1VGWA

Crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
212
Chain Sequence
KRKNIALIPAAPKQYVEIGSKTVLEHVLGIFERHEAVDLTVVVVSPEDTFADKVQTAFPQVRVWKNGGQTRAETVRNGVAKLLETGLAAETDNILVHDAARCCLPSEALARLIEQAGNAAEGGILAVPVADTLKRAESGQISATVDRSGLWQAQTPQLFQAGLLHRALAAGITDEASAVEKLGVRPLLIQGDARNLKLTQPQDAYIVRLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Transferase
total genus 58
structure length 212
sequence length 226
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vgwA00
2VFZA 1FO8A 4FRMA 1ZCUA 4FCEA 3ZGFA 4R7PA 1VGTA 1INIA 2QH5A 1R81A 1ZJPA 3RMWA 1ZI5A 2VSHA 2WGZA 3ST8A 2V0HA 3DJ4A 4ECMA 1FO9A 2E3DA 3OKRA 1HV9A 1HM8A 4ZDQA 2Y7AA 4HO9A 2RJ9A 1ZCYA 4KPXA 2E8BA 1ZDGA 1MP3A 1INJA 4B2XA 1YP3A 1ZCTA 1TW1A 4BMAA 3I0GA 1IINA 2OI7A 4FRQA 4B3UA 4P00A 1ZJ0A 4FQWA 3OH1A 5C49A 1EZIA 2GGOA 5IDSA 1LVWA 5C1LA 1HJJA 1I52A 1W77A 4LW3A 3F1CA 3CKOA 1K4VA 1JYKA 1VGUA 5FU0A 2O1HA 3E25A 2AH9A 1VM8A 5C1GA 4KNXA 2BO7A 2RJ8A 3CU0A 1H5SD 1WSZA 3SXDA 1ZI1A 3I0KA 4FRAA 1H5SB 4AYLA 1H5SA 1W57A 1H7TA 3V0PA 4HO3A 3OAMA 1MP4A 3K8DA 2WEEA 4IRQA 3T7NA 2RJ4A 4CJ8A 1TVYA 4UEGA 2OI5A 4D48A 5C4EA 1JVDA 2JCLA 2XMHA 3U2WA 4D11C 2ZU9A 3SX7A 1VPAA 5IDTA 1H5TB 2X5SA 3Q7UA 4M2AA 1SS9A 3I0CA 4HCQA 3IOIA 1LL0A 4IRPA 1QGQA 2YQHA 4Y7VA 5FUHA 4NANA 5L6VA 3F1YA 1VGZA 2FYCB 4LW6A 1FZWA 3JUKA 4MNDA 2RJ1A 1VH1A 3OH4A 4B4GA 5C4CA 5C3BA 3V0LA 2OEFA 1GWWA 3U0XA 1GX4A 1OMZA 3ZF8A 4EEAA 5IFYA 4HOCA 1G0RA 3K8EA 4B2WA 3LW6A 1NKHB 2YC5A 1KWSA 2P6WA 2ZU8A 2O1GA 1NWGB 2P72A 5FU8A 1ZJ1A 3DK5A 1PZYB 4K6RA 5CQOA 3V0OA 2Y4LA 3D5NA 4JISA 4B5BA 1O7QA 3BRKX 3IOJA 1GQCA 3JUJA 2GGQA 3I0LA 1QGSA 1H7GA 2YCMA 2QKXA 2RIXA 3SXCA 3USRA 3U2TA 1OMXA 3OH3A 2VD4A 5EJ1A 4B4MA 4KC4A 4HO4A 4KPZA 1ZDFA 2WVMA 5FTVA 2FFVA 1ZJ2A 1S4PA 3V0QA 4EEMA 3QVBA 5EIYA 2A8WA 2V0LA 3D98A 2ZU7A 2WE9A 5DDTA 1V84A 4D11A 3IOHA 1H4DA 5C36A 1G1LA 3I0DA 4NAKA 1G97A 1FG5N 1H7LA 4AC3A 1VZUA 5JQQA 3Q80A 3CKNA 2Z87A 5CQNX 5CMGX 4E1KA 1GA8A 1S4OA 1G2VA 3CGXA 4HO5A 3KIAA 2APCA 2NXVA 4J18A 1LL2A 2PX7A 3POLA 4KRVA 2JCKA 2AM4A 3I0JA 4GBPA 3JTJA 1WT0A 2X65A 4DDZA 5C1HA 5CQMX 1G23A 2AGDA 1H7EA 3PKPA 3I0HA 4ASJA 1HM0A 4DECA 2OI6A 1JVGA 4M4KA 1YP4A 2YC3A 3Q4SA 2FYAA 2PGVA 2D7RA 1FXOA 1LL3A 2AECA 3OH2A 5BXCA 4EEOA 3CKJA 2WVLA 1W55A 4B4BA 4Y63A 2OEGA 3V8ZA 1FRWA 2VS3A 1FR9A 2VXLA 3CKQA 2VXMA 4Y7TA 5AJNA 1O23B 2I5EA 4Y7FA 4KC2A 5FTSA 2V0KA 1NHEB 1FR8A 1Z90A 2RJ0A 1O0RA 4BQHA 4P02A 1R82A 2YQJA 1H5RA 1S4NA 3E26A 1FOAA 2RJ6A 3N9WA 2MZBA 2CU2A 3R2WA 3RMVA 1GX0A 5C38A 3U2XA 4D0ZA 4EE4A 2Z86A 2VS4A 1QG8A 2XWNA 1GWVA 3PKQA 5C4DA 1NF5B 2PA4A 2D7IA 4L41C 3O3PA 1R7YA 4FRDA 5CMIA 2RIZA 1ZIZA 1R7XA 1IIMA 3U2VA 4FREA 1JV3A 4HO0A 4KXOA 2A8UA 4G3PA 2P73A 1H7FA 2AM5A 2RIYA 5C3DA 3EE5A 1YROB 1TW5A 3DUVA 1V83A 1FGGA 5FYEA 3V90A 4KQLA 1LZIA 4Y6NA 5FV9A 3OH0A 1NQIB 3TQDA 4NALA 3NGWA 2YESA 1H4CA 1XHBA 5C4BA 5L6SA 4CVHA 4Y6UA 4FCUA 1ZCVA 3I0IX 5DDVA 1PZTA 2V0IA 2Y4MA 1ON6A 1FXJA 2X60A 1R7UA 1YP2A 2AM3A 3USQA 1VH3A 1O7OA 2XMEA 2Y4JA 1VZXA 1VZTA 1ZJ3A 5CMFX 3U0YA 1JYLA 2BO6A 4FRLA 3U2UA 4G3QA 3ZGGA 5EJZA 4EE5A 1ZJOA 4CJBA 1R7TA 1V82A 3V91A 4MYBA 5CQLX 2I5KA 4FROA 1VGWA 1H4EA 4Y7GA 4G3SA 1R80A 2WAWA 1G8OA 1H3MA 4HG6A 3T7MA 3V0NA 2QGIA 2WVKA 4FRPA 4FRBA 2XWMA 1XZ6A 1MC3A 3RSBA 2DPWA 2ICXA 1HM9A 1JV1A 2RITA 4ASYA 5C8RA 4EVWA 4Y64A 3T7OA 5HS2A 3SXGA 4Y62A 5C4FA 4CJCA 2O1FA 2D0JA 2Q4JA 5CMHA 1HJLA 4C2SA 1G3LA 1WT2A 4Y9XA 1ZI4A 2VSIA 2X5ZA 1NMMB 1E5KA 2V0JA 2ICYA 3OC9A 3PNNA 3SXBA 3SXEA 1R7VA 1LZ0A 1VICA 3SX5A 2AE7A 5C3AA 4JD0A 1ZHJA 3ZLKA 3SPTA 1LZ7A 3TZTA 