1VGWA

Crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
212
Chain Sequence
KRKNIALIPAAPKQYVEIGSKTVLEHVLGIFERHEAVDLTVVVVSPEDTFADKVQTAFPQVRVWKNGGQTRAETVRNGVAKLLETGLAAETDNILVHDAARCCLPSEALARLIEQAGNAAEGGILAVPVADTLKRAESGQISATVDRSGLWQAQTPQLFQAGLLHRALAAGITDEASAVEKLGVRPLLIQGDARNLKLTQPQDAYIVRLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 58
structure length 212
sequence length 226
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vgwA00
2ZU7A 3I0DA 4FRPA 2Y6PA 2FYDB 4K6RA 4D11A 3ZLLA 2Y4MA 1H5SA 4HO4A 3OC9A 1VZUA 3I0JA 1NKHB 1ZJOA 3SXDA 4D11C 1H5SC 2AM4A 4HO0A 1INJA 2Y4KA 4M2AA 1PZYB 4EEMA 1H7GA 3CKOA 4DECA 3IOIA 1H7HA 1R7TA 3T7NA 3BRKX 2E8BA 2WVLA 1ZI4A 2YC3A 4KPZA 1GWWA 2RJ9A 1XZ6A 4FREA 4M28A 2O1FA 3I0CA 5C47A 2O1HA 1VPAA 5C1GA 2A8UA 1HM8A 1R7VA 4HOCA 3I0HA 2V0KA 1WT0A 3OKRA 4Y7VA 4HG6A 4ZDQA 2GGQA 1H5SD 1R82A 4CJBA 1H7QA 5DDTA 2V0HA 4HO9A 1R80A 2YQCA 2WAWA 1G93A 2JCJA 5CMGX 3SX5A 3V0PA 1YP3A 1WSZA 2XWMA 4J18A 2RJ4A 3V8YA 2YC5A 1O0RA 1OMZA 1R81A 5C36A 5CQLX 2YQSA 5L6SA 1JVGA 4HO6A 2Z87A 4MYBA 3V90A 1IINA 2DPWA 2FFVA 1NMMB 5CMHA 4FRQA 1JYLA 2ICYA 2A8WA 4Y7FA 2OEGA 5AJOA 4EEGA 5FUHA 1VH3A 2GGOA 4IRPA 3V0OA 3T7OA 4EE5A 1JV1A 1FXOA 1ZJPA 1VGTA 1FGGA 1S4OA 2D7IA 2AGDA 1XHBA 5IDTA 3CU0A 4LW3A 3U2XA 5C3BA 1W77A 4XWIA 1ZCUA 1HJJA 1R7UA 4B3UA 1H7TA 3FWWA 3CKJA 2ZU9A 2ZU8A 3F1YA 3KIAA 2AH9A 4B4BA 4D0ZA 1GWVA 4P02A 1ZI5A 4HO3A 3V8ZA 1ZCYA 2W0WA 4ARWA 3SXAA 2Y7AA 1NF5B 4NAIA 4JD0A 4UEGA 3V91A 3Q4SA 1ZJ2A 1H5RA 2D0JA 1ZIZA 1O7QA 1G97A 3D5NA 1H5SB 3TZTA 5IFYA 2OI7A 5DDVA 5HS2A 1V82A 2VXMA 3OAMA 3I0FA 1WVCA 2OI5A 3CKNA 4EVWA 1ZDFA 4FRDA 5CMJA 3QVBA 3R3IA 1FZWA 1GX0A 3SXBA 5L6VA 1VGWA 4HO8A 2P73A 3ST8A 3ZGFA 4IRQA 1FO8A 3D8VA 1YP4A 1HM0A 3V0LA 1ZJ0A 2Y4JA 1S4NA 1INIA 2VSHA 3ZLKA 2VS3A 1H7FA 3I0KA 1HM9A 1QGQA 1VM8A 4AYJA 2AE7A 3OH2A 4Y7GA 1H4EA 1VICA 4G3QA 4FCEA 1LZJA 2V0JA 2AECA 1HV9A 1O23B 1MC3A 4KT7A 3SXGA 2RJ0A 4Y62A 5C1HA 1Z90A 4AAWA 1TW1A 4KXOA 1LVWA 4EE3A 4FRHA 2JCKA 4NAKA 2XMEA 3F1CA 1W57A 5FU8A 4B4MA 1W55A 1ZJ1A 2VD4A 3HL3A 3PNNA 5C8RA 4DDZA 4FQWA 5CQPA 1EZIA 1WT2A 1ON6A 3DJ4A 1K4VA 1H3MA 4LW6A 4FRMA 2AM3A 2I7BA 1ZI1A 1NWGB 2XMHA 1NHEB 1JV3A 2X5ZA 4CJCA 1FOAA 2I5KA 1FWYA 4ECMA 3SPTA 2V0IA 2W0VA 2BO7A 4FCUA 2AESA 4R7PA 1OQMB 3DK5A 3SXCA 1JVDA 2X5SA 3LW6A 1VGZA 3K8DA 1GX4A 3V0MA 1WT3A 1G23A 5AJPA 4KRVA 5EJZA 3SXEA 5EIYA 2FYBA 4AC3A 5JQQA 2Y4LA 1FGXA 4ASYA 3U2UA 1R7YA 3SX3A 2APCA 4G3SA 5C4EA 3IOHA 4KNXA 1VZXA 3EE5A 5FTVA 3SX7A 3USRA 3JTJA 1H5RB 3OH3A 1GQ9A 2P6WA 3R2WA 1H5TA 1MP5A 2XWNA 2BO4A 1LL0A 2P72A 4B2XA 1MP3A 1FRWA 5C4FA 3N9WA 1YROB 1SS9A 4KC4A 3TQDA 2WGZA 1ZJ3A 4Y6UA 2YQJA 3U0YA 2VS4A 2FYAA 4Y7TA 4CJ8A 2I5EA 4DE7A 4ASJA 3U0XA 3Q80A 5AJNA 2XWLA 5IDSA 1LZ7A 2VFZA 1KWSA 3E25A 2X65A 3U2WA 4KPXA 1V83A 1TVYA 3ZGGA 2JCOA 1G3LA 1LL3A 2JCLA 2NXVA 3O3PA 4AYLA 1OMXA 3SX8A 5FV9A 1H7LA 1HJLA 5FYEA 5CQOA 1ON8A 5FTSA 4YS8A 4EEOA 3CGXA 3PKPA 5CQMX 1H4CA 1ZCTA 1YP2A 5C1LA 2QGIA 3V0QA 2VS5A 4KNRA 1ZDGA 1S4PA 2QH5A 3OH1A 2BO6A 4HO2A 2YESA 5EJ1A 1EYRA 3RSBA 1NQIB 1FG5N 1IIMA 4D48A 1VH1A 2BO8A 1I52A 2RJ5A 4KC2A 4P00A 1TZFA 3BCVA 1G95A 1VZTA 3PKQA 1WT1A 2WEEA 3GUEA 3POLA 2CU2A 2YQHA 3NGWA 3D98A 2YCMA 2RJ7A 3OGZA 3K8EA 1GQCA 2OEFA 2WE9A 2Q4JA 4KC1A 3CKVA 4G3PA 5CMFX 3USQA 2UX8A 1LZ0A 2WVKA 2D7RA 4B4GA 2E3DA 4C2SA 4EEAA 4FRLA 1H7EA 3Q7UA 3I0IX 4BQHA 4GBPA 4FRAA 5CQNX 4HO5A 2O1GA 2Z86A 1GA8A 2RJ1A 3I0EA 5I1FA 2RIZA 1MP4A 3I0GA 2AM5A 1G0RA 4NALA 5CMIA 4Y6NA 1FR9A 3IOJA 5C38A 5C4DA 3U2VA 1FO9A 3RMVA 1H4DA 4EE4A 2WVMA 1H5TB 