 2AM3A 4HO5A 1G8OA 1H7TA 1O0RA 5FU0A 1FO8A 2RJ9A 1WSZA 2YESA 1NF5B 1R7UA 3Q80A 2Y7AA 1ZI4A 3D98A 1QGQA 3SX3A 4AC3A 3IOIA 1JVDA 4MYBA 2UX8A 2J0AA 2CU2A 3OH0A 4KT7A 1H7EA 1I52A 1W57A 4P00A 1ZJ1A 2P73A 2RJ7A 4IRPA 2RIZA 4KXOA 4Y7VA 1YP4A 4M2AA 2RJ6A 4AYLA 4B4GA 3RSBA 1VZTA 4Y9XA 1G95A 1S4PA 1LL3A 2WVMA 4FRLA 2RJ1A 3RMVA 2WEEA 4CVHA 4D11C 3U2TA 4HO9A 3OH1A 4JISA 1FGGA 1HJJA 3Q4SA 5C3AA 1FGXA 2QH5A 4DDZA 3IOHA 2Y4JA 3KIAA 1NQIB 1V83A 2WVLA 3SX5A 2X5ZA 1XZ6A 4D0TA 3I0LA 2VS4A 4M2BA 2Z87A 4FRHA 1MC3A 3DUVA 1FXOA 2RJ5A 2X65A 4HOCA 1JYLA 3V0QA 1VM8A 4D48A 3V8ZA 5C36A 3CKNA 1ZCUA 1ZI3A 1ON8A 1FG5N 3U2VA 3CKQA 2VSIA 1TZFA 5AJOA 4B3UA 3JUKA 4C2SA 1ZI5A 3F1YA 5IDSA 3LW6A 1G3LA 2VXLA 1G2VA 4FRDA 4B2XA 2BO8A 3SXGA 2YCMA 3SXEA 3I0JA 4B4BA 2D0JA 3R2WA 2V0KA 4EEMA 1WT1A 2APCA 3V0NA 1H5RA 1ZJPA 4KC2A 3PKQA 2AH9A 5FYEA 4FRBA 2YQHA 3ST8A 3OH4A 1H7GA 1WT0A 4FRMA 2AE7A 2FY7A 1NMMB 2VD4A 1H5RB 2O1FA 4KRVA 5L6VA 5IDTA 3USQA 4FIYA 4HO6A 5AJNA 5C1HA 3OGZA 1O23B 1VPAA 2P6WA 2OI6A 1ZDFA 2JCOA 1V84A 1ZCTA 1E5KA 4EE5A 1PZYB 1PZTA 4FCEA 1H7LA 4FREA 4D11A 4CJBA 2GGOA 3SXAA 4HCQA 2P72A 1INIA 1NKHB 1MP5A 1LZ7A 2XWLA 4BMAA 3N9WA 2YC3A 3RMWA 1H5SC 4Y7GA 5JQQA 1S4OA 4KNRA 4HO4A 2YC5A 1GX0A 1G23A 1QG8A 5CMHA 1JV1A 4ASYA 1W77A 1R80A 3JUJA 3OH2A 4KQLA 4Y63A 1R81A 5C4FA 3D8VA 1HV9A 3R3IA 1VH1A 2AESA 4G3SA 4Y6UA 4CJ8A 5FTVA 1HM0A 1HM9A 1G0RA 3I0EA 4B2WA 3OAMA 5EJZA 3F1CA 2Y4KA 1ZIZA 4IRQA 5DDVA 2PA4A 2V0LA 3SX7A 2RJ4A 3TQDA 3CKJA 4FRAA 3ZGFA 1H7QA 1H7HA 3V0MA 3QVBA 4ECMA 1WT2A 1ZJ2A 2Q4JA 2E3DA 3ZLKA 1R7XA 2OI5A 2WE9A 3PKPA 1LZ0A 3ZF8A 3E25A 3PNNA 3T7MA 1VGUA 1VGZA 1WVCA 4D0ZA 2XMEA 5C47A 2ICXA 1K4VA 2A8WA 4G3QA 4DECA 4ARWA 1FXJA 3D5NA 1TW5A 5FUHA 3SPTA 3K8DA 5C38A 2JCLA 3U2UA 4K6RA 2OEGA 2MZBA 5CQOA 5FV9A 1R82A 2AM4A 1LZIA 4GBPA 1OMXA 5D91A 1IINA 3V0PA 1H5SA 1YROB 2Y4LA 3POLA 4B42A 1S4NA 1FZWA 3FWWA 2X60A 4G87A 2Y6PA 4Y6NA 3USRA 3V90A 1R7TA 1QGSA 3T7OA 2XWMA 2Y4MA 1W55A 1H5SB 4MNDA 1Z90A 2FYAA 5EIYA 1H4EA 2V0HA 1G93A 1FOAA 4O6NA 1KWSA 1ZHJA 2X5SA 4LW6A 3IOJA 1FRWA 2VS5A 4EE4A 2YQJA 4Y7UA 2VSHA 2WAWA 2ZU9A 3OH3A 4KPZA 1MP4A 4FRPA 5D92A 4KNXA 4M4KA 4JD0A 4L41C 4HO8A 4ZDQA 5C4CA 2FYDB 1TW1A 3DJ4A 3T7NA 1GX4A 3I0CA 3I0KA 4AAWA 4DE7A 1VGTA 4ASJA 4HO2A 1INJA 2YQCA 3ZGGA 1VICA 4FIXA 2BO7A 2BO6A 2AECA 4HG6A 2BO4A 4EE3A 1H3MA 2D7IA 2PX7A 5FTSA 4HO3A 4P02A 1V82A 4B4MA 2I5EA 2J0BA 1ON6A 3V91A 