2Y6PA 4KT7A 1G95A 1H5RB 3V0MA 3CKVA 3V8YA 4Y7UA 2PGYA 1FGXA 2XWLA 3BCVA 1ON8A 4B42A 2UX8A 1OQMB 3SX8A 5CQPA 3SXAA 2BO4A 1FWYA 1H5TA 2RJ7A 4M2BA 1EYRA 5AJPA 4G87A 4D0TA 4ARWA 3GUEA 5I1FA 2AESA 3FWWA 1QWJA 3SX3A 2FY7A 3HL3A 5J49A 2W0WA 1G93A 1H7QA 1G9RA 1H7HA 4DE7A 5CMJA 2YQSA 4HO6A 2VS5A 4EEGA 4HO8A 4AYJA 3R3IA 4M28A 1ZI3A 2FFUA 3I0EA 4HO2A 2FYDB 4FRHA 4EE3A 2W0VA 3ZLLA 1WT1A 1GQ9A 4NAIA 1WT3A 3I0FA 1WVCA 4XWIA 2BO8A 2JCJA 2YQCA 3D8VA 5AJOA 1TZFA 3FOQA 4YS8A 5C47A 3OGZA 1H5SC 1LZJA 2I7BA 1MP5A 4KC1A 4AAWA 2FYBA 2Y4KA 4KNRA 2RJ5A 2JCOA 5C48A
chains in the Genus database with same CATH superfamily
2VFZA 1FO8A 4FRMA 1ZCUA 4FCEA 3ZGFA 4R7PA 1VGTA 1INIA 2QH5A 1R81A 1ZJPA 3RMWA 1ZI5A 2VSHA 2WGZA 3ST8A 2V0HA 3DJ4A 4ECMA 1FO9A 2E3DA 3OKRA 1HV9A 1HM8A 4ZDQA 2Y7AA 4HO9A 2RJ9A 1ZCYA 4KPXA 2E8BA 1ZDGA 1MP3A 1INJA 4B2XA 1YP3A 1ZCTA 1TW1A 4BMAA 3I0GA 1IINA 2OI7A 4FRQA 4B3UA 4P00A 1ZJ0A 4FQWA 3OH1A 5C49A 1EZIA 2GGOA 5IDSA 1LVWA 5C1LA 1HJJA 1I52A 1W77A 4LW3A 3F1CA 3CKOA 1K4VA 1JYKA 1VGUA 5FU0A 2O1HA 3E25A 2AH9A 1VM8A 5C1GA 4KNXA 2BO7A 2RJ8A 3CU0A 1H5SD 1WSZA 3SXDA 1ZI1A 3I0KA 4FRAA 1H5SB 4AYLA 1H5SA 1W57A 1H7TA 3V0PA 4HO3A 3OAMA 1MP4A 3K8DA 2WEEA 4IRQA 3T7NA 2RJ4A 4CJ8A 1TVYA 4UEGA 2OI5A 4D48A 5C4EA 1JVDA 4MIXA 4O6MA 2JCLA 2XMHA 3U2WA 4D11C 2ZU9A 3SX7A 1VPAA 5IDTA 1H5TB 2X5SA 3Q7UA 4M2AA 1SS9A 3I0CA 4HCQA 3IOIA 1LL0A 4IRPA 1QGQA 4O6NA 2YQHA 4Y7VA 5FUHA 4NANA 5L6VA 3F1YA 1VGZA 2FYCB 4LW6A 1FZWA 3JUKA 4MNDA 2RJ1A 1VH1A 3OH4A 4B4GA 5C4CA 5C3BA 3V0LA 2OEFA 1GWWA 3U0XA 1GX4A 1OMZA 3ZF8A 4EEAA 5IFYA 4HOCA 1G0RA 3K8EA 4B2WA 3LW6A 1NKHB 2YC5A 1KWSA 2P6WA 2ZU8A 2O1GA 1NWGB 2P72A 5FU8A 1ZJ1A 3DK5A 1PZYB 4K6RA 2J0BA 5CQOA 3V0OA 2Y4LA 3D5NA 4JISA 4B5BA 1O7QA 3BRKX 3IOJA 1GQCA 3JUJA 2GGQA 3I0LA 1QGSA 1H7GA 2YCMA 2QKXA 2RIXA 3SXCA 3USRA 3U2TA 1OMXA 3OH3A 2VD4A 5EJ1A 4B4MA 4KC4A 4HO4A 4KPZA 1ZDFA 2WVMA 5FTVA 2FFVA 1ZJ2A 1S4PA 3V0QA 4EEMA 3QVBA 5EIYA 2A8WA 2V0LA 3D98A 2ZU7A 2VK9A 2WE9A 5DDTA 1V84A 4D11A 3IOHA 1H4DA 5C36A 1G1LA 3I0DA 4NAKA 1G97A 1FG5N 1H7LA 4AC3A 1VZUA 5JQQA 3Q80A 3CKNA 2Z87A 5CQNX 5CMGX 4E1KA 1GA8A 1S4OA 1G2VA 3CGXA 4HO5A 3KIAA 2APCA 2NXVA 4J18A 1LL2A 2PX7A 3POLA 4KRVA 2JCKA 2AM4A 3I0JA 4GBPA 3JTJA 1WT0A 2X65A 4DDZA 5C1HA 5CQMX 1G23A 2AGDA 1H7EA 3PKPA 3I0HA 4ASJA 1HM0A 4DECA 2OI6A 1JVGA 4M4KA 1YP4A 2YC3A 3Q4SA 2FYAA 2J0AA 2PGVA 2D7RA 1FXOA 1LL3A 2AECA 3OH2A 5BXCA 4EEOA 3CKJA 2WVLA 4FIYA 1W55A 4B4BA 4Y63A 2OEGA 3V8ZA 1FRWA 2VS3A 1FR9A 2VXLA 3CKQA 2VXMA 4Y7TA 5AJNA 1O23B 2I5EA 4Y7FA 4KC2A 5FTSA 2V0KA 1NHEB 1FR8A 1Z90A 2RJ0A 1O0RA 4BQHA 4P02A 1R82A 2YQJA 1H5RA 1S4NA 3E26A 1FOAA 2RJ6A 3N9WA 2MZBA 2CU2A 3R2WA 3RMVA 1GX0A 5C38A 3U2XA 4D0ZA 4EE4A 2Z86A 2VS4A 1QG8A 2XWNA 1GWVA 3PKQA 5C4DA 1NF5B 2PA4A 2D7IA 4L41C 3O3PA 1R7YA 4FRDA 5CMIA 2RIZA 1ZIZA 1R7XA 1IIMA 3U2VA 4FREA 1JV3A 4HO0A 4KXOA 2A8UA 4G3PA 2P73A 5D92A 1H7FA 2AM5A 2RIYA 5C3DA 3EE5A 1YROB 5D91A 1TW5A 3DUVA 1V83A 1FGGA 2C0NA 5FYEA 3V90A 4KQLA 1LZIA 4Y6NA 5FV9A 3OH0A 1NQIB 3TQDA 4NALA 3NGWA 2YESA 1H4CA 1XHBA 4FIXA 5C4BA 5L6SA 4CVHA 4Y6UA 4FCUA 1ZCVA 3I0IX 5DDVA 1PZTA 2V0IA 2Y4MA 1ON6A 1FXJA 2X60A 1R7UA 1YP2A 2AM3A 3USQA 1VH3A 1O7OA 2XMEA 2Y4JA 1VZXA 1VZTA 1ZJ3A 5CMFX 3U0YA 1JYLA 2BO6A 4FRLA 3U2UA 4G3QA 3ZGGA 5EJZA 4EE5A 1ZJOA 4CJBA 1R7TA 1V82A 3V91A 4MYBA 5CQLX 2I5KA 4FROA 1VGWA 1H4EA 4Y7GA 4G3SA 1R80A 2WAWA 1G8OA 1H3MA 4HG6A 3T7MA 3V0NA 2QGIA 2WVKA 4FRPA 4FRBA 2XWMA 1XZ6A 1MC3A 3RSBA 2DPWA 2ICXA 1HM9A 1JV1A 2RITA 4ASYA 5C8RA 4EVWA 4Y64A 3T7OA 4Q7CA 5HS2A 3SXGA 4Y62A 5C4FA 