1LZIA 2VXLA 5BXCA 2VSIA 2RJ6A 2RIXA 1G1LA 4Y9XA 3OH4A 1G9RA 4M2BA 1ZHJA 2PGVA 3OH0A 3JUKA 2RITA 1QWJA 4JISA 4Y7UA 2RIYA 4Y63A 1FXJA 3CKQA 2ICXA 4HCQA 5J49A 5C49A 5C3AA 2PGYA 2FY7A 1PZTA 3RMWA 1TW5A 1O7OA 3JUJA 2FYCB 3V0NA 4L41C 4B5BA 4FROA 1E5KA 4M4KA 1VGUA 4MNDA 1FR8A 3ZF8A 1JYKA 3I0LA 1R7XA 3FOQA 1G8OA 2PA4A 2OI6A 1ZI3A 2QKXA 4E1KA 3E26A 2RJ8A 2V0LA 4FRBA 1QG8A 4BMAA 5C4CA 4CVHA 4G87A 2MZBA 4B2WA 5FU0A 5C4BA 2FFUA 5C48A 4KQLA 1G2VA 1ZCVA 4Y64A 4B42A 4D0TA 3T7MA 3DUVA 3U2TA 2PX7A 2X60A 1LL2A 1QGSA 1V84A 5C3DA 4NANA
chains in the Genus database with same CATH superfamily
2ZU7A 3I0DA 4FRPA 2Y6PA 2FYDB 4K6RA 4D11A 3ZLLA 2Y4MA 1H5SA 4HO4A 3OC9A 1VZUA 3I0JA 1NKHB 1ZJOA 3SXDA 4D11C 1H5SC 2AM4A 4HO0A 1INJA 2Y4KA 4M2AA 1PZYB 4EEMA 1H7GA 3CKOA 4DECA 3IOIA 1H7HA 1R7TA 3T7NA 3BRKX 2E8BA 2WVLA 1ZI4A 2YC3A 4KPZA 1GWWA 2RJ9A 1XZ6A 4FREA 4M28A 2O1FA 3I0CA 5C47A 2O1HA 1VPAA 5C1GA 2A8UA 1HM8A 2C0NA 1R7VA 4HOCA 3I0HA 2V0KA 1WT0A 3OKRA 4Y7VA 4HG6A 4ZDQA 2GGQA 1H5SD 1R82A 4CJBA 1H7QA 5DDTA 4Q7CA 2V0HA 4HO9A 1R80A 2YQCA 2WAWA 1G93A 2JCJA 5CMGX 3SX5A 3V0PA 1YP3A 1WSZA 2XWMA 4J18A 2RJ4A 3V8YA 2YC5A 1O0RA 1OMZA 1R81A 5C36A 5CQLX 2YQSA 2J0AA 5L6SA 1JVGA 4HO6A 2Z87A 4MYBA 3V90A 1IINA 2DPWA 2FFVA 1NMMB 5CMHA 4FRQA 1JYLA 2ICYA 2A8WA 4Y7FA 2OEGA 5AJOA 4EEGA 5FUHA 1VH3A 2GGOA 4IRPA 3V0OA 3T7OA 4EE5A 1JV1A 1FXOA 1ZJPA 1VGTA 1FGGA 1S4OA 2D7IA 2AGDA 1XHBA 5IDTA 4MIXA 3CU0A 4LW3A 3U2XA 5C3BA 1W77A 4XWIA 1ZCUA 1HJJA 1R7UA 4B3UA 5D91A 1H7TA 3FWWA 3CKJA 2ZU9A 2ZU8A 3F1YA 3KIAA 2AH9A 4B4BA 4D0ZA 1GWVA 4P02A 1ZI5A 4HO3A 3V8ZA 1ZCYA 2W0WA 4ARWA 3SXAA 2Y7AA 1NF5B 4NAIA 4JD0A 4UEGA 3V91A 3Q4SA 1ZJ2A 1H5RA 2D0JA 1ZIZA 1O7QA 1G97A 3D5NA 1H5SB 3TZTA 5IFYA 2OI7A 4O6NA 5DDVA 5HS2A 1V82A 2VXMA 3OAMA 3I0FA 1WVCA 2OI5A 3CKNA 4EVWA 1ZDFA 4FRDA 5CMJA 3QVBA 3R3IA 1FZWA 1GX0A 3SXBA 5L6VA 1VGWA 4HO8A 2P73A 3ST8A 3ZGFA 4IRQA 5D92A 1FO8A 3D8VA 1YP4A 1HM0A 3V0LA 1ZJ0A 2Y4JA 1S4NA 1INIA 2VSHA 3ZLKA 2VS3A 1H7FA 3I0KA 1HM9A 1QGQA 1VM8A 4AYJA 2AE7A 3OH2A 4Y7GA 1H4EA 1VICA 4G3QA 4FCEA 1LZJA 2V0JA 2AECA 1HV9A 1O23B 1MC3A 4KT7A 4O6MA 3SXGA 2RJ0A 4FIXA 4Y62A 5C1HA 1Z90A 4AAWA 1TW1A 4KXOA 1LVWA 4EE3A 4FRHA 2JCKA 4NAKA 2XMEA 3F1CA 1W57A 5FU8A 4B4MA 1W55A 1ZJ1A 2VD4A 3HL3A 3PNNA 5C8RA 4DDZA 4FQWA 5CQPA 1EZIA 1WT2A 1ON6A 3DJ4A 1K4VA 1H3MA 4LW6A 4FRMA 2AM3A 2I7BA 1ZI1A 1NWGB 2XMHA 1NHEB 1JV3A 2X5ZA 4CJCA 1FOAA 2I5KA 1FWYA 4ECMA 3SPTA 2V0IA 2W0VA 2BO7A 4FCUA 2AESA 4R7PA 1OQMB 3DK5A 3SXCA 1JVDA 2X5SA 3LW6A 1VGZA 3K8DA 1GX4A 3V0MA 1WT3A 1G23A 5AJPA 4KRVA 5EJZA 3SXEA 5EIYA 2FYBA 4AC3A 5JQQA 2Y4LA 1FGXA 4ASYA 3U2UA 1R7YA 3SX3A 2APCA 4G3SA 5C4EA 3IOHA 4KNXA 1VZXA 3EE5A 5FTVA 3SX7A 3USRA 3JTJA 1H5RB 3OH3A 1GQ9A 2P6WA 3R2WA 1H5TA 1MP5A 2XWNA 2BO4A 1LL0A 2P72A 4B2XA 1MP3A 1FRWA 5C4FA 3N9WA 1YROB 1SS9A 4KC4A 3TQDA 2WGZA 1ZJ3A 4Y6UA 2YQJA 3U0YA 2VS4A 2FYAA 4Y7TA 4CJ8A 2I5EA 4DE7A 4ASJA 3U0XA 3Q80A 5AJNA 2XWLA 5IDSA 1LZ7A 2VFZA 1KWSA 3E25A 2X65A 3U2WA 4KPXA 1V83A 1TVYA 3ZGGA 2JCOA 1G3LA 1LL3A 2JCLA 2NXVA 3O3PA 4AYLA 1OMXA 3SX8A 5FV9A 1H7LA 1HJLA 5FYEA 5CQOA 1ON8A 5FTSA 4YS8A 4EEOA 3CGXA 3PKPA 5CQMX 1H4CA 1ZCTA 1YP2A 5C1LA 2QGIA 3V0QA 2VS5A 4KNRA 1ZDGA 1S4PA 2QH5A 3OH1A 2BO6A 4HO2A 2YESA 5EJ1A 1EYRA 3RSBA 1NQIB 1FG5N 1IIMA 4D48A 1VH1A 2BO8A 1I52A 2RJ5A 4KC2A 4P00A 1TZFA 3BCVA 1G95A 1VZTA 3PKQA 1WT1A 2WEEA 3GUEA 3POLA 2CU2A 2YQHA 3NGWA 3D98A 2YCMA 2RJ7A 3OGZA 3K8EA 1GQCA 2OEFA 2WE9A 2Q4JA 4KC1A 3CKVA 4G3PA 5CMFX 3USQA 2UX8A 1LZ0A 2WVKA 2D7RA 4B4GA 2E3DA 4C2SA 4EEAA 4FRLA 1H7EA 3Q7UA 