5CMIA

Gta mutant without mercury - e303d
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
282
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDDSHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Glycosyltransfer in mutants of putative catalytic residue Glu303 of the human ABO(H) A and B blood group glycosyltransferases GTA and GTB proceeds through a labile active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 282
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5cmiA00
5FYEA 1JVGA 2PA4A 2AESA 3SX8A 2Y4JA 3EE5A 5C1LA 1O23B 2Q4JA 5BXCA 2Y4KA 4MNDA 5AJPA 4LW6A 3E26A 3V0OA 4R7PA 1FG5N 1O7QA 2V0LA 1ZI5A 1ZDFA 5DDVA 4DE7A 1OMXA 4M2AA 2VS4A 5C4BA 3CGXA 1VZXA 3V0PA 1JYKA 2VS5A 3T7MA 1H7QA 1VH3A 1NHEB 2WGZA 1H5RA 4AC3A 2XMEA 1H7TA 4B5BA 4C2SA 2PGVA 4G3SA 3IOJA 4KC4A 2FFVA 3U0YA 2RJ8A 5J49A 2XMHA 2Z86A 2RJ4A 4HO0A 1FO9A 3V90A 4HO2A 4KRVA 2A8WA 3FOQA 5EJ1A 3IOHA 4ARWA 2RJ7A 1VM8A 1ZIZA 3PNNA 5CMHA 3USQA 2P6WA 5C4CA 1H5SD 2WVLA 4FREA 1QWJA 5FU8A 3ZLLA 2YQSA 3R3IA 4FRLA 3U2UA 4HOCA 1G9RA 3D8VA 3V0MA 1QG8A 1LZ0A 1WT1A 2V0IA 2GGQA 1INIA 4M28A 4D0ZA 4IRQA 1SS9A 5FTSA 1H3MA 2WAWA 4Y64A 3CKNA 2PGYA 4ASYA 3IOIA 4E1KA 2X5ZA 3PKPA 1MP5A 2YC5A 5CQLX 2RITA 5C3DA 1VH1A 4G3PA 1V83A 1VPAA 4Y7VA 2VD4A 4HO4A 5I1FA 4NAKA 1H4EA 5AJNA 1PZYB 2RJ9A 4HO3A 3I0CA 4HO8A 1TVYA 4Y6UA 1ZCTA 1H7LA 4BMAA 3QVBA 2X5SA 1IIMA 1Z90A 5AJOA 4B4GA 5IDTA 3TZTA 5JQQA 5FU0A 1LVWA 1H5RB 2MZBA 1R7VA 1OMZA 1GWWA 3SX5A 4G3QA 2D7IA 4KXOA 4FRMA 4M4KA 2AH9A 2FYBA 4KT7A 1R80A 1V84A 3N9WA 3Q7UA 4EE3A 3OGZA 3OH1A 5C1HA 3TQDA 1VZTA 3K8EA 3CKOA 4J18A 1H5TB 3OH3A 1W57A 2JCJA 2VXLA 4NAIA 3Q80A 1ZCYA 5C47A 2ICYA 4Y7TA 5C48A 4Y6NA 1HM9A 4FRQA 4JISA 3SXDA 4D11A 1W77A 4XWIA 3V8YA 5C4EA 1HV9A 1LZIA 2NXVA 3CKJA 2OI6A 3U2TA 1ZJPA 3I0LA 5DDTA 5FTVA 2D7RA 1HJLA 4M2BA 2E3DA 4K6RA 2OI7A 2PX7A 1NQIB 1ZI3A 5C4DA 2DPWA 4HO5A 1ON8A 1R7XA 3DUVA 5HS2A 1LZ7A 1R7YA 3U2VA 3SX3A 