2E8BA 2VS3A 3Q7UA 3SX8A 5C48A 4EEAA 1HM8A 5CMIA 2GGQA 1EZIA 4KC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Q A;  3TZT A;  4BQH A;  2Z86 A;  2FYB A;  2AM5 A;  1IIM A;  5C4E A;  3V0L A;  1ZJ3 A;  2I5K A;  2V0I A;  3I0F A;  1H5T B;  2W0V A;  3SXB A;  3U2W A;  1FR8 A;  5AJP A;  4EVW A;  4FRO A;  1R7Y A;  3FOQ A;  4FQW A;  5IFY A;  2ZU8 A;  3OKR A;  3OC9 A;  4AYJ A;  2PGV A;  1TVY A;  1YP3 A;  1OQM B;  3CU0 A;  4J18 A;  5C8R A;  1ZJ0 A;  1EYR A;  2VFZ A;  4EEO A;  1XHB A;  5C4B A;  1VGW A;  4CJC A;  5DDT A;  4LW3 A;  1JVG A;  3ZLL A;  3E26 A;  1ZJO A;  1GQC A;  4G3P A;  2XMH A;  4UEG A;  2JCK A;  3CKV A;  5J49 A;  2RJ0 A;  1G9R A;  3U2X A;  5HS2 A;  3EE5 A;  1QWJ A;  2O1G A;  1WT3 A;  1JV3 A;  2RIT A;  4Y64 A;  1GWV A;  5L6S A;  3DK5 A;  2RIY A;  2RIX A;  4KC1 A;  3SXC A;  1GQ9 A;  3CKO A;  4Y7F A;  1ZCV A;  3BCV A;  4M28 A;  2D7R A;  1H4D A;  4EEG A;  1NHE B;  3CGX A;  2QGI A;  3HL3 A;  1G97 A;  1O7O A;  2QKX A;  4FRQ A;  4YS8 A;  2FYC B;  2WVK A;  3I0D A;  5C3D A;  3SXD A;  1MP3 A;  3GUE A;  4Y7T A;  1HJL A;  4FCU A;  1NWG B;  2AGD A;  2RJ8 A;  5BXC A;  2PGY A;  4E1K A;  1ZCY A;  4KPX A;  3JTJ A;  1JYK A;  2V0J A;  3O3P A;  5CMJ A;  5C1L A;  1VH3 A;  1SS9 A;  2O1H A;  2NXV A;  5CMG X;  1LZJ A;  3U0X A;  4B5B A;  1VZX A;  5CMF X;  5I1F A;  1VZU A;  1FR9 A;  1GA8 A;  5FU8 A;  3K8E A;  4HO0 A;  4Y62 A;  2DPW A;  2FFV A;  3U0Y A;  5EJ1 A;  1GWW A;  5C1G A;  5C4D A;  1ZI1 A;  5CQM X;  2YQS A;  2JCJ A;  2ZU7 A;  1FO9 A;  3I0I X;  4NAI A;  3V8Y A;  2OI7 A;  3BRK X;  4NAK A;  2W0W A;  1H5S D;  1YP2 A;  2I7B A;  4XWI A;  4NAN A;  2WGZ A;  1ZDG A;  5C3B A;  2OEF A;  1G1L A;  3NGW A;  4R7P A;  2XWN A;  1H5T A;  2VXM A;  5CQL X;  1H4C A;  1R7V A;  4NAL A;  1FWY A;  3V0O A;  1LL2 A;  1OMZ A;  3I0H A;  5CQP A;  2ICY A;  1H7F A;  2FFU A;  3I0G A;  1LVW A;  5CQN X;  5C49 A;  1LL0 A;  2A8U A;  2AM3 A;  4HO5 A;  1G8O A;  1H7T A;  1O0R A;  5FU0 A;  1FO8 A;  2RJ9 A;  1WSZ A;  2YES A;  1NF5 B;  1R7U A;  3Q80 A;  2Y7A A;  1ZI4 A;  3D98 A;  1QGQ A;  3SX3 A;  4AC3 A;  3IOI A;  1JVD A;  4MYB A;  2UX8 A;  2CU2 A;  3OH0 A;  4KT7 A;  1H7E A;  1I52 A;  1W57 A;  4P00 A;  1ZJ1 A;  2P73 A;  2RJ7 A;  4IRP A;  2RIZ A;  4KXO A;  4Y7V A;  1YP4 A;  4M2A A;  2RJ6 A;  4AYL A;  4B4G A;  3RSB A;  1VZT A;  4Y9X A;  1G95 A;  1S4P A;  1LL3 A;  2WVM A;  4FRL A;  2RJ1 A;  3RMV