3I0IX 4BQHA 2VK9A 4GBPA 4FRAA 5CQNX 4HO5A 2O1GA 4FIYA 2Z86A 1GA8A 2RJ1A 3I0EA 5I1FA 2RIZA 1MP4A 3I0GA 2AM5A 1G0RA 4NALA 5CMIA 4Y6NA 1FR9A 3IOJA 5C38A 5C4DA 3U2VA 1FO9A 3RMVA 2J0BA 1H4DA 4EE4A 2WVMA 1H5TB 1LZIA 2VXLA 5BXCA 2VSIA 2RJ6A 2RIXA 1G1LA 4Y9XA 3OH4A 1G9RA 4M2BA 1ZHJA 2PGVA 3OH0A 3JUKA 2RITA 1QWJA 4JISA 4Y7UA 2RIYA 4Y63A 1FXJA 3CKQA 2ICXA 4HCQA 5J49A 5C49A 5C3AA 2PGYA 2FY7A 1PZTA 3RMWA 1TW5A 1O7OA 3JUJA 2FYCB 3V0NA 4L41C 4B5BA 4FROA 1E5KA 4M4KA 1VGUA 4MNDA 1FR8A 3ZF8A 1JYKA 3I0LA 1R7XA 3FOQA 1G8OA 2PA4A 2OI6A 1ZI3A 2QKXA 4E1KA 3E26A 2RJ8A 2V0LA 4FRBA 1QG8A 4BMAA 5C4CA 4CVHA 4G87A 2MZBA 4B2WA 5FU0A 5C4BA 2FFUA 5C48A 4KQLA 1G2VA 1ZCVA 4Y64A 4B42A 4D0TA 3T7MA 3DUVA 3U2TA 2PX7A 2X60A 1LL2A 1QGSA 1V84A 5C3DA 4NANA
chains in the Genus database with same CATH topology
2ZU7A 3I0DA 4FRPA 2Y6PA 2FYDB 4K6RA 4D11A 3ZLLA 2Y4MA 1H5SA 4HO4A 3OC9A 1VZUA 3I0JA 1NKHB 1ZJOA 3SXDA 4D11C 1H5SC 2AM4A 4HO0A 1INJA 2Y4KA 4M2AA 1PZYB 4EEMA 1H7GA 3CKOA 4DECA 3IOIA 1H7HA 1R7TA 3T7NA 3BRKX 2E8BA 2WVLA 1ZI4A 2YC3A 4KPZA 1GWWA 2RJ9A 1XZ6A 4FREA 4M28A 2O1FA 3I0CA 5C47A 2O1HA 1VPAA 5C1GA 2A8UA 1HM8A 2C0NA 1R7VA 4HOCA 3I0HA 2V0KA 1WT0A 3OKRA 4Y7VA 4HG6A 4ZDQA 2GGQA 1H5SD 1R82A 4CJBA 1H7QA 5DDTA 4Q7CA 2V0HA 4HO9A 1R80A 2YQCA 2WAWA 1G93A 2JCJA 5CMGX 3SX5A 3V0PA 1YP3A 1WSZA 2XWMA 4J18A 2RJ4A 3V8YA 2YC5A 1O0RA 1OMZA 1R81A 5C36A 5CQLX 2YQSA 2J0AA 5L6SA 1JVGA 4HO6A 2Z87A 4MYBA 3V90A 1IINA 2DPWA 2FFVA 1NMMB 5CMHA 4FRQA 1JYLA 2ICYA 2A8WA 4Y7FA 2OEGA 5AJOA 4EEGA 5FUHA 1VH3A 2GGOA 4IRPA 3V0OA 3T7OA 4EE5A 1JV1A 1FXOA 1ZJPA 1VGTA 1FGGA 1S4OA 2D7IA 2AGDA 1XHBA 5IDTA 4MIXA 3CU0A 4LW3A 3U2XA 5C3BA 1W77A 4XWIA 1ZCUA 1HJJA 1R7UA 4B3UA 5D91A 1H7TA 3FWWA 3CKJA 2ZU9A 2ZU8A 3F1YA 3KIAA 2AH9A 4B4BA 4D0ZA 1GWVA 4P02A 1ZI5A 4HO3A 3V8ZA 1ZCYA 2W0WA 4ARWA 3SXAA 2Y7AA 1NF5B 4NAIA 4JD0A 4UEGA 3V91A 3Q4SA 1ZJ2A 1H5RA 2D0JA 1ZIZA 1O7QA 1G97A 3D5NA 1H5SB 3TZTA 5IFYA 2OI7A 4O6NA 5DDVA 5HS2A 1V82A 2VXMA 3OAMA 3I0FA 1WVCA 2OI5A 3CKNA 4EVWA 1ZDFA 4FRDA 5CMJA 3QVBA 3R3IA 1FZWA 1GX0A 3SXBA 5L6VA 1VGWA 4HO8A 2P73A 3ST8A 3ZGFA 4IRQA 5D92A 1FO8A 3D8VA 1YP4A 1HM0A 3V0LA 1ZJ0A 2Y4JA 1S4NA 1INIA 2VSHA 3ZLKA 2VS3A 1H7FA 3I0KA 1HM9A 1QGQA 1VM8A 4AYJA 2AE7A 3OH2A 4Y7GA 1H4EA 1VICA 4G3QA 4FCEA 1LZJA 2V0JA 2AECA 1HV9A 1O23B 1MC3A 4KT7A 4O6MA 3SXGA 2RJ0A 4FIXA 4Y62A 5C1HA 1Z90A 4AAWA 1TW1A 4KXOA 1LVWA 4EE3A 4FRHA 2JCKA 4NAKA 2XMEA 3F1CA 1W57A 5FU8A 4B4MA 1W55A 1ZJ1A 2VD4A 3HL3A 3PNNA 5C8RA 4DDZA 4FQWA 5CQPA 1EZIA 1WT2A 1ON6A 3DJ4A 1K4VA 1H3MA 4LW6A 4FRMA 2AM3A 2I7BA 1ZI1A 1NWGB 2XMHA 1NHEB 1JV3A 2X5ZA 4CJCA 1FOAA 2I5KA 1FWYA 4ECMA 3SPTA 2V0IA 2W0VA 2BO7A 4FCUA 2AESA 4R7PA 1OQMB 3DK5A 3SXCA 1JVDA 2X5SA 3LW6A 1VGZA 3K8DA 1GX4A 3V0MA 1WT3A 1G23A 5AJPA 4KRVA 5EJZA 3SXEA 5EIYA 2FYBA 4AC3A 5JQQA 2Y4LA 1FGXA 4ASYA 3U2UA 1R7YA 3SX3A 2APCA 4G3SA 5C4EA 3IOHA 4KNXA 1VZXA 3EE5A 5FTVA 3SX7A 3USRA 3JTJA 1H5RB 3OH3A 1GQ9A 2P6WA 3R2WA 1H5TA 1MP5A 2XWNA 2BO4A 1LL0A 2P72A 4B2XA 1MP3A 1FRWA 5C4FA 3N9WA 1YROB 1SS9A 4KC4A 3TQDA 2WGZA 1ZJ3A 4Y6UA 2YQJA 3U0YA 2VS4A 2FYAA 4Y7TA 4CJ8A 2I5EA 4DE7A 4ASJA 3U0XA 3Q80A 5AJNA 2XWLA 5IDSA 1LZ7A 2VFZA 1KWSA 3E25A 2X65A 3U2WA 4KPXA 1V83A 1TVYA 3ZGGA 2JCOA 1G3LA 1LL3A 2JCLA 2NXVA 3O3PA 4AYLA 1OMXA 3SX8A 5FV9A 1H7LA 1HJLA 5FYEA 5CQOA 1ON8A 5FTSA 4YS8A 4EEOA 3CGXA 3PKPA 5CQMX 1H4CA 1ZCTA 1YP2A 5C1LA 2QGIA 3V0QA 2VS5A 4KNRA 1ZDGA 1S4PA 2QH5A 3OH1A 2BO6A 4HO2A 2YESA 5EJ1A 1EYRA 3RSBA 1NQIB 1FG5N 1IIMA 4D48A 1VH1A 2BO8A 1I52A 2RJ5A 4KC2A 4P00A 1TZFA 3BCVA 1G95A 1VZTA 