4EE5A 2FFUA 4FRDA 3V8ZA 4EE4A 4NALA 1FGXA 2ZU7A 2W0VA 1ZCUA 3NGWA 5IFYA 1LL3A 3T7OA 2BO7A 2W0WA 4HCQA 3PKQA 2XWNA 3HL3A 1R81A 2A8UA 2RIZA 4EEMA 1H5TA 2WVMA 4EEGA 2CU2A 5C4FA 3DK5A 2YC3A 1JVDA 2QKXA 4JD0A 3CU0A 5C36A 4B2XA 5L6VA 1MP3A 2VSHA 2Y4LA 1YP3A 1LL0A 1XHBA 4ECMA 1PZTA 2QGIA 3F1YA 4Y62A 3V0LA 5CQMX 1EYRA 4KNXA 3BCVA 4Y7GA 3ZGGA 1GX0A 1S4NA 4KPXA 1R82A 2AM4A 3OKRA 4CJCA 1FRWA 1S4OA 2ICXA 2FYDB 2VXMA 4EEAA 1NMMB 2RJ1A 2YQJA 3I0HA 1FXOA 3FWWA 4HG6A 3OAMA 4KPZA 2RIYA 1EZIA 4DDZA 2BO4A 1TZFA 1WT3A 3ZGFA 2YESA 4UEGA 3RMVA 2VS3A 1H5SA 3LW6A 3I0IX 1YP2A 1JV3A 3KIAA 1WSZA 1VZUA 1ZJ0A 2FYCB 5CMJA 2AE7A 2BO6A 1NKHB 1R7TA 3V0QA 2FY7A 2YQCA 2JCOA 1FXJA 1LZJA 1ZHJA 1KWSA 4FRHA 3SX7A 2ZU8A 4ZDQA 1WT2A 3I0JA 3F1CA 5CQOA 2RJ6A 2AM3A 2AECA 2UX8A 3Q4SA 1WVCA 1ZI4A 2APCA 3DJ4A 1ON6A 4B42A 2Y4MA 5EIYA 2P72A 3K8DA 2V0KA 1TW5A 2XWLA 3I0FA 1H4CA 4NANA 3OC9A 4CJ8A 1GX4A 3RSBA 2GGOA 2OI5A 5EJZA 2O1GA 2Y6PA 1INJA 4BQHA 1VGUA 5CMIA 2YCMA 2D0JA 1FWYA 2WVKA 1ZJOA 4AYJA 4FROA 1R7UA 4D0TA 4EVWA 2JCLA 2X65A 3JTJA 3OH2A 1FO8A 1YP4A 1G2VA 1K4VA 1G97A 1XZ6A 1ZI1A 1ZJ1A 5C1GA 3USRA 3RMWA 4CVHA 3POLA 1ZDGA 2RJ5A 3SXGA 3JUKA 2I5KA 4D48A 1MC3A 5FV9A 1MP4A 2RJ0A 4KQLA 5C8RA 4P02A 1VGWA 1W55A 4D11C 4B4MA 1FR9A 2I7BA 2AM5A 5C38A 1HJJA 1H5SB 1G3LA 1QGQA 1FOAA 3OH0A 2I5EA 2WEEA 1JYLA 3SXEA 2VSIA 5CMFX 2YQHA 2P73A 3CKQA 3I0GA 1S4PA 1WT0A 1H7EA 5L6SA 2Y7AA 1H4DA 3R2WA 2QH5A 1GQCA 2JCKA 1VGZA 3GUEA 1GWVA 4MYBA 1H7FA 1ZJ2A 5C3AA 2E8BA 3U2XA 2OEFA 4CJBA 2OEGA 4KC1A 2V0HA 3T7NA 4HO9A 1G95A 1QGSA 4AYLA 1G8OA 1G0RA 1IINA 2XWMA 1G1LA 4YS8A 4LW3A 1FR8A 4IRPA 5C3BA 1H7GA 3I0DA 3O3PA 4KNRA 1E5KA 1TW1A 2WE9A 4Y63A 4KC2A 3CKVA 3D98A 2O1FA 1H7HA 1NWGB 3ST8A 2ZU9A 2AGDA 1YROB 1JV1A 2RIXA 3D5NA 1OQMB 3I0EA 1ZCVA 3OH4A 4FCUA 4P00A 4G87A 1G93A 1GQ9A 3SPTA 4HO6A 4Y7FA 4FRBA 2X60A 5CQPA 2VFZA 3SXBA 4GBPA 3ZF8A 4B3UA 5C49A 1LL2A 4FQWA 3SXAA 1V82A 2O1HA 4FCEA 4B2WA 1O0RA 2BO8A 3V0NA 2Z87A 4EEOA 1ZJ3A 5CMGX 5CQNX 4Y7UA 3U2WA 4FRAA 4AAWA 1VGTA 1NF5B 1H5SC 4DECA 3E25A 4B4BA 2FYAA 4ASJA 4Y9XA 3JUJA 5IDSA 1HM8A 3I0KA 1O7OA 5FUHA 3U0XA 3V91A 2V0JA 1GA8A 1VICA 1FZWA 1HM0A 3ZLKA 4L41C 1FGGA 3BRKX 3SXCA 4FRPA 1G23A 1I52A