A;  2WEE A;  4CVH A;  4D11 C;  3U2T A;  4HO9 A;  3OH1 A;  4JIS A;  1FGG A;  1HJJ A;  3Q4S A;  5C3A A;  1FGX A;  2QH5 A;  4DDZ A;  3IOH A;  2Y4J A;  3KIA A;  1NQI B;  1V83 A;  2WVL A;  3SX5 A;  2X5Z A;  1XZ6 A;  4D0T A;  3I0L A;  2VS4 A;  4M2B A;  2Z87 A;  4FRH A;  1MC3 A;  3DUV A;  1FXO A;  2RJ5 A;  2X65 A;  4HOC A;  1JYL A;  3V0Q A;  1VM8 A;  4D48 A;  3V8Z A;  5C36 A;  3CKN A;  1ZCU A;  1ZI3 A;  1ON8 A;  1FG5 N;  3U2V A;  3CKQ A;  2VSI A;  1TZF A;  5AJO A;  4B3U A;  3JUK A;  4C2S A;  1ZI5 A;  3F1Y A;  5IDS A;  3LW6 A;  1G3L A;  2VXL A;  1G2V A;  4FRD A;  4B2X A;  2BO8 A;  3SXG A;  2YCM A;  3SXE A;  3I0J A;  4B4B A;  2D0J A;  3R2W A;  2V0K A;  4EEM A;  1WT1 A;  2APC A;  3V0N A;  1H5R A;  1ZJP A;  4KC2 A;  3PKQ A;  2AH9 A;  5FYE A;  4FRB A;  2YQH A;  3ST8 A;  3OH4 A;  1H7G A;  1WT0 A;  4FRM A;  2AE7 A;  2FY7 A;  1NMM B;  2VD4 A;  1H5R B;  2O1F A;  4KRV A;  5L6V A;  5IDT A;  3USQ A;  4HO6 A;  5AJN A;  5C1H A;  3OGZ A;  1O23 B;  1VPA A;  2P6W A;  2OI6 A;  1ZDF A;  2JCO A;  1V84 A;  1ZCT A;  1E5K A;  4EE5 A;  1PZY B;  1PZT A;  4FCE A;  1H7L A;  4FRE A;  4D11 A;  4CJB A;  2GGO A;  3SXA A;  4HCQ A;  2P72 A;  1INI A;  1NKH B;  1MP5 A;  1LZ7 A;  2XWL A;  4BMA A;  3N9W A;  2YC3 A;  3RMW A;  1H5S C;  4Y7G A;  5JQQ A;  1S4O A;  4KNR A;  4HO4 A;  2YC5 A;  1GX0 A;  1G23 A;  1QG8 A;  5CMH A;  1JV1 A;  4ASY A;  1W77 A;  1R80 A;  3JUJ A;  3OH2 A;  4KQL A;  4Y63 A;  1R81 A;  5C4F A;  3D8V A;  1HV9 A;  3R3I A;  1VH1 A;  2AES A;  4G3S A;  4Y6U A;  4CJ8 A;  5FTV A;  1HM0 A;  1HM9 A;  1G0R A;  3I0E A;  4B2W A;  3OAM A;  5EJZ A;  3F1C A;  2Y4K A;  1ZIZ A;  4IRQ A;  5DDV A;  2PA4 A;  2V0L A;  3SX7 A;  2RJ4 A;  3TQD A;  3CKJ A;  4FRA A;  3ZGF A;  1H7Q A;  1H7H A;  3V0M A;  3QVB A;  4ECM A;  1WT2 A;  1ZJ2 A;  2Q4J A;  2E3D A;  3ZLK A;  1R7X A;  2OI5 A;  2WE9 A;  3PKP A;  1LZ0 A;  3ZF8 A;  3E25 A;  3PNN A;  3T7M A;  1VGU A;  1VGZ A;  1WVC A;  4D0Z A;  2XME A;  5C47 A;  2ICX A;  1K4V A;  2A8W A;  4G3Q A;  4DEC A;  4ARW A;  1FXJ A;  3D5N A;  1TW5 A;  5FUH A;  3SPT A;  3K8D A;  5C38 A;  2JCL A;  3U2U A;  4K6R A;  2OEG A;  2MZB A;  5CQO A;  5FV9 A;  1R82 A;  2AM4 A;  1LZI A;  4GBP A;  1OMX A;  1IIN A;  3V0P A;  1H5S A;  1YRO B;  2Y4L A;  3POL A;  4B42 A;  1S4N A;  1FZW A;  3FWW A;  2X60 A;  4G87 A;  2Y6P A;  4Y6N A;  3USR A;  3V90 A;  1R7T A;  1QGS A;  3T7O A;  2XWM A;  