3PKQA 1WT1A 2WEEA 3GUEA 3POLA 2CU2A 2YQHA 3NGWA 3D98A 2YCMA 2RJ7A 3OGZA 3K8EA 1GQCA 2OEFA 2WE9A 2Q4JA 4KC1A 3CKVA 4G3PA 5CMFX 3USQA 2UX8A 1LZ0A 2WVKA 2D7RA 4B4GA 2E3DA 4C2SA 4EEAA 4FRLA 1H7EA 3Q7UA 3I0IX 4BQHA 2VK9A 4GBPA 4FRAA 5CQNX 4HO5A 2O1GA 4FIYA 2Z86A 1GA8A 2RJ1A 3I0EA 5I1FA 2RIZA 1MP4A 3I0GA 2AM5A 1G0RA 4NALA 5CMIA 4Y6NA 1FR9A 3IOJA 5C38A 5C4DA 3U2VA 1FO9A 3RMVA 2J0BA 1H4DA 4EE4A 2WVMA 1H5TB 1LZIA 2VXLA 5BXCA 2VSIA 2RJ6A 2RIXA 1G1LA 4Y9XA 3OH4A 1G9RA 4M2BA 1ZHJA 2PGVA 3OH0A 3JUKA 2RITA 1QWJA 4JISA 4Y7UA 2RIYA 4Y63A 1FXJA 3CKQA 2ICXA 4HCQA 5J49A 5C49A 5C3AA 2PGYA 2FY7A 1PZTA 3RMWA 1TW5A 1O7OA 3JUJA 2FYCB 3V0NA 4L41C 4B5BA 4FROA 1E5KA 4M4KA 1VGUA 4MNDA 1FR8A 3ZF8A 1JYKA 3I0LA 1R7XA 3FOQA 1G8OA 2PA4A 2OI6A 1ZI3A 2QKXA 4E1KA 3E26A 2RJ8A 2V0LA 4FRBA 1QG8A 4BMAA 5C4CA 4CVHA 4G87A 2MZBA 4B2WA 5FU0A 5C4BA 2FFUA 5C48A 4KQLA 1G2VA 1ZCVA 4Y64A 4B42A 4D0TA 3T7MA 3DUVA 3U2TA 2PX7A 2X60A 1LL2A 1QGSA 1V84A 5C3DA 4NANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZU7 A;  3I0D A;  4FRP A;  2Y6P A;  2FYD B;  4K6R A;  4D11 A;  3ZLL A;  2Y4M A;  1H5S A;  4HO4 A;  3OC9 A;  1VZU A;  3I0J A;  1NKH B;  1ZJO A;  3SXD A;  4D11 C;  1H5S C;  2AM4 A;  4HO0 A;  1INJ A;  2Y4K A;  4M2A A;  1PZY B;  4EEM A;  1H7G A;  3CKO A;  4DEC A;  3IOI A;  1H7H A;  1R7T A;  3T7N A;  3BRK X;  2E8B A;  2WVL A;  1ZI4 A;  2YC3 A;  4KPZ A;  1GWW A;  2RJ9 A;  1XZ6 A;  4FRE A;  4M28 A;  2O1F A;  3I0C A;  5C47 A;  2O1H A;  1VPA A;  5C1G A;  2A8U A;  1HM8 A;  1R7V A;  4HOC A;  3I0H A;  2V0K A;  1WT0 A;  3OKR A;  4Y7V A;  4HG6 A;  4ZDQ A;  2GGQ A;  1H5S D;  1R82 A;  4CJB A;  1H7Q A;  5DDT A;  2V0H A;  4HO9 A;  1R80 A;  2YQC A;  2WAW A;  1G93 A;  2JCJ A;  5CMG X;  3SX5 A;  3V0P A;  1YP3 A;  1WSZ A;  2XWM A;  4J18 A;  2RJ4 A;  3V8Y A;  2YC5 A;  1O0R A;  1OMZ A;  1R81 A;  5C36 A;  5CQL X;  2YQS A;  5L6S A;  1JVG A;  4HO6 A;  2Z87 A;  4MYB A;  3V90 A;  1IIN A;  2DPW A;  2FFV A;  1NMM B;  5CMH A;  4FRQ A;  1JYL A;  2ICY A;  2A8W A;  4Y7F A;  2OEG A;  5AJO A;  4EEG A;  5FUH A;  1VH3 A;  2GGO A;  4IRP A;  3V0O A;  3T7O A;  4EE5 A;  1JV1 A;  1FXO A;  1ZJP A;  1VGT A;  1FGG A;  1S4O A;  2D7I A;  2AGD A;  1XHB A;  5IDT A;  3CU0 A;  4LW3 A;  3U2X A;  5C3B A;  1W77 A;  4XWI A;  1ZCU A;  1HJJ A;  1R7U A;  4B3U A;  1H7T A;  3FWW A;  3CKJ A;  2ZU9 A;  2ZU8 A;  3F1Y A;  3KIA A;  2AH9 A;  4B4B A;  4D0Z A;  1GWV A;  4P02 A;  1ZI5 A;  4HO3 A;  3V8Z A;  1ZCY A;  2W0W A;  4ARW A;  3SXA A;  2Y7A A;  1NF5 B;  4NAI A;  4JD0 A;  4UEG A;  3V91 A;  3Q4S A;  1ZJ2 A;  1H5R A;  2D0J A;  1ZIZ A;  1O7Q A;  1G97 A;  3D5N A;  1H5S B;  3TZT A;  5IFY A;  2OI7 A;  5DDV A;  5HS2 A;  1V82 A;  2VXM A;  3OAM A;  3I0F A;  1WVC A;  2OI5 A;  3CKN A;  4EVW A;  1ZDF A;  4FRD A;  5CMJ A;  3QVB A;  3R3I A;  1FZW A;  1GX0 A;  3SXB A;  5L6V A;  1VGW A;  4HO8 A;  2P73 A;  3ST8 A;  3ZGF A;  4IRQ A;  1FO8 A;  3D8V A;  1YP4 A;  1HM0 A;  3V0L A;  1ZJ0 A;  2Y4J A;  1S4N A;  1INI A;  2VSH A;  3ZLK A;  2VS3 A;  1H7F A;  3I0K A;  1HM9 A;  1QGQ A;  1VM8 A;  4AYJ A;  2AE7 A;  3OH2 A;  4Y7G A;  1H4E A;  1VIC A;  4G3Q A;  4FCE A;  1LZJ A;  2V0J A;  2AEC A;  1HV9 A;  1O23 B;  1MC3 A;  4KT7 A;  3SXG A;  2RJ0 A;  4Y62 A;  5C1H A;  1Z90 A;  4AAW A;  1TW1 A;  4KXO A;  1LVW A;  4EE3 A;  4FRH A;  2JCK A;  4NAK A;  2XME A;  3F1C A;  1W57 A;  5FU8 A;  4B4M A;  1W55 A;  1ZJ1 A;  2VD4 A;  3HL3 A;  3PNN A;  5C8R A;  4DDZ A;  4FQW A;  5CQP A;  1EZI A;  1WT2 A;  1ON6 A;  3DJ4 A;  1K4V A;  1H3M A;  4LW6 A;  4FRM A;  2AM3 