chains in the Genus database with same CATH superfamily
5FYEA 1JVGA 2PA4A 2AESA 3SX8A 2Y4JA 3EE5A 5C1LA 1O23B 2Q4JA 5BXCA 5D92A 2Y4KA 4MNDA 5AJPA 4LW6A 3E26A 3V0OA 4R7PA 1FG5N 1O7QA 2V0LA 1ZI5A 1ZDFA 5DDVA 4DE7A 1OMXA 4M2AA 2VS4A 5C4BA 3CGXA 1VZXA 3V0PA 1JYKA 2VS5A 3T7MA 1H7QA 1VH3A 1NHEB 2WGZA 1H5RA 4AC3A 2XMEA 1H7TA 4B5BA 4C2SA 2PGVA 4G3SA 3IOJA 4KC4A 4FIXA 2FFVA 3U0YA 2RJ8A 5J49A 4MIXA 2XMHA 2Z86A 2RJ4A 4HO0A 1FO9A 3V90A 4HO2A 4KRVA 2A8WA 3FOQA 5EJ1A 3IOHA 4ARWA 2RJ7A 1VM8A 1ZIZA 3PNNA 5CMHA 3USQA 2P6WA 5C4CA 1H5SD 2WVLA 4FREA 1QWJA 5FU8A 3ZLLA 2YQSA 3R3IA 4FRLA 3U2UA 4HOCA 1G9RA 3D8VA 3V0MA 1QG8A 1LZ0A 1WT1A 2V0IA 2GGQA 1INIA 4M28A 4D0ZA 4IRQA 1SS9A 5FTSA 1H3MA 2WAWA 4Y64A 3CKNA 2C0NA 2PGYA 4ASYA 3IOIA 4E1KA 2X5ZA 3PKPA 1MP5A 2YC5A 5CQLX 2RITA 5C3DA 1VH1A 4G3PA 1V83A 1VPAA 4Y7VA 2VD4A 4HO4A 5I1FA 4NAKA 1H4EA 5AJNA 1PZYB 2RJ9A 4HO3A 3I0CA 4HO8A 1TVYA 4Y6UA 1ZCTA 1H7LA 4BMAA 3QVBA 2X5SA 1IIMA 1Z90A 5AJOA 4B4GA 5IDTA 3TZTA 5JQQA 5FU0A 1LVWA 1H5RB 2MZBA 1R7VA 1OMZA 1GWWA 3SX5A 4G3QA 2D7IA 4KXOA 4FRMA 4M4KA 2AH9A 2FYBA 4KT7A 1R80A 1V84A 3N9WA 3Q7UA 4EE3A 3OGZA 3OH1A 5C1HA 3TQDA 1VZTA 3K8EA 3CKOA 4J18A 1H5TB 3OH3A 1W57A 2JCJA 2VXLA 4NAIA 3Q80A 1ZCYA 5C47A 2ICYA 4Y7TA 5C48A 4Y6NA 1HM9A 4FRQA 4JISA 3SXDA 4D11A 1W77A 4XWIA 3V8YA 5C4EA 1HV9A 1LZIA 2NXVA 3CKJA 2OI6A 3U2TA 1ZJPA 3I0LA 5DDTA 5FTVA 2D7RA 1HJLA 4M2BA 2E3DA 4K6RA 2OI7A 2PX7A 1NQIB 1ZI3A 5C4DA 2DPWA 4HO5A 1ON8A 1R7XA 3DUVA 5HS2A 1LZ7A 1R7YA 3U2VA 3SX3A 4EE5A 2FFUA 4FRDA 3V8ZA 4EE4A 4NALA 1FGXA 2ZU7A 2W0VA 1ZCUA 3NGWA 5IFYA 1LL3A 3T7OA 2BO7A 2W0WA 4HCQA 3PKQA 2XWNA 3HL3A 1R81A 2A8UA 2RIZA 4EEMA 1H5TA 2WVMA 4EEGA 2CU2A 5C4FA 3DK5A 2YC3A 