4CJCA 2O1FA 2D0JA 2Q4JA 5CMHA 1HJLA 4C2SA 1G3LA 1WT2A 4Y9XA 1ZI4A 2VSIA 2X5ZA 1NMMB 1E5KA 2V0JA 2ICYA 3OC9A 3PNNA 3SXBA 3SXEA 1R7VA 1LZ0A 1VICA 3SX5A 2AE7A 5C3AA 4JD0A 1ZHJA 3ZLKA 3SPTA 1LZ7A 3TZTA 2Y6PA 4KT7A 1G95A 1H5RB 3V0MA 3CKVA 3V8YA 4Y7UA 2PGYA 1FGXA 2XWLA 3BCVA 1ON8A 4B42A 2UX8A 1OQMB 3SX8A 5CQPA 3SXAA 2BO4A 1FWYA 1H5TA 2RJ7A 4M2BA 1EYRA 5AJPA 4G87A 4D0TA 4ARWA 3GUEA 5I1FA 2AESA 3FWWA 1QWJA 3SX3A 2FY7A 3HL3A 5J49A 2W0WA 1G93A 1H7QA 1G9RA 1H7HA 4DE7A 5CMJA 2YQSA 4HO6A 2VS5A 4EEGA 4HO8A 4AYJA 3R3IA 4M28A 1ZI3A 2FFUA 3I0EA 4HO2A 2FYDB 4FRHA 4EE3A 2W0VA 3ZLLA 1WT1A 1GQ9A 4NAIA 1WT3A 3I0FA 1WVCA 4XWIA 2BO8A 2JCJA 2YQCA 3D8VA 5AJOA 1TZFA 3FOQA 4YS8A 5C47A 3OGZA 1H5SC 1LZJA 2I7BA 1MP5A 4KC1A 4AAWA 2FYBA 2Y4KA 4KNRA 2RJ5A 2JCOA 5C48A
chains in the Genus database with same CATH topology
2VFZA 1FO8A 4FRMA 1ZCUA 4FCEA 3ZGFA 4R7PA 1VGTA 1INIA 2QH5A 1R81A 1ZJPA 3RMWA 1ZI5A 2VSHA 2WGZA 3ST8A 2V0HA 3DJ4A 4ECMA 1FO9A 2E3DA 3OKRA 1HV9A 1HM8A 4ZDQA 2Y7AA 4HO9A 2RJ9A 1ZCYA 4KPXA 2E8BA 1ZDGA 1MP3A 1INJA 4B2XA 1YP3A 1ZCTA 1TW1A 4BMAA 3I0GA 1IINA 2OI7A 4FRQA 4B3UA 4P00A 1ZJ0A 4FQWA 3OH1A 5C49A 1EZIA 2GGOA 5IDSA 1LVWA 5C1LA 1HJJA 1I52A 1W77A 4LW3A 3F1CA 3CKOA 1K4VA 1JYKA 1VGUA 5FU0A 2O1HA 3E25A 2AH9A 1VM8A 5C1GA 4KNXA 2BO7A 2RJ8A 3CU0A 1H5SD 1WSZA 3SXDA 1ZI1A 3I0KA 4FRAA 1H5SB 4AYLA 1H5SA 1W57A 1H7TA 3V0PA 4HO3A 3OAMA 1MP4A 3K8DA 2WEEA 4IRQA 3T7NA 2RJ4A 4CJ8A 1TVYA 4UEGA 2OI5A 4D48A 5C4EA 1JVDA 4MIXA 4O6MA 2JCLA 2XMHA 3U2WA 4D11C 2ZU9A 3SX7A 1VPAA 5IDTA 1H5TB 2X5SA 3Q7UA 4M2AA 1SS9A 3I0CA 4HCQA 3IOIA 1LL0A 4IRPA 1QGQA 4O6NA 2YQHA 4Y7VA 5FUHA 4NANA 5L6VA 3F1YA 1VGZA 2FYCB 4LW6A 1FZWA 3JUKA 4MNDA 2RJ1A 1VH1A 3OH4A 4B4GA 5C4CA 5C3BA 3V0LA 2OEFA 1GWWA 3U0XA 1GX4A 1OMZA 3ZF8A 4EEAA 5IFYA 4HOCA 1G0RA 3K8EA 4B2WA 3LW6A 1NKHB 2YC5A 1KWSA 2P6WA 2ZU8A 2O1GA 1NWGB 2P72A 5FU8A 1ZJ1A 3DK5A 1PZYB 4K6RA 2J0BA 5CQOA 3V0OA 2Y4LA 3D5NA 4JISA 4B5BA 1O7QA 3BRKX 3IOJA 1GQCA 3JUJA 2GGQA 3I0LA 1QGSA 1H7GA 2YCMA 2QKXA 2RIXA 3SXCA 3USRA 3U2TA 1OMXA 3OH3A 2VD4A 5EJ1A 4B4MA 4KC4A 4HO4A 4KPZA 1ZDFA 2WVMA 5FTVA 2FFVA 1ZJ2A 1S4PA 3V0QA 4EEMA 3QVBA 5EIYA 2A8WA 2V0LA 3D98A 2ZU7A 2VK9A 2WE9A 5DDTA 1V84A 4D11A 3IOHA 1H4DA 5C36A 1G1LA 3I0DA 4NAKA 1G97A 1FG5N 1H7LA 4AC3A 1VZUA 5JQQA 3Q80A 3CKNA 2Z87A 5CQNX 5CMGX 4E1KA 1GA8A 1S4OA 1G2VA 3CGXA 4HO5A 3KIAA 2APCA 2NXVA 4J18A 1LL2A 2PX7A 3POLA 4KRVA 2JCKA 2AM4A 3I0JA 4GBPA 3JTJA 1WT0A 2X65A 4DDZA 5C1HA 5CQMX 1G23A 2AGDA 1H7EA 3PKPA 3I0HA 4ASJA 1HM0A 4DECA 2OI6A 1JVGA 4M4KA 1YP4A 2YC3A 3Q4SA 2FYAA 2J0AA 2PGVA 2D7RA 1FXOA 1LL3A 2AECA 3OH2A 5BXCA 4EEOA 3CKJA 2WVLA 4FIYA 1W55A 4B4BA 4Y63A 2OEGA 3V8ZA 1FRWA 2VS3A 1FR9A 2VXLA 3CKQA 2VXMA 4Y7TA 5AJNA 1O23B 2I5EA 4Y7FA 4KC2A 5FTSA 2V0KA 1NHEB 1FR8A 1Z90A 2RJ0A 1O0RA 4BQHA 4P02A 1R82A 2YQJA 1H5RA 1S4NA 3E26A 1FOAA 2RJ6A 3N9WA 2MZBA 2CU2A 3R2WA 3RMVA 1GX0A 5C38A 3U2XA 4D0ZA 4EE4A 2Z86A 2VS4A 1QG8A 2XWNA 1GWVA 3PKQA 5C4DA 1NF5B 2PA4A 2D7IA 4L41C 3O3PA 1R7YA 4FRDA 5CMIA 2RIZA 1ZIZA 1R7XA 1IIMA 3U2VA 4FREA 1JV3A 4HO0A 4KXOA 2A8UA 4G3PA 2P73A 5D92A 1H7FA 2AM5A 2RIYA 5C3DA 3EE5A 1YROB 5D91A 1TW5A 3DUVA 1V83A 1FGGA 2C0NA 5FYEA 3V90A 4KQLA 1LZIA 4Y6NA 5FV9A 3OH0A 1NQIB 3TQDA 4NALA 3NGWA 2YESA 1H4CA 1XHBA 4FIXA 5C4BA 5L6SA 4CVHA 4Y6UA 4FCUA 1ZCVA 3I0IX 5DDVA 1PZTA 2V0IA 2Y4MA 1ON6A 1FXJA 2X60A 1R7UA 1YP2A 2AM3A 3USQA 1VH3A 1O7OA 2XMEA 2Y4JA 1VZXA 1VZTA 1ZJ3A 5CMFX 3U0YA 1JYLA 2BO6A 4FRLA 3U2UA 4G3QA 3ZGGA 5EJZA 4EE5A 1ZJOA 4CJBA 1R7TA 1V82A 3V91A 4MYBA 5CQLX 2I5KA 4FROA 1VGWA 1H4EA 