2Y4M A;  1W55 A;  1H5S B;  4MND A;  1Z90 A;  2FYA A;  5EIY A;  1H4E A;  2V0H A;  1G93 A;  1FOA A;  1KWS A;  1ZHJ A;  2X5S A;  4LW6 A;  3IOJ A;  1FRW A;  2VS5 A;  4EE4 A;  2YQJ A;  4Y7U A;  2VSH A;  2WAW A;  2ZU9 A;  3OH3 A;  4KPZ A;  1MP4 A;  4FRP A;  4KNX A;  4M4K A;  4JD0 A;  4L41 C;  4HO8 A;  4ZDQ A;  5C4C A;  2FYD B;  1TW1 A;  3DJ4 A;  3T7N A;  1GX4 A;  3I0C A;  3I0K A;  4AAW A;  4DE7 A;  1VGT A;  4ASJ A;  4HO2 A;  1INJ A;  2YQC A;  3ZGG A;  1VIC A;  2BO7 A;  2BO6 A;  2AEC A;  4HG6 A;  2BO4 A;  4EE3 A;  1H3M A;  2D7I A;  2PX7 A;  5FTS A;  4HO3 A;  4P02 A;  1V82 A;  4B4M A;  2I5E A;  1ON6 A;  3V91 A;  2E8B A;  2VS3 A;  3Q7U A;  3SX8 A;  5C48 A;  4EEA A;  1HM8 A;  5CMI A;  2GGQ A;  1EZI A;  4KC4 A; 
#chains in the Genus database with same CATH topology
 1O7Q A;  3TZT A;  4BQH A;  2Z86 A;  2FYB A;  2AM5 A;  1IIM A;  5C4E A;  3V0L A;  1ZJ3 A;  2I5K A;  2V0I A;  3I0F A;  1H5T B;  2W0V A;  3SXB A;  3U2W A;  1FR8 A;  5AJP A;  4EVW A;  4FRO A;  1R7Y A;  3FOQ A;  4FQW A;  2C0N A;  5IFY A;  2ZU8 A;  3OKR A;  3OC9 A;  4AYJ A;  2PGV A;  1TVY A;  1YP3 A;  1OQM B;  3CU0 A;  4J18 A;  4MIX A;  1ZJ0 A;  5C8R A;  1EYR A;  2VFZ A;  4EEO A;  1XHB A;  5C4B A;  1VGW A;  4CJC A;  5DDT A;  4LW3 A;  1JVG A;  3ZLL A;  3E26 A;  1ZJO A;  1GQC A;  4G3P A;  2XMH A;  4UEG A;  2JCK A;  3CKV A;  5J49 A;  2RJ0 A;  1G9R A;  3U2X A;  5HS2 A;  3EE5 A;  1QWJ A;  2O1G A;  1WT3 A;  1JV3 A;  2RIT A;  4Y64 A;  1GWV A;  5L6S A;  3DK5 A;  2RIY A;  2RIX A;  4KC1 A;  3SXC A;  1GQ9 A;  3CKO A;  4Y7F A;  1ZCV A;  4Q7C A;  3BCV A;  4M28 A;  2D7R A;  1H4D A;  4EEG A;  1NHE B;  3CGX A;  2QGI A;  3HL3 A;  1G97 A;  1O7O A;  2QKX A;  4FRQ A;  4YS8 A;  2FYC B;  2WVK A;  3I0D A;  5C3D A;  3SXD A;  1MP3 A;  3GUE A;  4Y7T A;  1HJL A;  4FCU A;  1NWG B;  2AGD A;  2RJ8 A;  5BXC A;  2PGY A;  4E1K A;  1ZCY A;  4KPX A;  3JTJ A;  1JYK A;  2V0J A;  3O3P A;  5CMJ A;  5C1L A;  1VH3 A;  1SS9 A;  2O1H A;  2NXV A;  5CMG X;  1LZJ A;  4O6M A;  3U0X A;  4B5B A;  1VZX A;  5CMF X;  5I1F A;  1VZU A;  1FR9 A;  1GA8 A;  5FU8 A;  3K8E A;  4HO0 A;  4Y62 A;  2DPW A;  2FFV A;  3U0Y A;  5EJ1 A;  1GWW A;  5C1G A;  5C4D A;  1ZI1 A;  5CQM X;  2YQS A;  2JCJ A;  2ZU7 A;  1FO9 A;  3I0I X;  4NAI A;  3V8Y A;  2OI7 A;  3BRK X;  4NAK A;  2W0W A;  1H5S D;  1YP2 A;  2I7B A;  4XWI A;  4NAN A;  2WGZ A;  1ZDG A;  5C3B A;  2OEF A;  