A;  2I7B A;  1ZI1 A;  1NWG B;  2XMH A;  1NHE B;  1JV3 A;  2X5Z A;  4CJC A;  1FOA A;  2I5K A;  1FWY A;  4ECM A;  3SPT A;  2V0I A;  2W0V A;  2BO7 A;  4FCU A;  2AES A;  4R7P A;  1OQM B;  3DK5 A;  3SXC A;  1JVD A;  2X5S A;  3LW6 A;  1VGZ A;  3K8D A;  1GX4 A;  3V0M A;  1WT3 A;  1G23 A;  5AJP A;  4KRV A;  5EJZ A;  3SXE A;  5EIY A;  2FYB A;  4AC3 A;  5JQQ A;  2Y4L A;  1FGX A;  4ASY A;  3U2U A;  1R7Y A;  3SX3 A;  2APC A;  4G3S A;  5C4E A;  3IOH A;  4KNX A;  1VZX A;  3EE5 A;  5FTV A;  3SX7 A;  3USR A;  3JTJ A;  1H5R B;  3OH3 A;  1GQ9 A;  2P6W A;  3R2W A;  1H5T A;  1MP5 A;  2XWN A;  2BO4 A;  1LL0 A;  2P72 A;  4B2X A;  1MP3 A;  1FRW A;  5C4F A;  3N9W A;  1YRO B;  1SS9 A;  4KC4 A;  3TQD A;  2WGZ A;  1ZJ3 A;  4Y6U A;  2YQJ A;  3U0Y A;  2VS4 A;  2FYA A;  4Y7T A;  4CJ8 A;  2I5E A;  4DE7 A;  4ASJ A;  3U0X A;  3Q80 A;  5AJN A;  2XWL A;  5IDS A;  1LZ7 A;  2VFZ A;  1KWS A;  3E25 A;  2X65 A;  3U2W A;  4KPX A;  1V83 A;  1TVY A;  3ZGG A;  2JCO A;  1G3L A;  1LL3 A;  2JCL A;  2NXV A;  3O3P A;  4AYL A;  1OMX A;  3SX8 A;  5FV9 A;  1H7L A;  1HJL A;  5FYE A;  5CQO A;  1ON8 A;  5FTS A;  4YS8 A;  4EEO A;  3CGX A;  3PKP A;  5CQM X;  1H4C A;  1ZCT A;  1YP2 A;  5C1L A;  2QGI A;  3V0Q A;  2VS5 A;  4KNR A;  1ZDG A;  1S4P A;  2QH5 A;  3OH1 A;  2BO6 A;  4HO2 A;  2YES A;  5EJ1 A;  1EYR A;  3RSB A;  1NQI B;  1FG5 N;  1IIM A;  4D48 A;  1VH1 A;  2BO8 A;  1I52 A;  2RJ5 A;  4KC2 A;  4P00 A;  1TZF A;  3BCV A;  1G95 A;  1VZT A;  3PKQ A;  1WT1 A;  2WEE A;  3GUE A;  3POL A;  2CU2 A;  2YQH A;  3NGW A;  3D98 A;  2YCM A;  2RJ7 A;  3OGZ A;  3K8E A;  1GQC A;  2OEF A;  2WE9 A;  2Q4J A;  4KC1 A;  3CKV A;  4G3P A;  5CMF X;  3USQ A;  2UX8 A;  1LZ0 A;  2WVK A;  2D7R A;  4B4G A;  2E3D A;  4C2S A;  4EEA A;  4FRL A;  1H7E A;  3Q7U A;  3I0I X;  4BQH A;  4GBP A;  4FRA A;  5CQN X;  4HO5 A;  2O1G A;  2Z86 A;  1GA8 A;  2RJ1 A;  3I0E A;  5I1F A;  2RIZ A;  1MP4 A;  3I0G A;  2AM5 A;  1G0R A;  4NAL A;  5CMI A;  4Y6N A;  1FR9 A;  3IOJ A;  5C38 A;  5C4D A;  3U2V A;  1FO9 A;  3RMV A;  1H4D A;  4EE4 A;  2WVM A;  1H5T B;  1LZI A;  2VXL A;  5BXC A;  2VSI A;  2RJ6 A;  2RIX A;  1G1L A;  4Y9X A;  3OH4 A;  1G9R A;  4M2B A;  1ZHJ A;  2PGV A;  3OH0 A;  3JUK A;  2RIT A;  1QWJ A;  4JIS A;  4Y7U A;  2RIY A;  4Y63 A;  1FXJ A;  3CKQ A;  2ICX A;  4HCQ A;  5J49 A;  5C49 A;  5C3A A;  2PGY A;  2FY7 A;  1PZT A;  3RMW A;  1TW5 A;  1O7O A;  3JUJ A;  2FYC B;  3V0N A;  4L41 C;  4B5B A;  4FRO A;  1E5K A;  4M4K A;  1VGU A;  4MND A;  1FR8 A;  3ZF8 A;  1JYK A;  3I0L A;  1R7X A;  3FOQ A;  1G8O A;  2PA4 A;  2OI6 A;  1ZI3 A;  2QKX A;  4E1K A;  3E26 A;  2RJ8 A;  2V0L A;  4FRB A;  1QG8 A;  4BMA A;  5C4C A;  4CVH A;  4G87 A;  2MZB A;  4B2W A;  5FU0 A;  5C4B A;  2FFU A;  5C48 A;  4KQL A;  1G2V A;  1ZCV A;  4Y64 A;  4B42 A;  4D0T A;  3T7M A;  3DUV A;  3U2T A;  2PX7 A;  2X60 A;  1LL2 A;  1QGS A;  1V84 A;  5C3D A;  4NAN A; 
#chains in the Genus database with same CATH topology
 2ZU7 A;  3I0D A;  4FRP A;  2Y6P A;  2FYD B;  4K6R A;  4D11 A;  3ZLL A;  2Y4M A;  1H5S A;  4HO4 A;  3OC9 A;  1VZU A;  3I0J A;  1NKH B;  1ZJO A;  3SXD A;  4D11 C;  1H5S C;  2AM4 A;  4HO0 A;  1INJ A;  2Y4K A;  4M2A A;  1PZY B;  4EEM A;  1H7G A;  3CKO A;  4DEC A;  3IOI A;  1H7H A;  1R7T A;  3T7N A;  3BRK X;  2E8B A;  2WVL A;  1ZI4 A;  2YC3 A;  4KPZ A;  1GWW A;  2RJ9 A;  1XZ6 A;  4FRE A;  4M28 A;  2O1F A;  3I0C A;  5C47 A;  2O1H A;  1VPA A;  5C1G A;  2A8U A;  1HM8 A;  2C0N A;  1R7V A;  4HOC A;  3I0H A;  2V0K A;  1WT0 A;  3OKR A;  4Y7V A;  4HG6 A;  4ZDQ A;  2GGQ A;  1H5S D;  1R82 A;  4CJB A;  1H7Q A;  5DDT A;  4Q7C A;  2V0H A;  4HO9 A;  1R80 A;  2YQC A;  2WAW A;  1G93 A;  2JCJ A;  5CMG X;  3SX5 A;  3V0P A;  1YP3 A;  1WSZ A;  2XWM A;  4J18 A;  2RJ4 A;  3V8Y A;  2YC5 A;  1O0R A;  1OMZ A;  1R81 A;  5C36 A;  5CQL X;  2YQS A;  2J0A A;  5L6S A;  1JVG A;  4HO6 A;  2Z87 A;  4MYB A;  3V90 A;  1IIN A;  2DPW A;  2FFV A;  1NMM B;  5CMH A;  4FRQ A;  1JYL A;  2ICY A;  2A8W A;  4Y7F A;  2OEG A;  5AJO A;  4EEG A;  5FUH A;  1VH3 A;  2GGO A;  4IRP A;  3V0O A;  3T7O A;  4EE5 A;  1JV1 A;  1FXO A;  1ZJP A;  1VGT A;  1FGG A;  1S4O A;  2D7I A;  2AGD A;  1XHB A;  5IDT A;  4MIX A;  3CU0 A;  4LW3 A;  3U2X A;  5C3B A;  1W77 A;  4XWI A;  1ZCU A;  1HJJ A;  1R7U A;  4B3U A;  5D91 A;  1H7T A;  3FWW A;  3CKJ A;  2ZU9 A;  2ZU8 A;  3F1Y A;  3KIA A;  2AH9 A;  4B4B A;  4D0Z A;  1GWV A;  4P02 A;  1ZI5 A;  4HO3 A;  3V8Z A;  1ZCY A;  2W0W A;  4ARW A;  3SXA A;  2Y7A A;  1NF5 B;  4NAI A;  4JD0 A;  4UEG A;  3V91 A;  3Q4S A;  1ZJ2 A;  1H5R A;  2D0J A;  1ZIZ A;  1O7Q A;  1G97 A;  3D5N A;  1H5S B;  3TZT A;  5IFY A;  2OI7 A;  4O6N A;  5DDV A;  5HS2 A;  1V82 A;  2VXM A;  3OAM A;  3I0F A;  1WVC A;  2OI5 A;  3CKN A;  4EVW A;  1ZDF A;  4FRD A;  5CMJ A;  3QVB A;  3R3I A;  1FZW A;  1GX0 A;  3SXB A;  5L6V A;  1VGW A;  4HO8 A;  2P73 A;  3ST8 A;  3ZGF A;  4IRQ A;  5D92 A;  1FO8 A;  3D8V A;  1YP4 A;  1HM0 A;  3V0L A;  1ZJ0 A;  2Y4J A;  1S4N A;  1INI A;  2VSH A;  3ZLK A;  2VS3 A;  1H7F A;  3I0K A;  1HM9 A;  1QGQ A;  1VM8 A;  4AYJ A;  2AE7 A;  3OH2 A;  4Y7G A;  1H4E A;  1VIC A;  4G3Q A;  4FCE A;  1LZJ A;  2V0J A;  2AEC A;  1HV9 A;  1O23 B;  1MC3 A;  4KT7 A;  4O6M A;  3SXG A;  2RJ0 A;  4FIX A;  4Y62 A;  5C1H A;  1Z90 A;  4AAW A;  1TW1 A;  4KXO A;  1LVW A;  4EE3 A;  4FRH A;  2JCK A;  4NAK A;  2XME A;  3F1C A;  1W57 A;  5FU8 A;  4B4M A;  1W55 A;  1ZJ1 A;  2VD4 A;  3HL3 A;  3PNN A;  5C8R A;  4DDZ A;  4FQW A;  5CQP A;  1EZI A;  1WT2 A;  1ON6 A;  3DJ4 A;  1K4V A;  1H3M A;  4LW6 A;  4FRM A;  2AM3 A;  2I7B A;  1ZI1 A;  1NWG B;  2XMH A;  1NHE B;  1JV3 A;  2X5Z A;  4CJC A;  1FOA A;  2I5K A;  1FWY A;  4ECM A;  3SPT A;  2V0I A;  2W0V A;  2BO7 A;  4FCU A;  2AES A;  4R7P A;  1OQM B;  3DK5 A;  3SXC A;  1JVD A;  2X5S A;  3LW6 A;  1VGZ A;  3K8D A;  1GX4 A;  3V0M A;  1WT3 A;  1G23 A;  5AJP A;  4KRV A;  5EJZ A;  3SXE A;  5EIY A;  2FYB A;  4AC3 A;  5JQQ A;  2Y4L A;  1FGX A;  4ASY A;  3U2U A;  1R7Y A;  3SX3 A;  2APC A;  4G3S A;  5C4E A;  3IOH A;  4KNX A;  1VZX A;  3EE5 A;  5FTV A;  3SX7 A;  3USR A;  3JTJ A;  1H5R B;  3OH3 A;  1GQ9 A;  2P6W A;  3R2W A;  1H5T A;  1MP5 A;  2XWN A;  2BO4 A;  1LL0 A;  2P72 A;  4B2X A;  1MP3 A;  1FRW A;  5C4F A;  3N9W A;  1YRO B;  1SS9 A;  4KC4 A;  3TQD A;  2WGZ A;  1ZJ3 A;  4Y6U A;  2YQJ A;  3U0Y A;  2VS4 A;  2FYA A;  4Y7T A;  4CJ8 A;  2I5E A;  4DE7 A;  4ASJ A;  3U0X A;  3Q80 A;  5AJN A;  2XWL A;  5IDS A;  1LZ7 A;  2VFZ A;  1KWS A;  3E25 A;  2X65 A;  3U2W A;  4KPX A;  1V83 A;  1TVY A;  3ZGG A;  2JCO A;  1G3L A;  1LL3 A;  2JCL A;  2NXV A;  3O3P A;  4AYL A;  1OMX A;  3SX8 A;  5FV9 A;  1H7L A;  1HJL A;  5FYE A;  5CQO A;  1ON8 A;  5FTS A;  4YS8 A;  4EEO A;  3CGX A;  3PKP A;  5CQM X;  1H4C A;  1ZCT A;  1YP2 A;  5C1L A;  2QGI A;  3V0Q A;  2VS5 A;  4KNR A;  1ZDG A;  1S4P A;  2QH5 A;  3OH1 A;  2BO6 A;  4HO2 A;  2YES A;  5EJ1 A;  1EYR A;  3RSB A;  1NQI B;  1FG5 N;  1IIM A;  4D48 A;  1VH1 A;  2BO8 A;  1I52 A;  2RJ5 A;  4KC2 A;  4P00 A;  1TZF A;  3BCV A;  1G95 A;  1VZT A;  3PKQ A;  1WT1 A;  2WEE A;  