4Y7GA 4G3SA 1R80A 2WAWA 1G8OA 1H3MA 4HG6A 3T7MA 3V0NA 2QGIA 2WVKA 4FRPA 4FRBA 2XWMA 1XZ6A 1MC3A 3RSBA 2DPWA 2ICXA 1HM9A 1JV1A 2RITA 4ASYA 5C8RA 4EVWA 4Y64A 3T7OA 4Q7CA 5HS2A 3SXGA 4Y62A 5C4FA 4CJCA 2O1FA 2D0JA 2Q4JA 5CMHA 1HJLA 4C2SA 1G3LA 1WT2A 4Y9XA 1ZI4A 2VSIA 2X5ZA 1NMMB 1E5KA 2V0JA 2ICYA 3OC9A 3PNNA 3SXBA 3SXEA 1R7VA 1LZ0A 1VICA 3SX5A 2AE7A 5C3AA 4JD0A 1ZHJA 3ZLKA 3SPTA 1LZ7A 3TZTA 2Y6PA 4KT7A 1G95A 1H5RB 3V0MA 3CKVA 3V8YA 4Y7UA 2PGYA 1FGXA 2XWLA 3BCVA 1ON8A 4B42A 2UX8A 1OQMB 3SX8A 5CQPA 3SXAA 2BO4A 1FWYA 1H5TA 2RJ7A 4M2BA 1EYRA 5AJPA 4G87A 4D0TA 4ARWA 3GUEA 5I1FA 2AESA 3FWWA 1QWJA 3SX3A 2FY7A 3HL3A 5J49A 2W0WA 1G93A 1H7QA 1G9RA 1H7HA 4DE7A 5CMJA 2YQSA 4HO6A 2VS5A 4EEGA 4HO8A 4AYJA 3R3IA 4M28A 1ZI3A 2FFUA 3I0EA 4HO2A 2FYDB 4FRHA 4EE3A 2W0VA 3ZLLA 1WT1A 1GQ9A 4NAIA 1WT3A 3I0FA 1WVCA 4XWIA 2BO8A 2JCJA 2YQCA 3D8VA 5AJOA 1TZFA 3FOQA 4YS8A 5C47A 3OGZA 1H5SC 1LZJA 2I7BA 1MP5A 4KC1A 4AAWA 2FYBA 2Y4KA 4KNRA 2RJ5A 2JCOA 5C48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFZ A;  1FO8 A;  4FRM A;  1ZCU A;  4FCE A;  3ZGF A;  4R7P A;  1VGT A;  1INI A;  2QH5 A;  1R81 A;  1ZJP A;  3RMW A;  1ZI5 A;  2VSH A;  2WGZ A;  3ST8 A;  2V0H A;  3DJ4 A;  4ECM A;  1FO9 A;  2E3D A;  3OKR A;  1HV9 A;  1HM8 A;  4ZDQ A;  2Y7A A;  4HO9 A;  2RJ9 A;  1ZCY A;  4KPX A;  2E8B A;  1ZDG A;  1MP3 A;  1INJ A;  4B2X A;  1YP3 A;  1ZCT A;  1TW1 A;  4BMA A;  3I0G A;  1IIN A;  2OI7 A;  4FRQ A;  4B3U A;  4P00 A;  1ZJ0 A;  4FQW A;  3OH1 A;  5C49 A;  1EZI A;  2GGO A;  5IDS A;  1LVW A;  5C1L A;  1HJJ A;  1I52 A;  1W77 A;  4LW3 A;  3F1C A;  3CKO A;  1K4V A;  1JYK A;  1VGU A;  5FU0 A;  2O1H A;  3E25 A;  2AH9 A;  1VM8 A;  5C1G A;  4KNX A;  2BO7 A;  2RJ8 A;  3CU0 A;  1H5S D;  1WSZ A;  3SXD A;  1ZI1 A;  3I0K A;  4FRA A;  1H5S B;  4AYL A;  1H5S A;  1W57 A;  1H7T A;  3V0P A;  4HO3 A;  3OAM A;  1MP4 A;  3K8D A;  2WEE A;  4IRQ A;  3T7N A;  2RJ4 A;  4CJ8 A;  1TVY A;  4UEG A;  2OI5 A;  4D48 A;  5C4E A;  1JVD A;  2JCL A;  2XMH A;  3U2W A;  4D11 C;  2ZU9 A;  3SX7 A;  1VPA A;  5IDT A;  1H5T B;  2X5S A;  3Q7U A;  4M2A A;  1SS9 A;  3I0C A;  4HCQ A;  3IOI A;  1LL0 A;  4IRP A;  1QGQ A;  2YQH A;  4Y7V A;  5FUH A;  4NAN A;  5L6V A;  3F1Y A;  1VGZ A;  2FYC B;  4LW6 A;  1FZW A;  3JUK A;  4MND A;  2RJ1 A;  1VH1 A;  3OH4 A;  4B4G A;  5C4C A;  5C3B A;  3V0L A;  2OEF A;  1GWW A;  3U0X A;  1GX4 A;  1OMZ A;  3ZF8 A;  4EEA A;  5IFY A;  4HOC A;  1G0R A;  3K8E A;  4B2W A;  3LW6 A;  1NKH B;  2YC5 A;  1KWS A;  2P6W A;  2ZU8 A;  2O1G A;  1NWG B;  2P72 A;  5FU8 A;  1ZJ1 A;  3DK5 A;  1PZY B;  4K6R A;  5CQO A;  3V0O A;  2Y4L A;  3D5N A;  4JIS A;  4B5B A;  1O7Q A;  3BRK X;  3IOJ A;  1GQC A;  3JUJ A;  2GGQ A;  3I0L A;  1QGS A;  1H7G A;  2YCM A;  2QKX A;  2RIX A;  3SXC A;  3USR A;  3U2T A;  1OMX A;  3OH3 A;  2VD4 A;  5EJ1 A;  4B4M A;  4KC4 A;  4HO4 A;  4KPZ A;  1ZDF A;  2WVM A;  5FTV A;  2FFV A;  1ZJ2 A;  1S4P A;  3V0Q A;  4EEM A;  3QVB A;  5EIY A;  2A8W A;  2V0L A;  3D98 A;  2ZU7 A;  2WE9 A;  5DDT A;  1V84 A;  4D11 A;  3IOH A;  1H4D A;  5C36 A;  1G1L A;  3I0D A;  4NAK A;  1G97 A;  1FG5 N;  1H7L A;  4AC3 A;  1VZU A;  5JQQ A;  3Q80 A;  3CKN A;  2Z87 A;  5CQN X;  5CMG X;  4E1K A;  1GA8 A;  1S4O A;  1G2V A;  3CGX A;  4HO5 A;  3KIA A;  2APC A;  2NXV A;  4J18 A;  1LL2 A;  2PX7 A;  3POL A;  4KRV A;  2JCK A;  2AM4 A;  3I0J A;  4GBP A;  3JTJ A;  1WT0 A;  2X65 A;  4DDZ A;  5C1H A;  5CQM X;  1G23 A;  2AGD A;  1H7E A;  3PKP A;  3I0H A;  4ASJ A;  1HM0 A;  4DEC A;  2OI6 A;  1JVG A;  4M4K A;  1YP4 