1G1L A;  3NGW A;  2VK9 A;  4R7P A;  2XWN A;  1H5T A;  2VXM A;  5CQL X;  1H4C A;  1R7V A;  4NAL A;  1FWY A;  3V0O A;  1LL2 A;  1OMZ A;  3I0H A;  5CQP A;  2ICY A;  1H7F A;  2FFU A;  3I0G A;  1LVW A;  5CQN X;  5C49 A;  1LL0 A;  2A8U A;  2AM3 A;  4HO5 A;  1G8O A;  1H7T A;  1O0R A;  5FU0 A;  1FO8 A;  2RJ9 A;  1WSZ A;  2YES A;  1NF5 B;  1R7U A;  3Q80 A;  2Y7A A;  1ZI4 A;  3D98 A;  1QGQ A;  3SX3 A;  4AC3 A;  3IOI A;  1JVD A;  4MYB A;  2UX8 A;  2J0A A;  2CU2 A;  3OH0 A;  4KT7 A;  1H7E A;  1I52 A;  1W57 A;  4P00 A;  1ZJ1 A;  2P73 A;  2RJ7 A;  4IRP A;  2RIZ A;  4KXO A;  4Y7V A;  1YP4 A;  4M2A A;  2RJ6 A;  4AYL A;  4B4G A;  3RSB A;  1VZT A;  4Y9X A;  1G95 A;  1S4P A;  1LL3 A;  2WVM A;  4FRL A;  2RJ1 A;  3RMV A;  2WEE A;  4CVH A;  4D11 C;  3U2T A;  4HO9 A;  3OH1 A;  4JIS A;  1FGG A;  1HJJ A;  3Q4S A;  5C3A A;  1FGX A;  2QH5 A;  4DDZ A;  3IOH A;  2Y4J A;  3KIA A;  1NQI B;  1V83 A;  2WVL A;  3SX5 A;  2X5Z A;  1XZ6 A;  4D0T A;  3I0L A;  2VS4 A;  4M2B A;  2Z87 A;  4FRH A;  1MC3 A;  3DUV A;  1FXO A;  2RJ5 A;  2X65 A;  4HOC A;  1JYL A;  3V0Q A;  1VM8 A;  4D48 A;  3V8Z A;  5C36 A;  3CKN A;  1ZCU A;  1ZI3 A;  1ON8 A;  1FG5 N;  3U2V A;  3CKQ A;  2VSI A;  1TZF A;  5AJO A;  4B3U A;  3JUK A;  4C2S A;  1ZI5 A;  3F1Y A;  5IDS A;  3LW6 A;  1G3L A;  2VXL A;  1G2V A;  4FRD A;  4B2X A;  2BO8 A;  3SXG A;  2YCM A;  3SXE A;  3I0J A;  4B4B A;  2D0J A;  3R2W A;  2V0K A;  4EEM A;  1WT1 A;  2APC A;  3V0N A;  1H5R A;  1ZJP A;  4KC2 A;  3PKQ A;  2AH9 A;  5FYE A;  4FRB A;  2YQH A;  3ST8 A;  3OH4 A;  1H7G A;  1WT0 A;  4FRM A;  2AE7 A;  2FY7 A;  1NMM B;  2VD4 A;  1H5R B;  2O1F A;  4KRV A;  5L6V A;  5IDT A;  3USQ A;  4FIY A;  4HO6 A;  5AJN A;  5C1H A;  3OGZ A;  1O23 B;  1VPA A;  2P6W A;  2OI6 A;  1ZDF A;  2JCO A;  1V84 A;  1ZCT A;  1E5K A;  4EE5 A;  1PZY B;  1PZT A;  4FCE A;  1H7L A;  4FRE A;  4D11 A;  4CJB A;  2GGO A;  3SXA A;  4HCQ A;  2P72 A;  1INI A;  1NKH B;  1MP5 A;  1LZ7 A;  2XWL A;  4BMA A;  3N9W A;  2YC3 A;  3RMW A;  1H5S C;  4Y7G A;  5JQQ A;  1S4O A;  4KNR A;  4HO4 A;  2YC5 A;  1GX0 A;  1G23 A;  1QG8 A;  5CMH A;  1JV1 A;  4ASY A;  1W77 A;  1R80 A;  3JUJ A;  3OH2 A;  4KQL A;  4Y63 A;  1R81 A;  5C4F A;  3D8V A;  1HV9 A;  3R3I A;  1VH1 A;  2AES A;  4G3S A;  4Y6U A;  4CJ8 A;  5FTV A;  1HM0 A;  1HM9 A;  1G0R A;  3I0E A;  4B2W A;  3OAM A;  5EJZ A;  3F1C A;  2Y4K A;  1ZIZ A;  4IRQ A;  5DDV A;  2PA4 A;  2V0L A;  3SX7 A;  2RJ4 A;  3TQD A;  3CKJ A;  4FRA A;  3ZGF A;  1H7Q A;  1H7H A;  3V0M A;  3QVB A;  4ECM A;  1WT2 A;  1ZJ2 A;  2Q4J A;  2E3D A;  3ZLK A;  1R7X A;  2OI5 A;  2WE9 A;  3PKP A;  1LZ0 A;  3ZF8 A;  3E25 A;  3PNN A;  3T7M A;  1VGU A;  1VGZ A;  1WVC A;  4D0Z A;  2XME A;  5C47 A;  2ICX A;  1K4V A;  2A8W A;  4G3Q A;  4DEC A;  4ARW A;  1FXJ A;  3D5N A;  1TW5 A;  5FUH A;  3SPT A;  3K8D A;  5C38 A;  2JCL A;  3U2U A;  4K6R A;  2OEG A;  2MZB A;  5CQO A;  5FV9 A;  1R82 A;  2AM4 A;  1LZI A;  4GBP A;  1OMX A;  5D91 A;  1IIN A;  3V0P A;  1H5S A;  1YRO B;  2Y4L A;  3POL A;  4B42 A;  1S4N A;  1FZW A;  3FWW A;  2X60 A;  4G87 A;  2Y6P A;  4Y6N A;  3USR A;  3V90 A;  1R7T A;  1QGS A;  3T7O A;  2XWM A;  2Y4M A;  1W55 A;  1H5S B;  4MND A;  1Z90 A;  2FYA A;  5EIY A;  1H4E A;  2V0H A;  1G93 A;  1FOA A;  4O6N A;  1KWS A;  1ZHJ A;  2X5S A;  4LW6 A;  3IOJ A;  1FRW A;  2VS5 A;  4EE4 A;  2YQJ A;  4Y7U A;  2VSH A;  2WAW A;  2ZU9 A;  3OH3 A;  4KPZ A;  1MP4 A;  4FRP A;  5D92 A;  4KNX A;  4M4K A;  4JD0 A;  4L41 C;  4HO8 A;  4ZDQ A;  5C4C A;  2FYD B;  1TW1 A;  3DJ4 A;  3T7N A;  1GX4 A;  3I0C A;  3I0K A;  4AAW A;  4DE7 A;  1VGT A;  4ASJ A;  4HO2 A;  1INJ A;  2YQC A;  3ZGG A;  1VIC A;  4FIX A;  2BO7 A;  2BO6 A;  2AEC A;  4HG6 A;  2BO4 A;  4EE3 A;  1H3M A;  2D7I A;  2PX7 A;  5FTS A;  4HO3 A;  4P02 A;  1V82 A;  4B4M A;  2I5E A;  2J0B A;  1ON6 A;  3V91 A;  2E8B A;  2VS3 A;  3Q7U A;  3SX8 A;  5C48 A;  4EEA A;  1HM8 A;  5CMI A;  2GGQ A;  1EZI A;  4KC4 A; 
#chains in the Genus database with same CATH homology
 1O7Q A;  3TZT A;  4BQH A;  2Z86 A;  2FYB A;  2AM5 A;  1IIM A;  5C4E A;  3V0L A;  1ZJ3 A;  2I5K A;  2V0I A;  3I0F A;  1H5T B;  2W0V A;  3SXB A;  3U2W A;  1FR8 A;  5AJP A;  4EVW A;  4FRO A;  1R7Y A;  3FOQ A;  4FQW A;  2C0N A;  5IFY A;  2ZU8 A;  3OKR A;  3OC9 A;  4AYJ A;  2PGV A;  1TVY A;  1YP3 A;  1OQM B;  3CU0 A;  4J18 A;  4MIX A;  1ZJ0 A;  5C8R A;  1EYR A;  2VFZ A;  4EEO A;  1XHB A;  5C4B A;  1VGW A;  4CJC A;  5DDT A;  4LW3 A;  1JVG A;  3ZLL A;  3E26 A;  1ZJO A;  1GQC A;  4G3P A;  2XMH A;  4UEG A;  2JCK A;  3CKV A;  5J49 A;  2RJ0 A;  1G9R A;  3U2X A;  5HS2 A;  3EE5 A;  1QWJ A;  2O1G A;  1WT3 A;  1JV3 A;  2RIT A;  4Y64 A;  1GWV A;  5L6S A;  3DK5 A;  2RIY A;  2RIX A;  4KC1 A;  3SXC A;  1GQ9 A;  3CKO A;  4Y7F A;  1ZCV A;  4Q7C A;  3BCV A;  4M28 A;  