1JVDA 2QKXA 4JD0A 3CU0A 4Q7CA 5C36A 4B2XA 5L6VA 1MP3A 2VSHA 2Y4LA 1YP3A 1LL0A 1XHBA 4ECMA 1PZTA 2QGIA 3F1YA 4Y62A 3V0LA 5CQMX 1EYRA 4KNXA 3BCVA 4Y7GA 3ZGGA 1GX0A 1S4NA 4KPXA 1R82A 2AM4A 3OKRA 4CJCA 1FRWA 1S4OA 2ICXA 2FYDB 2VXMA 4EEAA 1NMMB 2RJ1A 2YQJA 3I0HA 1FXOA 3FWWA 4HG6A 3OAMA 2J0BA 4KPZA 2RIYA 1EZIA 4DDZA 2BO4A 1TZFA 1WT3A 2J0AA 3ZGFA 2YESA 4UEGA 3RMVA 2VS3A 1H5SA 3LW6A 3I0IX 1YP2A 1JV3A 3KIAA 1WSZA 1VZUA 1ZJ0A 2FYCB 5CMJA 2AE7A 2BO6A 1NKHB 1R7TA 3V0QA 2FY7A 2YQCA 2JCOA 1FXJA 1LZJA 1ZHJA 1KWSA 4FRHA 3SX7A 2ZU8A 4ZDQA 1WT2A 3I0JA 3F1CA 5CQOA 2RJ6A 2AM3A 2AECA 2UX8A 3Q4SA 1WVCA 2VK9A 1ZI4A 2APCA 3DJ4A 1ON6A 4B42A 2Y4MA 5EIYA 2P72A 3K8DA 2V0KA 1TW5A 2XWLA 3I0FA 1H4CA 4NANA 3OC9A 4CJ8A 1GX4A 3RSBA 2GGOA 2OI5A 5EJZA 2O1GA 2Y6PA 1INJA 4BQHA 1VGUA 5CMIA 2YCMA 2D0JA 1FWYA 2WVKA 1ZJOA 4AYJA 4FROA 1R7UA 4D0TA 4EVWA 2JCLA 2X65A 3JTJA 3OH2A 1FO8A 1YP4A 1G2VA 1K4VA 1G97A 1XZ6A 1ZI1A 1ZJ1A 5C1GA 3USRA 3RMWA 4CVHA 3POLA 1ZDGA 2RJ5A 3SXGA 3JUKA 2I5KA 4D48A 1MC3A 5FV9A 1MP4A 2RJ0A 4KQLA 5C8RA 4P02A 1VGWA 1W55A 4D11C 4B4MA 1FR9A 2I7BA 2AM5A 5C38A 1HJJA 1H5SB 4O6MA 1G3LA 1QGQA 1FOAA 3OH0A 2I5EA 2WEEA 1JYLA 3SXEA 2VSIA 5CMFX 2YQHA 2P73A 3CKQA 3I0GA 1S4PA 1WT0A 1H7EA 5L6SA 2Y7AA 1H4DA 3R2WA 2QH5A 1GQCA 2JCKA 1VGZA 3GUEA 1GWVA 4MYBA 1H7FA 1ZJ2A 5C3AA 2E8BA 3U2XA 2OEFA 4CJBA 2OEGA 4KC1A 2V0HA 3T7NA 4HO9A 1G95A 1QGSA 4AYLA 1G8OA 1G0RA 1IINA 2XWMA 1G1LA 4YS8A 4LW3A 1FR8A 4IRPA 5C3BA 1H7GA 3I0DA 3O3PA 4KNRA 1E5KA 1TW1A 2WE9A 4Y63A 4KC2A 3CKVA 3D98A 2O1FA 1H7HA 1NWGB 3ST8A 2ZU9A 2AGDA 1YROB 1JV1A 2RIXA 3D5NA 1OQMB 4O6NA 3I0EA 1ZCVA 3OH4A 4FCUA 4P00A 4G87A 1G93A 1GQ9A 3SPTA 4HO6A 4Y7FA 4FRBA 2X60A 5CQPA 2VFZA 3SXBA 4GBPA 3ZF8A 4FIYA 4B3UA 5C49A 1LL2A 4FQWA 3SXAA 1V82A 2O1HA 4FCEA 4B2WA 1O0RA 2BO8A 3V0NA 2Z87A 4EEOA 1ZJ3A 5CMGX 5CQNX 4Y7UA 3U2WA 4FRAA 4AAWA 1VGTA 1NF5B 1H5SC 4DECA 3E25A 4B4BA 2FYAA 4ASJA 4Y9XA 3JUJA 5IDSA 1HM8A 3I0KA 5D91A 1O7OA 5FUHA 3U0XA 3V91A 2V0JA 1GA8A 1VICA 1FZWA 1HM0A 3ZLKA 4L41C 1FGGA 3BRKX 3SXCA 4FRPA 1G23A 1I52A