A;  2YC3 A;  3Q4S A;  2FYA A;  2PGV A;  2D7R A;  1FXO A;  1LL3 A;  2AEC A;  3OH2 A;  5BXC A;  4EEO A;  3CKJ A;  2WVL A;  1W55 A;  4B4B A;  4Y63 A;  2OEG A;  3V8Z A;  1FRW A;  2VS3 A;  1FR9 A;  2VXL A;  3CKQ A;  2VXM A;  4Y7T A;  5AJN A;  1O23 B;  2I5E A;  4Y7F A;  4KC2 A;  5FTS A;  2V0K A;  1NHE B;  1FR8 A;  1Z90 A;  2RJ0 A;  1O0R A;  4BQH A;  4P02 A;  1R82 A;  2YQJ A;  1H5R A;  1S4N A;  3E26 A;  1FOA A;  2RJ6 A;  3N9W A;  2MZB A;  2CU2 A;  3R2W A;  3RMV A;  1GX0 A;  5C38 A;  3U2X A;  4D0Z A;  4EE4 A;  2Z86 A;  2VS4 A;  1QG8 A;  2XWN A;  1GWV A;  3PKQ A;  5C4D A;  1NF5 B;  2PA4 A;  2D7I A;  4L41 C;  3O3P A;  1R7Y A;  4FRD A;  5CMI A;  2RIZ A;  1ZIZ A;  1R7X A;  1IIM A;  3U2V A;  4FRE A;  1JV3 A;  4HO0 A;  4KXO A;  2A8U A;  4G3P A;  2P73 A;  1H7F A;  2AM5 A;  2RIY A;  5C3D A;  3EE5 A;  1YRO B;  1TW5 A;  3DUV A;  1V83 A;  1FGG A;  5FYE A;  3V90 A;  4KQL A;  1LZI A;  4Y6N A;  5FV9 A;  3OH0 A;  1NQI B;  3TQD A;  4NAL A;  3NGW A;  2YES A;  1H4C A;  1XHB A;  5C4B A;  5L6S A;  4CVH A;  4Y6U A;  4FCU A;  1ZCV A;  3I0I X;  5DDV A;  1PZT A;  2V0I A;  2Y4M A;  1ON6 A;  1FXJ A;  2X60 A;  1R7U A;  1YP2 A;  2AM3 A;  3USQ A;  1VH3 A;  1O7O A;  2XME A;  2Y4J A;  1VZX A;  1VZT A;  1ZJ3 A;  5CMF X;  3U0Y A;  1JYL A;  2BO6 A;  4FRL A;  3U2U A;  4G3Q A;  3ZGG A;  5EJZ A;  4EE5 A;  1ZJO A;  4CJB A;  1R7T A;  1V82 A;  3V91 A;  4MYB A;  5CQL X;  2I5K A;  4FRO A;  1VGW A;  1H4E A;  4Y7G A;  4G3S A;  1R80 A;  2WAW A;  1G8O A;  1H3M A;  4HG6 A;  3T7M A;  3V0N A;  2QGI A;  2WVK A;  4FRP A;  4FRB A;  2XWM A;  1XZ6 A;  1MC3 A;  3RSB A;  2DPW A;  2ICX A;  1HM9 A;  1JV1 A;  2RIT A;  4ASY A;  5C8R A;  4EVW A;  4Y64 A;  3T7O A;  5HS2 A;  3SXG A;  4Y62 A;  5C4F A;  4CJC A;  2O1F A;  2D0J A;  2Q4J A;  5CMH A;  1HJL A;  4C2S A;  1G3L A;  1WT2 A;  4Y9X A;  1ZI4 A;  2VSI A;  2X5Z A;  1NMM B;  1E5K A;  2V0J A;  2ICY A;  3OC9 A;  3PNN A;  3SXB A;  3SXE A;  1R7V A;  1LZ0 A;  1VIC A;  3SX5 A;  2AE7 A;  5C3A A;  4JD0 A;  1ZHJ A;  3ZLK A;  3SPT A;  1LZ7 A;  3TZT A;  2Y6P A;  4KT7 A;  1G95 A;  1H5R B;  3V0M A;  3CKV A;  3V8Y A;  4Y7U A;  2PGY A;  1FGX A;  2XWL A;  3BCV A;  1ON8 A;  4B42 A;  2UX8 A;  1OQM B;  3SX8 A;  5CQP A;  3SXA A;  2BO4 A;  1FWY A;  1H5T A;  2RJ7 A;  4M2B A;  1EYR A;  5AJP A;  4G87 A;  4D0T A;  4ARW A;  3GUE A;  5I1F A;  2AES A;  3FWW A;  1QWJ A;  3SX3 A;  2FY7 A;  3HL3 A;  5J49 A;  2W0W A;  1G93 A;  1H7Q A;  1G9R A;  1H7H A;  4DE7 A;  5CMJ A;  2YQS A;  4HO6 A;  2VS5 A;  4EEG A;  4HO8 A;  4AYJ A;  3R3I A;  4M28 A;  1ZI3 A;  2FFU A;  3I0E A;  4HO2 A;  2FYD B;  4FRH A;  4EE3 A;  2W0V A;  3ZLL A;  1WT1 A;  1GQ9 A;  4NAI A;  1WT3 A;  3I0F A;  1WVC A;  4XWI A;  2BO8 A;  2JCJ A;  2YQC A;  3D8V A;  5AJO A;  1TZF A;  3FOQ A;  4YS8 A;  5C47 A;  3OGZ A;  1H5S C;  1LZJ A;  2I7B A;  1MP5 A;  4KC1 A;  4AAW A;  2FYB A;  2Y4K A;  4KNR A;  2RJ5 A;  2JCO A;  5C48 A; 
#chains in the Genus database with same CATH topology
 2VFZ A;  1FO8 A;  4FRM A;  1ZCU A;  4FCE A;  3ZGF A;  4R7P A;  1VGT A;  1INI A;  2QH5 A;  1R81 A;  1ZJP A;  3RMW A;  1ZI5 A;  2VSH A;  2WGZ A;  3ST8 A;  2V0H A;  3DJ4 A;  4ECM A;  1FO9 A;  2E3D A;  3OKR A;  1HV9 A;  1HM8 A;  4ZDQ A;  2Y7A A;  4HO9 A;  2RJ9 A;  1ZCY A;  4KPX A;  2E8B A;  1ZDG A;  1MP3 A;  1INJ A;  4B2X A;  1YP3 A;  1ZCT A;  1TW1 A;  4BMA A;  3I0G A;  1IIN A;  2OI7 A;  4FRQ A;  4B3U A;  4P00 A;  1ZJ0 A;  4FQW A;  3OH1 A;  5C49 A;  1EZI A;  2GGO A;  5IDS A;  1LVW A;  5C1L A;  1HJJ A;  1I52 A;  1W77 A;  4LW3 A;  3F1C