2D7R A;  1H4D A;  4EEG A;  1NHE B;  3CGX A;  2QGI A;  3HL3 A;  1G97 A;  1O7O A;  2QKX A;  4FRQ A;  4YS8 A;  2FYC B;  2WVK A;  3I0D A;  5C3D A;  3SXD A;  1MP3 A;  3GUE A;  4Y7T A;  1HJL A;  4FCU A;  1NWG B;  2AGD A;  2RJ8 A;  5BXC A;  2PGY A;  4E1K A;  1ZCY A;  4KPX A;  3JTJ A;  1JYK A;  2V0J A;  3O3P A;  5CMJ A;  5C1L A;  1VH3 A;  1SS9 A;  2O1H A;  2NXV A;  5CMG X;  1LZJ A;  4O6M A;  3U0X A;  4B5B A;  1VZX A;  5CMF X;  5I1F A;  1VZU A;  1FR9 A;  1GA8 A;  5FU8 A;  3K8E A;  4HO0 A;  4Y62 A;  2DPW A;  2FFV A;  3U0Y A;  5EJ1 A;  1GWW A;  5C1G A;  5C4D A;  1ZI1 A;  5CQM X;  2YQS A;  2JCJ A;  2ZU7 A;  1FO9 A;  3I0I X;  4NAI A;  3V8Y A;  2OI7 A;  3BRK X;  4NAK A;  2W0W A;  1H5S D;  1YP2 A;  2I7B A;  4XWI A;  4NAN A;  2WGZ A;  1ZDG A;  5C3B A;  2OEF A;  1G1L A;  3NGW A;  2VK9 A;  4R7P A;  2XWN A;  1H5T A;  2VXM A;  5CQL X;  1H4C A;  1R7V A;  4NAL A;  1FWY A;  3V0O A;  1LL2 A;  1OMZ A;  3I0H A;  5CQP A;  2ICY A;  1H7F A;  2FFU A;  3I0G A;  1LVW A;  5CQN X;  5C49 A;  1LL0 A;  2A8U A;  2AM3 A;  4HO5 A;  1G8O A;  1H7T A;  1O0R A;  5FU0 A;  1FO8 A;  2RJ9 A;  1WSZ A;  2YES A;  1NF5 B;  1R7U A;  3Q80 A;  2Y7A A;  1ZI4 A;  3D98 A;  1QGQ A;  3SX3 A;  4AC3 A;  3IOI A;  1JVD A;  4MYB A;  2UX8 A;  2J0A A;  2CU2 A;  3OH0 A;  4KT7 A;  1H7E A;  1I52 A;  1W57 A;  4P00 A;  1ZJ1 A;  2P73 A;  2RJ7 A;  4IRP A;  2RIZ A;  4KXO A;  4Y7V A;  1YP4 A;  4M2A A;  2RJ6 A;  4AYL A;  4B4G A;  3RSB A;  1VZT A;  4Y9X A;  1G95 A;  1S4P A;  1LL3 A;  2WVM A;  4FRL A;  2RJ1 A;  3RMV A;  2WEE A;  4CVH A;  4D11 C;  3U2T A;  4HO9 A;  3OH1 A;  4JIS A;  1FGG A;  1HJJ A;  3Q4S A;  5C3A A;  1FGX A;  2QH5 A;  4DDZ A;  3IOH A;  2Y4J A;  3KIA A;  1NQI B;  1V83 A;  2WVL A;  3SX5 A;  2X5Z A;  1XZ6 A;  4D0T A;  3I0L A;  2VS4 A;  4M2B A;  2Z87 A;  4FRH A;  1MC3 A;  3DUV A;  1FXO A;  2RJ5 A;  2X65 A;  4HOC A;  1JYL A;  3V0Q A;  1VM8 A;  4D48 A;  3V8Z A;  5C36 A;  3CKN A;  1ZCU A;  1ZI3 A;  1ON8 A;  1FG5 N;  3U2V A;  3CKQ A;  2VSI A;  1TZF A;  5AJO A;  4B3U A;  3JUK A;  4C2S A;  1ZI5 A;  3F1Y A;  5IDS A;  3LW6 A;  1G3L A;  2VXL A;  1G2V A;  4FRD A;  4B2X A;  2BO8 A;  3SXG A;  2YCM A;  3SXE A;  3I0J A;  4B4B A;  2D0J A;  3R2W A;  2V0K A;  4EEM A;  1WT1 A;  2APC A;  3V0N A;  1H5R A;  1ZJP A;  4KC2 A;  3PKQ A;  2AH9 A;  5FYE A;  4FRB A;  2YQH A;  3ST8 A;  3OH4 A;  1H7G A;  1WT0 A;  4FRM A;  2AE7 A;  