chains in the Genus database with same CATH topology
5FYEA 1JVGA 2PA4A 2AESA 3SX8A 2Y4JA 3EE5A 5C1LA 1O23B 2Q4JA 5BXCA 5D92A 2Y4KA 4MNDA 5AJPA 4LW6A 3E26A 3V0OA 4R7PA 1FG5N 1O7QA 2V0LA 1ZI5A 1ZDFA 5DDVA 4DE7A 1OMXA 4M2AA 2VS4A 5C4BA 3CGXA 1VZXA 3V0PA 1JYKA 2VS5A 3T7MA 1H7QA 1VH3A 1NHEB 2WGZA 1H5RA 4AC3A 2XMEA 1H7TA 4B5BA 4C2SA 2PGVA 4G3SA 3IOJA 4KC4A 4FIXA 2FFVA 3U0YA 2RJ8A 5J49A 4MIXA 2XMHA 2Z86A 2RJ4A 4HO0A 1FO9A 3V90A 4HO2A 4KRVA 2A8WA 3FOQA 5EJ1A 3IOHA 4ARWA 2RJ7A 1VM8A 1ZIZA 3PNNA 5CMHA 3USQA 2P6WA 5C4CA 1H5SD 2WVLA 4FREA 1QWJA 5FU8A 3ZLLA 2YQSA 3R3IA 4FRLA 3U2UA 4HOCA 1G9RA 3D8VA 3V0MA 1QG8A 1LZ0A 1WT1A 2V0IA 2GGQA 1INIA 4M28A 4D0ZA 4IRQA 1SS9A 5FTSA 1H3MA 2WAWA 4Y64A 3CKNA 2C0NA 2PGYA 4ASYA 3IOIA 4E1KA 2X5ZA 3PKPA 1MP5A 2YC5A 5CQLX 2RITA 5C3DA 1VH1A 4G3PA 1V83A 1VPAA 4Y7VA 2VD4A 4HO4A 5I1FA 4NAKA 1H4EA 5AJNA 1PZYB 2RJ9A 4HO3A 3I0CA 4HO8A 1TVYA 4Y6UA 1ZCTA 1H7LA 4BMAA 3QVBA 2X5SA 1IIMA 1Z90A 5AJOA 4B4GA 5IDTA 3TZTA 5JQQA 5FU0A 1LVWA 1H5RB 2MZBA 1R7VA 1OMZA 1GWWA 3SX5A 4G3QA 2D7IA 4KXOA 4FRMA 4M4KA 2AH9A 2FYBA 4KT7A 1R80A 1V84A 3N9WA 3Q7UA 4EE3A 3OGZA 3OH1A 5C1HA 3TQDA 1VZTA 3K8EA 3CKOA 4J18A 1H5TB 3OH3A 1W57A 2JCJA 2VXLA 4NAIA 3Q80A 1ZCYA 5C47A 2ICYA 4Y7TA 5C48A 4Y6NA 1HM9A 4FRQA 4JISA 3SXDA 4D11A 1W77A 4XWIA 3V8YA 5C4EA 1HV9A 1LZIA 2NXVA 3CKJA 2OI6A 3U2TA 1ZJPA 3I0LA 5DDTA 5FTVA 2D7RA 1HJLA 4M2BA 2E3DA 4K6RA 2OI7A 2PX7A 1NQIB 1ZI3A 5C4DA 2DPWA 4HO5A 1ON8A 1R7XA 3DUVA 5HS2A 1LZ7A 1R7YA 3U2VA 3SX3A 4EE5A 2FFUA 4FRDA 3V8ZA 4EE4A 4NALA 1FGXA 2ZU7A 2W0VA 1ZCUA 3NGWA 5IFYA 1LL3A 3T7OA 2BO7A 2W0WA 4HCQA 3PKQA 2XWNA 3HL3A 1R81A 2A8UA 2RIZA 4EEMA 1H5TA 2WVMA 4EEGA 2CU2A 5C4FA 3DK5A 2YC3A 1JVDA 2QKXA 4JD0A 3CU0A 4Q7CA 5C36A 4B2XA 5L6VA 1MP3A 2VSHA 2Y4LA 1YP3A 1LL0A 1XHBA 4ECMA 1PZTA 2QGIA 3F1YA 4Y62A 3V0LA 5CQMX 1EYRA 4KNXA 