A;  3CKO A;  1K4V A;  1JYK A;  1VGU A;  5FU0 A;  2O1H A;  3E25 A;  2AH9 A;  1VM8 A;  5C1G A;  4KNX A;  2BO7 A;  2RJ8 A;  3CU0 A;  1H5S D;  1WSZ A;  3SXD A;  1ZI1 A;  3I0K A;  4FRA A;  1H5S B;  4AYL A;  1H5S A;  1W57 A;  1H7T A;  3V0P A;  4HO3 A;  3OAM A;  1MP4 A;  3K8D A;  2WEE A;  4IRQ A;  3T7N A;  2RJ4 A;  4CJ8 A;  1TVY A;  4UEG A;  2OI5 A;  4D48 A;  5C4E A;  1JVD A;  4MIX A;  4O6M A;  2JCL A;  2XMH A;  3U2W A;  4D11 C;  2ZU9 A;  3SX7 A;  1VPA A;  5IDT A;  1H5T B;  2X5S A;  3Q7U A;  4M2A A;  1SS9 A;  3I0C A;  4HCQ A;  3IOI A;  1LL0 A;  4IRP A;  1QGQ A;  4O6N A;  2YQH A;  4Y7V A;  5FUH A;  4NAN A;  5L6V A;  3F1Y A;  1VGZ A;  2FYC B;  4LW6 A;  1FZW A;  3JUK A;  4MND A;  2RJ1 A;  1VH1 A;  3OH4 A;  4B4G A;  5C4C A;  5C3B A;  3V0L A;  2OEF A;  1GWW A;  3U0X A;  1GX4 A;  1OMZ A;  3ZF8 A;  4EEA A;  5IFY A;  4HOC A;  1G0R A;  3K8E A;  4B2W A;  3LW6 A;  1NKH B;  2YC5 A;  1KWS A;  2P6W A;  2ZU8 A;  2O1G A;  1NWG B;  2P72 A;  5FU8 A;  1ZJ1 A;  3DK5 A;  1PZY B;  4K6R A;  2J0B A;  5CQO A;  3V0O A;  2Y4L A;  3D5N A;  4JIS A;  4B5B A;  1O7Q A;  3BRK X;  3IOJ A;  1GQC A;  3JUJ A;  2GGQ A;  3I0L A;  1QGS A;  1H7G A;  2YCM A;  2QKX A;  2RIX A;  3SXC A;  3USR A;  3U2T A;  1OMX A;  3OH3 A;  2VD4 A;  5EJ1 A;  4B4M A;  4KC4 A;  4HO4 A;  4KPZ A;  1ZDF A;  2WVM A;  5FTV A;  2FFV A;  1ZJ2 A;  1S4P A;  3V0Q A;  4EEM A;  3QVB A;  5EIY A;  2A8W A;  2V0L A;  3D98 A;  2ZU7 A;  2VK9 A;  2WE9 A;  5DDT A;  1V84 A;  4D11 A;  3IOH A;  1H4D A;  5C36 A;  1G1L A;  3I0D A;  4NAK A;  1G97 A;  1FG5 N;  1H7L A;  4AC3 A;  1VZU A;  5JQQ A;  3Q80 A;  3CKN A;  2Z87 A;  5CQN X;  5CMG X;  4E1K A;  1GA8 A;  1S4O A;  1G2V A;  3CGX A;  4HO5 A;  3KIA A;  2APC A;  2NXV A;  4J18 A;  1LL2 A;  2PX7 A;  3POL A;  4KRV A;  2JCK A;  2AM4 A;  3I0J A;  4GBP A;  3JTJ A;  1WT0 A;  2X65 A;  4DDZ A;  5C1H A;  5CQM X;  1G23 A;  2AGD A;  1H7E A;  3PKP A;  3I0H A;  4ASJ A;  1HM0 A;  4DEC A;  2OI6 A;  1JVG A;  4M4K A;  1YP4 A;  2YC3 A;  3Q4S A;  2FYA A;  2J0A A;  2PGV A;  2D7R A;  1FXO A;  1LL3 A;  2AEC A;  3OH2 A;  5BXC A;  4EEO A;  3CKJ A;  2WVL A;  4FIY A;  1W55 A;  4B4B A;  4Y63 A;  2OEG A;  3V8Z A;  1FRW A;  2VS3 A;  1FR9 A;  2VXL A;  3CKQ A;  2VXM A;  4Y7T A;  5AJN A;  1O23 B;  2I5E A;  4Y7F A;  4KC2 A;  5FTS A;  2V0K A;  1NHE B;  1FR8 A;  1Z90 A;  2RJ0 A;  1O0R A;  4BQH A;  4P02 A;  1R82 A;  2YQJ A;  1H5R A;  1S4N A;  3E26 A;  1FOA A;  2RJ6 A;  3N9W A;  2MZB A;  2CU2 A;  3R2W A;  3RMV A;  1GX0 A;  5C38 A;  3U2X A;  4D0Z A;  4EE4 A;  2Z86 A;  2VS4 A;  1QG8 A;  2XWN A;  1GWV A;  3PKQ A;  5C4D A;  1NF5 B;  2PA4 A;  2D7I A;  4L41 C;  3O3P A;  1R7Y A;  4FRD A;  5CMI A;  2RIZ A;  1ZIZ A;  1R7X A;  1IIM A;  3U2V A;  4FRE A;  1JV3 A;  4HO0 A;  4KXO A;  2A8U A;  4G3P A;  2P73 A;  5D92 A;  1H7F A;  2AM5 A;  2RIY A;  5C3D A;  3EE5 A;  1YRO B;  5D91 A;  1TW5 A;  3DUV A;  1V83 A;  1FGG A;  2C0N A;  5FYE A;  3V90 A;  4KQL A;  1LZI A;  4Y6N A;  5FV9 A;  3OH0 A;  1NQI B;  3TQD A;  4NAL A;  3NGW A;  2YES A;  1H4C A;  1XHB A;  4FIX A;  5C4B A;  5L6S A;  4CVH A;  4Y6U A;  4FCU A;  1ZCV A;  3I0I X;  5DDV A;  1PZT A;  2V0I A;  2Y4M A;  1ON6 A;  1FXJ A;  2X60 A;  1R7U A;  1YP2 A;  2AM3 A;  3USQ A;  1VH3 A;  1O7O A;  2XME A;  2Y4J A;  1VZX A;  1VZT A;  1ZJ3 A;  5CMF X;  3U0Y A;  1JYL A;  2BO6 A;  4FRL A;  3U2U A;  4G3Q A;  3ZGG A;  5EJZ A;  4EE5 A;  1ZJO A;  4CJB A;  1R7T A;  1V82 A;  3V91 A;  4MYB A;  5CQL X;  2I5K A;  4FRO A;  1VGW A;  1H4E A;  4Y7G A;  4G3S A;  1R80 A;  2WAW A;  1G8O