3GUE A;  3POL A;  2CU2 A;  2YQH A;  3NGW A;  3D98 A;  2YCM A;  2RJ7 A;  3OGZ A;  3K8E A;  1GQC A;  2OEF A;  2WE9 A;  2Q4J A;  4KC1 A;  3CKV A;  4G3P A;  5CMF X;  3USQ A;  2UX8 A;  1LZ0 A;  2WVK A;  2D7R A;  4B4G A;  2E3D A;  4C2S A;  4EEA A;  4FRL A;  1H7E A;  3Q7U A;  3I0I X;  4BQH A;  2VK9 A;  4GBP A;  4FRA A;  5CQN X;  4HO5 A;  2O1G A;  4FIY A;  2Z86 A;  1GA8 A;  2RJ1 A;  3I0E A;  5I1F A;  2RIZ A;  1MP4 A;  3I0G A;  2AM5 A;  1G0R A;  4NAL A;  5CMI A;  4Y6N A;  1FR9 A;  3IOJ A;  5C38 A;  5C4D A;  3U2V A;  1FO9 A;  3RMV A;  2J0B A;  1H4D A;  4EE4 A;  2WVM A;  1H5T B;  1LZI A;  2VXL A;  5BXC A;  2VSI A;  2RJ6 A;  2RIX A;  1G1L A;  4Y9X A;  3OH4 A;  1G9R A;  4M2B A;  1ZHJ A;  2PGV A;  3OH0 A;  3JUK A;  2RIT A;  1QWJ A;  4JIS A;  4Y7U A;  2RIY A;  4Y63 A;  1FXJ A;  3CKQ A;  2ICX A;  4HCQ A;  5J49 A;  5C49 A;  5C3A A;  2PGY A;  2FY7 A;  1PZT A;  3RMW A;  1TW5 A;  1O7O A;  3JUJ A;  2FYC B;  3V0N A;  4L41 C;  4B5B A;  4FRO A;  1E5K A;  4M4K A;  1VGU A;  4MND A;  1FR8 A;  3ZF8 A;  1JYK A;  3I0L A;  1R7X A;  3FOQ A;  1G8O A;  2PA4 A;  2OI6 A;  1ZI3 A;  2QKX A;  4E1K A;  3E26 A;  2RJ8 A;  2V0L A;  4FRB A;  1QG8 A;  4BMA A;  5C4C A;  4CVH A;  4G87 A;  2MZB A;  4B2W A;  5FU0 A;  5C4B A;  2FFU A;  5C48 A;  4KQL A;  1G2V A;  1ZCV A;  4Y64 A;  4B42 A;  4D0T A;  3T7M A;  3DUV A;  3U2T A;  2PX7 A;  2X60 A;  1LL2 A;  1QGS A;  1V84 A;  5C3D A;  4NAN A; 
#chains in the Genus database with same CATH homology
 2ZU7 A;  3I0D A;  4FRP A;  2Y6P A;  2FYD B;  4K6R A;  4D11 A;  3ZLL A;  2Y4M A;  1H5S A;  4HO4 A;  3OC9 A;  1VZU A;  3I0J A;  1NKH B;  1ZJO A;  3SXD A;  4D11 C;  1H5S C;  2AM4 A;  4HO0 A;  1INJ A;  2Y4K A;  4M2A A;  1PZY B;  4EEM A;  1H7G A;  3CKO A;  4DEC A;  3IOI A;  1H7H A;  1R7T A;  3T7N A;  3BRK X;  2E8B A;  2WVL A;  1ZI4 A;  2YC3 A;  4KPZ A;  1GWW A;  2RJ9 A;  1XZ6 A;  4FRE A;  4M28 A;  2O1F A;  3I0C A;  5C47 A;  2O1H A;  1VPA A;  5C1G A;  2A8U A;  1HM8 A;  2C0N A;  1R7V A;  4HOC A;  3I0H A;  2V0K A;  1WT0 A;  3OKR A;  4Y7V A;  4HG6 A;  4ZDQ A;  2GGQ A;  1H5S D;  1R82 A;  4CJB A;  1H7Q A;  5DDT A;  4Q7C A;  2V0H A;  4HO9 A;  1R80 A;  2YQC A;  2WAW A;  1G93 A;  2JCJ A;  5CMG X;  3SX5 A;  3V0P A;  1YP3 A;  1WSZ A;  2XWM A;  4J18 A;  2RJ4 A;  3V8Y A;  2YC5 A;  1O0R A;  1OMZ A;  1R81 A;  5C36 A;  5CQL X;  2YQS A;  2J0A A;  5L6S A;  1JVG A;  4HO6 A;  2Z87 A;  4MYB A;  3V90 A;  1IIN A;  2DPW A;  2FFV A;  1NMM B;  5CMH A;  4FRQ A;  1JYL A;  2ICY A;  2A8W A;  4Y7F A;  2OEG A;  5AJO A;  4EEG A;  5FUH A;  1VH3 A;  2GGO A;  4IRP A;  3V0O A;  3T7O A;  4EE5 A;  1JV1 A;  1FXO A;  1ZJP A;  1VGT A;  1FGG A;  1S4O A;  2D7I A;  2AGD A;  1XHB A;  5IDT A;  4MIX A;  3CU0 A;  4LW3 A;  3U2X A;  5C3B A;  1W77 A;  4XWI A;  1ZCU A;  1HJJ A;  1R7U A;  4B3U A;  5D91 A;  1H7T A;  3FWW A;  3CKJ A;  2ZU9 A;  2ZU8 A;  3F1Y A;  3KIA A;  2AH9 A;  4B4B A;  4D0Z A;  1GWV A;  4P02 A;  1ZI5 A;  4HO3 A;  3V8Z A;  1ZCY A;  2W0W A;  4ARW A;  3SXA A;  2Y7A A;  1NF5 B;  4NAI A;  4JD0 A;  4UEG A;  3V91 A;  3Q4S A;  1ZJ2 A;  1H5R A;  2D0J A;  1ZIZ A;  1O7Q A;  1G97 A;  3D5N A;  1H5S B;  3TZT A;  5IFY A;  2OI7 A;  4O6N A;  5DDV A;  5HS2 A;  1V82 A;  2VXM A;  3OAM A;  3I0F A;  1WVC A;  2OI5 A;  3CKN A;  4EVW A;  1ZDF A;  4FRD A;  5CMJ A;  3QVB A;  3R3I A;  1FZW A;  1GX0 A;  3SXB A;  5L6V A;  1VGW A;  4HO8 A;  2P73 A;  3ST8 A;  3ZGF A;  4IRQ A;  5D92 A;  1FO8 A;  3D8V A;  1YP4 A;  1HM0 A;  3V0L A;  1ZJ0 A;  2Y4J A;  1S4N A;  1INI A;  2VSH A;  3ZLK A;  2VS3 