2FY7 A;  1NMM B;  2VD4 A;  1H5R B;  2O1F A;  4KRV A;  5L6V A;  5IDT A;  3USQ A;  4FIY A;  4HO6 A;  5AJN A;  5C1H A;  3OGZ A;  1O23 B;  1VPA A;  2P6W A;  2OI6 A;  1ZDF A;  2JCO A;  1V84 A;  1ZCT A;  1E5K A;  4EE5 A;  1PZY B;  1PZT A;  4FCE A;  1H7L A;  4FRE A;  4D11 A;  4CJB A;  2GGO A;  3SXA A;  4HCQ A;  2P72 A;  1INI A;  1NKH B;  1MP5 A;  1LZ7 A;  2XWL A;  4BMA A;  3N9W A;  2YC3 A;  3RMW A;  1H5S C;  4Y7G A;  5JQQ A;  1S4O A;  4KNR A;  4HO4 A;  2YC5 A;  1GX0 A;  1G23 A;  1QG8 A;  5CMH A;  1JV1 A;  4ASY A;  1W77 A;  1R80 A;  3JUJ A;  3OH2 A;  4KQL A;  4Y63 A;  1R81 A;  5C4F A;  3D8V A;  1HV9 A;  3R3I A;  1VH1 A;  2AES A;  4G3S A;  4Y6U A;  4CJ8 A;  5FTV A;  1HM0 A;  1HM9 A;  1G0R A;  3I0E A;  4B2W A;  3OAM A;  5EJZ A;  3F1C A;  2Y4K A;  1ZIZ A;  4IRQ A;  5DDV A;  2PA4 A;  2V0L A;  3SX7 A;  2RJ4 A;  3TQD A;  3CKJ A;  4FRA A;  3ZGF A;  1H7Q A;  1H7H A;  3V0M A;  3QVB A;  4ECM A;  1WT2 A;  1ZJ2 A;  2Q4J A;  2E3D A;  3ZLK A;  1R7X A;  2OI5 A;  2WE9 A;  3PKP A;  1LZ0 A;  3ZF8 A;  3E25 A;  3PNN A;  3T7M A;  1VGU A;  1VGZ A;  1WVC A;  4D0Z A;  2XME A;  5C47 A;  2ICX A;  1K4V A;  2A8W A;  4G3Q A;  4DEC A;  4ARW A;  1FXJ A;  3D5N A;  1TW5 A;  5FUH A;  3SPT A;  3K8D A;  5C38 A;  2JCL A;  3U2U A;  4K6R A;  2OEG A;  2MZB A;  5CQO A;  5FV9 A;  1R82 A;  2AM4 A;  1LZI A;  4GBP A;  1OMX A;  5D91 A;  1IIN A;  3V0P A;  1H5S A;  1YRO B;  2Y4L A;  3POL A;  4B42 A;  1S4N A;  1FZW A;  3FWW A;  2X60 A;  4G87 A;  2Y6P A;  4Y6N A;  3USR A;  3V90 A;  1R7T A;  1QGS A;  3T7O A;  2XWM A;  2Y4M A;  1W55 A;  1H5S B;  4MND A;  1Z90 A;  2FYA A;  5EIY A;  1H4E A;  2V0H A;  1G93 A;  1FOA A;  4O6N A;  1KWS A;  1ZHJ A;  2X5S A;  4LW6 A;  3IOJ A;  1FRW A;  2VS5 A;  4EE4 A;  2YQJ A;  4Y7U A;  2VSH A;  2WAW A;  2ZU9 A;  3OH3 A;  4KPZ A;  1MP4 A;  4FRP A;  5D92 A;  4KNX A;  4M4K A;  4JD0 A;  4L41 C;  4HO8 A;  4ZDQ A;  5C4C A;  2FYD B;  1TW1 A;  3DJ4 A;  3T7N A;  1GX4 A;  3I0C A;  3I0K A;  4AAW A;  4DE7 A;  1VGT A;  4ASJ A;  4HO2 A;  1INJ A;  2YQC A;  3ZGG A;  1VIC A;  4FIX A;  2BO7 A;  2BO6 A;  2AEC A;  4HG6 A;  2BO4 A;  4EE3 A;  1H3M A;  2D7I A;  2PX7 A;  5FTS A;  4HO3 A;  4P02 A;  1V82 A;  4B4M A;  2I5E A;  2J0B A;  1ON6 A;  3V91 A;  2E8B A;  2VS3 A;  3Q7U A;  3SX8 A;  5C48 A;  4EEA A;  1HM8 A;  5CMI A;  2GGQ A;  1EZI A;  4KC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...