A;  1H3M A;  4HG6 A;  3T7M A;  3V0N A;  2QGI A;  2WVK A;  4FRP A;  4FRB A;  2XWM A;  1XZ6 A;  1MC3 A;  3RSB A;  2DPW A;  2ICX A;  1HM9 A;  1JV1 A;  2RIT A;  4ASY A;  5C8R A;  4EVW A;  4Y64 A;  3T7O A;  4Q7C A;  5HS2 A;  3SXG A;  4Y62 A;  5C4F A;  4CJC A;  2O1F A;  2D0J A;  2Q4J A;  5CMH A;  1HJL A;  4C2S A;  1G3L A;  1WT2 A;  4Y9X A;  1ZI4 A;  2VSI A;  2X5Z A;  1NMM B;  1E5K A;  2V0J A;  2ICY A;  3OC9 A;  3PNN A;  3SXB A;  3SXE A;  1R7V A;  1LZ0 A;  1VIC A;  3SX5 A;  2AE7 A;  5C3A A;  4JD0 A;  1ZHJ A;  3ZLK A;  3SPT A;  1LZ7 A;  3TZT A;  2Y6P A;  4KT7 A;  1G95 A;  1H5R B;  3V0M A;  3CKV A;  3V8Y A;  4Y7U A;  2PGY A;  1FGX A;  2XWL A;  3BCV A;  1ON8 A;  4B42 A;  2UX8 A;  1OQM B;  3SX8 A;  5CQP A;  3SXA A;  2BO4 A;  1FWY A;  1H5T A;  2RJ7 A;  4M2B A;  1EYR A;  5AJP A;  4G87 A;  4D0T A;  4ARW A;  3GUE A;  5I1F A;  2AES A;  3FWW A;  1QWJ A;  3SX3 A;  2FY7 A;  3HL3 A;  5J49 A;  2W0W A;  1G93 A;  1H7Q A;  1G9R A;  1H7H A;  4DE7 A;  5CMJ A;  2YQS A;  4HO6 A;  2VS5 A;  4EEG A;  4HO8 A;  4AYJ A;  3R3I A;  4M28 A;  1ZI3 A;  2FFU A;  3I0E A;  4HO2 A;  2FYD B;  4FRH A;  4EE3 A;  2W0V A;  3ZLL A;  1WT1 A;  1GQ9 A;  4NAI A;  1WT3 A;  3I0F A;  1WVC A;  4XWI A;  2BO8 A;  2JCJ A;  2YQC A;  3D8V A;  5AJO A;  1TZF A;  3FOQ A;  4YS8 A;  5C47 A;  3OGZ A;  1H5S C;  1LZJ A;  2I7B A;  1MP5 A;  4KC1 A;  4AAW A;  2FYB A;  2Y4K A;  4KNR A;  2RJ5 A;  2JCO A;  5C48 A; 
#chains in the Genus database with same CATH homology
 2VFZ A;  1FO8 A;  4FRM A;  1ZCU A;  4FCE A;  3ZGF A;  4R7P A;  1VGT A;  1INI A;  2QH5 A;  1R81 A;  1ZJP A;  3RMW A;  1ZI5 A;  2VSH A;  2WGZ A;  3ST8 A;  2V0H A;  3DJ4 A;  4ECM A;  1FO9 A;  2E3D A;  3OKR A;  1HV9 A;  1HM8 A;  4ZDQ A;  2Y7A A;  4HO9 A;  2RJ9 A;  1ZCY A;  4KPX A;  2E8B A;  1ZDG A;  1MP3 A;  1INJ A;  4B2X A;  1YP3 A;  1ZCT A;  1TW1 A;  4BMA A;  3I0G A;  1IIN A;  2OI7 A;  4FRQ A;  4B3U A;  4P00 A;  1ZJ0 A;  4FQW A;  3OH1 A;  5C49 A;  1EZI A;  2GGO A;  5IDS A;  1LVW A;  5C1L A;  1HJJ A;  1I52 A;  1W77 A;  4LW3 A;  3F1C A;  3CKO A;  1K4V A;  1JYK A;  1VGU A;  5FU0 A;  2O1H A;  3E25 A;  2AH9 A;  1VM8 A;  5C1G A;  4KNX A;  2BO7 A;  2RJ8 A;  3CU0 A;  1H5S D;  1WSZ A;  3SXD A;  1ZI1 A;  3I0K A;  4FRA A;  1H5S B;  4AYL A;  1H5S A;  1W57 A;  1H7T A;  3V0P A;  4HO3 A;  3OAM A;  1MP4 A;  3K8D A;  2WEE A;  4IRQ A;  3T7N A;  2RJ4 A;  4CJ8 A;  1TVY A;  4UEG A;  2OI5 A;  4D48 A;  5C4E A;  1JVD A;  4MIX A;  4O6M A;  2JCL A;  2XMH A;  3U2W A;  4D11 C;  2ZU9 A;  3SX7 A;  1VPA A;  5IDT A;  1H5T B;  2X5S A;  3Q7U A;  4M2A A;  1SS9 A;  3I0C A;  4HCQ A;  3IOI A;  1LL0 A;  4IRP A;  1QGQ A;  4O6N A;  2YQH A;  4Y7V A;  5FUH A;  4NAN A;  5L6V A;  3F1Y A;  1VGZ A;  2FYC B;  4LW6 A;  1FZW A;  3JUK A;  4MND A;  2RJ1 A;  1VH1 A;  3OH4 A;  4B4G A;  5C4C A;  5C3B A;  3V0L A;  2OEF A;  1GWW A;  3U0X A;  1GX4 A;  1OMZ A;  3ZF8 A;  4EEA A;  5IFY A;  4HOC A;  1G0R A;  3K8E A;  4B2W A;  3LW6 A;  1NKH B;  2YC5 A;  1KWS A;  2P6W A;  2ZU8 A;  2O1G A;  1NWG B;  2P72 A;  5FU8 A;  1ZJ1 A;  3DK5 A;  1PZY B;  4K6R A;  2J0B A;  5CQO A;  3V0O A;  2Y4L A;  3D5N A;  4JIS A;  4B5B A;  1O7Q A;  3BRK X;  3IOJ A;  1GQC A;  3JUJ A;  2GGQ A;  3I0L A;  1QGS A;  1H7G A;  2YCM A;  2QKX A;  2RIX A;  3SXC A;  3USR A;  3U2T A;  1OMX A;  3OH3 A;  2VD4 A;  5EJ1 A;  4B4M A;  4KC4 A;  4HO4 A;  4KPZ A;  1ZDF A;  2WVM A;  5FTV A;  2FFV A;  1ZJ2 A;  1S4P A;  3V0Q A;  4EEM A;  3QVB A;  5EIY A;  2A8W A;  2V0L A;  3D98 A;  2ZU7 A;  2VK9 A;  2WE9 A;  5DDT A;  1V84 A;  4D11 