A;  1H7F A;  3I0K A;  1HM9 A;  1QGQ A;  1VM8 A;  4AYJ A;  2AE7 A;  3OH2 A;  4Y7G A;  1H4E A;  1VIC A;  4G3Q A;  4FCE A;  1LZJ A;  2V0J A;  2AEC A;  1HV9 A;  1O23 B;  1MC3 A;  4KT7 A;  4O6M A;  3SXG A;  2RJ0 A;  4FIX A;  4Y62 A;  5C1H A;  1Z90 A;  4AAW A;  1TW1 A;  4KXO A;  1LVW A;  4EE3 A;  4FRH A;  2JCK A;  4NAK A;  2XME A;  3F1C A;  1W57 A;  5FU8 A;  4B4M A;  1W55 A;  1ZJ1 A;  2VD4 A;  3HL3 A;  3PNN A;  5C8R A;  4DDZ A;  4FQW A;  5CQP A;  1EZI A;  1WT2 A;  1ON6 A;  3DJ4 A;  1K4V A;  1H3M A;  4LW6 A;  4FRM A;  2AM3 A;  2I7B A;  1ZI1 A;  1NWG B;  2XMH A;  1NHE B;  1JV3 A;  2X5Z A;  4CJC A;  1FOA A;  2I5K A;  1FWY A;  4ECM A;  3SPT A;  2V0I A;  2W0V A;  2BO7 A;  4FCU A;  2AES A;  4R7P A;  1OQM B;  3DK5 A;  3SXC A;  1JVD A;  2X5S A;  3LW6 A;  1VGZ A;  3K8D A;  1GX4 A;  3V0M A;  1WT3 A;  1G23 A;  5AJP A;  4KRV A;  5EJZ A;  3SXE A;  5EIY A;  2FYB A;  4AC3 A;  5JQQ A;  2Y4L A;  1FGX A;  4ASY A;  3U2U A;  1R7Y A;  3SX3 A;  2APC A;  4G3S A;  5C4E A;  3IOH A;  4KNX A;  1VZX A;  3EE5 A;  5FTV A;  3SX7 A;  3USR A;  3JTJ A;  1H5R B;  3OH3 A;  1GQ9 A;  2P6W A;  3R2W A;  1H5T A;  1MP5 A;  2XWN A;  2BO4 A;  1LL0 A;  2P72 A;  4B2X A;  1MP3 A;  1FRW A;  5C4F A;  3N9W A;  1YRO B;  1SS9 A;  4KC4 A;  3TQD A;  2WGZ A;  1ZJ3 A;  4Y6U A;  2YQJ A;  3U0Y A;  2VS4 A;  2FYA A;  4Y7T A;  4CJ8 A;  2I5E A;  4DE7 A;  4ASJ A;  3U0X A;  3Q80 A;  5AJN A;  2XWL A;  5IDS A;  1LZ7 A;  2VFZ A;  1KWS A;  3E25 A;  2X65 A;  3U2W A;  4KPX A;  1V83 A;  1TVY A;  3ZGG A;  2JCO A;  1G3L A;  1LL3 A;  2JCL A;  2NXV A;  3O3P A;  4AYL A;  1OMX A;  3SX8 A;  5FV9 A;  1H7L A;  1HJL A;  5FYE A;  5CQO A;  1ON8 A;  5FTS A;  4YS8 A;  4EEO A;  3CGX A;  3PKP A;  5CQM X;  1H4C A;  1ZCT A;  1YP2 A;  5C1L A;  2QGI A;  3V0Q A;  2VS5 A;  4KNR A;  1ZDG A;  1S4P A;  2QH5 A;  3OH1 A;  2BO6 A;  4HO2 A;  2YES A;  5EJ1 A;  1EYR A;  3RSB A;  1NQI B;  1FG5 N;  1IIM A;  4D48 A;  1VH1 A;  2BO8 A;  1I52 A;  2RJ5 A;  4KC2 A;  4P00 A;  1TZF A;  3BCV A;  1G95 A;  1VZT A;  3PKQ A;  1WT1 A;  2WEE A;  3GUE A;  3POL A;  2CU2 A;  2YQH A;  3NGW A;  3D98 A;  2YCM A;  2RJ7 A;  3OGZ A;  3K8E A;  1GQC A;  2OEF A;  2WE9 A;  2Q4J A;  4KC1 A;  3CKV A;  4G3P A;  5CMF X;  3USQ A;  2UX8 A;  1LZ0 A;  2WVK A;  2D7R A;  4B4G A;  2E3D A;  4C2S A;  4EEA A;  4FRL A;  1H7E A;  3Q7U A;  3I0I X;  4BQH A;  2VK9 A;  4GBP A;  4FRA A;  5CQN X;  4HO5 A;  2O1G A;  4FIY A;  2Z86 A;  1GA8 A;  2RJ1 A;  3I0E A;  5I1F A;  2RIZ A;  1MP4 A;  3I0G A;  2AM5 A;  1G0R A;  4NAL A;  5CMI A;  4Y6N A;  1FR9 A;  3IOJ A;  5C38 A;  5C4D A;  3U2V A;  1FO9 A;  3RMV A;  2J0B A;  1H4D A;  4EE4 A;  2WVM A;  1H5T B;  1LZI A;  2VXL A;  5BXC A;  2VSI A;  2RJ6 A;  2RIX A;  1G1L A;  4Y9X A;  3OH4 A;  1G9R A;  4M2B A;  1ZHJ A;  2PGV A;  3OH0 A;  3JUK A;  2RIT A;  1QWJ A;  4JIS A;  4Y7U A;  2RIY A;  4Y63 A;  1FXJ A;  3CKQ A;  2ICX A;  4HCQ A;  5J49 A;  5C49 A;  5C3A A;  2PGY A;  2FY7 A;  1PZT A;  3RMW A;  1TW5 A;  1O7O A;  3JUJ A;  2FYC B;  3V0N A;  4L41 C;  4B5B A;  4FRO A;  1E5K A;  4M4K A;  1VGU A;  4MND A;  1FR8 A;  3ZF8 A;  1JYK A;  3I0L A;  1R7X A;  3FOQ A;  1G8O A;  2PA4 A;  2OI6 A;  1ZI3 A;  2QKX A;  4E1K A;  3E26 A;  2RJ8 A;  2V0L A;  4FRB A;  1QG8 A;  4BMA A;  5C4C A;  4CVH A;  4G87 A;  2MZB A;  4B2W A;  5FU0 A;  5C4B A;  2FFU A;  5C48 A;  4KQL A;  1G2V A;  1ZCV A;  4Y64 A;  4B42 A;  4D0T A;  3T7M A;  3DUV A;  3U2T A;  2PX7 A;  2X60 A;  1LL2 A;  1QGS A;  1V84 A;  5C3D A;  4NAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...