A;  3IOH A;  1H4D A;  5C36 A;  1G1L A;  3I0D A;  4NAK A;  1G97 A;  1FG5 N;  1H7L A;  4AC3 A;  1VZU A;  5JQQ A;  3Q80 A;  3CKN A;  2Z87 A;  5CQN X;  5CMG X;  4E1K A;  1GA8 A;  1S4O A;  1G2V A;  3CGX A;  4HO5 A;  3KIA A;  2APC A;  2NXV A;  4J18 A;  1LL2 A;  2PX7 A;  3POL A;  4KRV A;  2JCK A;  2AM4 A;  3I0J A;  4GBP A;  3JTJ A;  1WT0 A;  2X65 A;  4DDZ A;  5C1H A;  5CQM X;  1G23 A;  2AGD A;  1H7E A;  3PKP A;  3I0H A;  4ASJ A;  1HM0 A;  4DEC A;  2OI6 A;  1JVG A;  4M4K A;  1YP4 A;  2YC3 A;  3Q4S A;  2FYA A;  2J0A A;  2PGV A;  2D7R A;  1FXO A;  1LL3 A;  2AEC A;  3OH2 A;  5BXC A;  4EEO A;  3CKJ A;  2WVL A;  4FIY A;  1W55 A;  4B4B A;  4Y63 A;  2OEG A;  3V8Z A;  1FRW A;  2VS3 A;  1FR9 A;  2VXL A;  3CKQ A;  2VXM A;  4Y7T A;  5AJN A;  1O23 B;  2I5E A;  4Y7F A;  4KC2 A;  5FTS A;  2V0K A;  1NHE B;  1FR8 A;  1Z90 A;  2RJ0 A;  1O0R A;  4BQH A;  4P02 A;  1R82 A;  2YQJ A;  1H5R A;  1S4N A;  3E26 A;  1FOA A;  2RJ6 A;  3N9W A;  2MZB A;  2CU2 A;  3R2W A;  3RMV A;  1GX0 A;  5C38 A;  3U2X A;  4D0Z A;  4EE4 A;  2Z86 A;  2VS4 A;  1QG8 A;  2XWN A;  1GWV A;  3PKQ A;  5C4D A;  1NF5 B;  2PA4 A;  2D7I A;  4L41 C;  3O3P A;  1R7Y A;  4FRD A;  5CMI A;  2RIZ A;  1ZIZ A;  1R7X A;  1IIM A;  3U2V A;  4FRE A;  1JV3 A;  4HO0 A;  4KXO A;  2A8U A;  4G3P A;  2P73 A;  5D92 A;  1H7F A;  2AM5 A;  2RIY A;  5C3D A;  3EE5 A;  1YRO B;  5D91 A;  1TW5 A;  3DUV A;  1V83 A;  1FGG A;  2C0N A;  5FYE A;  3V90 A;  4KQL A;  1LZI A;  4Y6N A;  5FV9 A;  3OH0 A;  1NQI B;  3TQD A;  4NAL A;  3NGW A;  2YES A;  1H4C A;  1XHB A;  4FIX A;  5C4B A;  5L6S A;  4CVH A;  4Y6U A;  4FCU A;  1ZCV A;  3I0I X;  5DDV A;  1PZT A;  2V0I A;  2Y4M A;  1ON6 A;  1FXJ A;  2X60 A;  1R7U A;  1YP2 A;  2AM3 A;  3USQ A;  1VH3 A;  1O7O A;  2XME A;  2Y4J A;  1VZX A;  1VZT A;  1ZJ3 A;  5CMF X;  3U0Y A;  1JYL A;  2BO6 A;  4FRL A;  3U2U A;  4G3Q A;  3ZGG A;  5EJZ A;  4EE5 A;  1ZJO A;  4CJB A;  1R7T A;  1V82 A;  3V91 A;  4MYB A;  5CQL X;  2I5K A;  4FRO A;  1VGW A;  1H4E A;  4Y7G A;  4G3S A;  1R80 A;  2WAW A;  1G8O A;  1H3M A;  4HG6 A;  3T7M A;  3V0N A;  2QGI A;  2WVK A;  4FRP A;  4FRB A;  2XWM A;  1XZ6 A;  1MC3 A;  3RSB A;  2DPW A;  2ICX A;  1HM9 A;  1JV1 A;  2RIT A;  4ASY A;  5C8R A;  4EVW A;  4Y64 A;  3T7O A;  4Q7C A;  5HS2 A;  3SXG A;  4Y62 A;  5C4F A;  4CJC A;  2O1F A;  2D0J A;  2Q4J A;  5CMH A;  1HJL A;  4C2S A;  1G3L A;  1WT2 A;  4Y9X A;  1ZI4 A;  2VSI A;  2X5Z A;  1NMM B;  1E5K A;  2V0J A;  2ICY A;  3OC9 A;  3PNN A;  3SXB A;  3SXE A;  1R7V A;  1LZ0 A;  1VIC A;  3SX5 A;  2AE7 A;  5C3A A;  4JD0 A;  1ZHJ A;  3ZLK A;  3SPT A;  1LZ7 A;  3TZT A;  2Y6P A;  4KT7 A;  1G95 A;  1H5R B;  3V0M A;  3CKV A;  3V8Y A;  4Y7U A;  2PGY A;  1FGX A;  2XWL A;  3BCV A;  1ON8 A;  4B42 A;  2UX8 A;  1OQM B;  3SX8 A;  5CQP A;  3SXA A;  2BO4 A;  1FWY A;  1H5T A;  2RJ7 A;  4M2B A;  1EYR A;  5AJP A;  4G87 A;  4D0T A;  4ARW A;  3GUE A;  5I1F A;  2AES A;  3FWW A;  1QWJ A;  3SX3 A;  2FY7 A;  3HL3 A;  5J49 A;  2W0W A;  1G93 A;  1H7Q A;  1G9R A;  1H7H A;  4DE7 A;  5CMJ A;  2YQS A;  4HO6 A;  2VS5 A;  4EEG A;  4HO8 A;  4AYJ A;  3R3I A;  4M28 A;  1ZI3 A;  2FFU A;  3I0E A;  4HO2 A;  2FYD B;  4FRH A;  4EE3 A;  2W0V A;  3ZLL A;  1WT1 A;  1GQ9 A;  4NAI A;  1WT3 A;  3I0F A;  1WVC A;  4XWI A;  2BO8 A;  2JCJ A;  2YQC A;  3D8V A;  5AJO A;  1TZF A;  3FOQ A;  4YS8 A;  5C47 A;  3OGZ A;  1H5S C;  1LZJ A;  2I7B A;  1MP5 A;  4KC1 A;  4AAW A;  2FYB A;  2Y4K A;  4KNR A;  2RJ5 A;  2JCO A;  5C48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...