3BCVA 4Y7GA 3ZGGA 1GX0A 1S4NA 4KPXA 1R82A 2AM4A 3OKRA 4CJCA 1FRWA 1S4OA 2ICXA 2FYDB 2VXMA 4EEAA 1NMMB 2RJ1A 2YQJA 3I0HA 1FXOA 3FWWA 4HG6A 3OAMA 2J0BA 4KPZA 2RIYA 1EZIA 4DDZA 2BO4A 1TZFA 1WT3A 2J0AA 3ZGFA 2YESA 4UEGA 3RMVA 2VS3A 1H5SA 3LW6A 3I0IX 1YP2A 1JV3A 3KIAA 1WSZA 1VZUA 1ZJ0A 2FYCB 5CMJA 2AE7A 2BO6A 1NKHB 1R7TA 3V0QA 2FY7A 2YQCA 2JCOA 1FXJA 1LZJA 1ZHJA 1KWSA 4FRHA 3SX7A 2ZU8A 4ZDQA 1WT2A 3I0JA 3F1CA 5CQOA 2RJ6A 2AM3A 2AECA 2UX8A 3Q4SA 1WVCA 2VK9A 1ZI4A 2APCA 3DJ4A 1ON6A 4B42A 2Y4MA 5EIYA 2P72A 3K8DA 2V0KA 1TW5A 2XWLA 3I0FA 1H4CA 4NANA 3OC9A 4CJ8A 1GX4A 3RSBA 2GGOA 2OI5A 5EJZA 2O1GA 2Y6PA 1INJA 4BQHA 1VGUA 5CMIA 2YCMA 2D0JA 1FWYA 2WVKA 1ZJOA 4AYJA 4FROA 1R7UA 4D0TA 4EVWA 2JCLA 2X65A 3JTJA 3OH2A 1FO8A 1YP4A 1G2VA 1K4VA 1G97A 1XZ6A 1ZI1A 1ZJ1A 5C1GA 3USRA 3RMWA 4CVHA 3POLA 1ZDGA 2RJ5A 3SXGA 3JUKA 2I5KA 4D48A 1MC3A 5FV9A 1MP4A 2RJ0A 4KQLA 5C8RA 4P02A 1VGWA 1W55A 4D11C 4B4MA 1FR9A 2I7BA 2AM5A 5C38A 1HJJA 1H5SB 4O6MA 1G3LA 1QGQA 1FOAA 3OH0A 2I5EA 2WEEA 1JYLA 3SXEA 2VSIA 5CMFX 2YQHA 2P73A 3CKQA 3I0GA 1S4PA 1WT0A 1H7EA 5L6SA 2Y7AA 1H4DA 3R2WA 2QH5A 1GQCA 2JCKA 1VGZA 3GUEA 1GWVA 4MYBA 1H7FA 1ZJ2A 5C3AA 2E8BA 3U2XA 2OEFA 4CJBA 2OEGA 4KC1A 2V0HA 3T7NA 4HO9A 1G95A 1QGSA 4AYLA 1G8OA 1G0RA 1IINA 2XWMA 1G1LA 4YS8A 4LW3A 1FR8A 4IRPA 5C3BA 1H7GA 3I0DA 3O3PA 4KNRA 1E5KA 1TW1A 2WE9A 4Y63A 4KC2A 3CKVA 3D98A 2O1FA 1H7HA 1NWGB 3ST8A 2ZU9A 2AGDA 1YROB 1JV1A 2RIXA 3D5NA 1OQMB 4O6NA 3I0EA 1ZCVA 3OH4A 4FCUA 4P00A 4G87A 1G93A 1GQ9A 3SPTA 4HO6A 4Y7FA 4FRBA 2X60A 5CQPA 2VFZA 3SXBA 4GBPA 3ZF8A 4FIYA 4B3UA 5C49A 1LL2A 4FQWA 3SXAA 1V82A 2O1HA 4FCEA 4B2WA 1O0RA 2BO8A 3V0NA 2Z87A 4EEOA 1ZJ3A 5CMGX 5CQNX 4Y7UA 3U2WA 4FRAA 4AAWA 1VGTA 1NF5B 1H5SC 4DECA 3E25A 4B4BA 2FYAA 4ASJA 4Y9XA 3JUJA 5IDSA 1HM8A 3I0KA 5D91A 1O7OA 5FUHA 3U0XA 3V91A 2V0JA 1GA8A 1VICA 1FZWA 1HM0A 3ZLKA 4L41C 1FGGA 3BRKX 3SXCA 4FRPA 1G23A 1I52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYE A;  1JVG A;  2PA4 A;  2AES A;  3SX8 A;  2Y4J A;  3EE5 A;  5C1L A;  1O23 B;  2Q4J A;  5BXC A;  2Y4K A;  4MND A;  5AJP A;  4LW6 A;  3E26 A;  3V0O A;  4R7P A;  1FG5 N;  1O7Q A;  2V0L A;  1ZI5 A;  1ZDF A;  5DDV A;  4DE7 A;  1OMX A;  4M2A A;  2VS4 A;  5C4B A;  3CGX A;  1VZX A;  3V0P A;  1JYK A;  2VS5 A;  3T7M A;  1H7Q A;  1VH3 A;  1NHE B;  2WGZ A;  1H5R A;  4AC3 A;  2XME A;  1H7T A;  4B5B A;  4C2S A;  2PGV A;  4G3S A;  3IOJ A;  4KC4 A;  2FFV A;  3U0Y A;  2RJ8 A;  5J49 A;  2XMH A;  2Z86 A;  2RJ4 A;  4HO0 A;  1FO9 A;  3V90 A;  4HO2 A;  4KRV A;  2A8W A;  3FOQ A;  5EJ1 A;  3IOH A;  4ARW A;  2RJ7 A;  1VM8 A;  1ZIZ A;  3PNN A;  5CMH A;  3USQ A;  2P6W A;  5C4C A;  1H5S D;  2WVL A;  4FRE A;  1QWJ A;  5FU8 A;  3ZLL A;  2YQS A;  3R3I A;  4FRL A;  3U2U A;  4HOC A;  1G9R A;  3D8V A;  3V0M A;  1QG8 A;  1LZ0 A;  1WT1 A;  2V0I A;  2GGQ A;  1INI A;  4M28 A;  4D0Z A;  4IRQ A;  1SS9 A;  5FTS A;  1H3M A;  2WAW A;  4Y64 A;  3CKN A;  2PGY A;  4ASY A;  3IOI A;  4E1K A;  2X5Z A;  3PKP A;  1MP5 A;  2YC5 A;  5CQL X;  2RIT A;  5C3D A;  1VH1 A;  4G3P A;  1V83 A;  1VPA A;  4Y7V A;  2VD4 A;  4HO4 A;  5I1F A;  4NAK A;  1H4E A;  5AJN A;  1PZY B;  2RJ9 A;  4HO3 A;  3I0C A;  4HO8 A;  1TVY A;  4Y6U A;  1ZCT A;  1H7L A;  4BMA A;  3QVB A;  2X5S A;  1IIM A;  1Z90 A;  5AJO A;  4B4G A;  5IDT A;  3TZT A;  5JQQ A;  5FU0 A;  1LVW A;  1H5R B;  2MZB A;  1R7V A;  1OMZ A;  1GWW A;  3SX5 A;  4G3Q A;  2D7I A;  4KXO A;  4FRM A;  4M4K A;  2AH9 A;  2FYB A;  4KT7 A;  1R80 A;  1V84 A;  3N9W A;  3Q7U A;  4EE3 A;  3OGZ A;  3OH1 A;  5C1H A;  3TQD A;  1VZT A;  3K8E A;  3CKO A;  4J18 A;  1H5T B;  3OH3 A;  1W57 A;  2JCJ A;  2VXL A;  4NAI A;  3Q80 A;  1ZCY A;  5C47 A;  2ICY A;  4Y7T A;  5C48 A;  4Y6N A;  1HM9 A;  4FRQ A;  4JIS A;  3SXD A;  4D11 A;  1W77 A;  4XWI A;  3V8Y A;  5C4E A;  1HV9 A;  1LZI A;  2NXV A;  3CKJ A;  2OI6 A;  3U2T A;  1ZJP A;  3I0L A;  5DDT A;  5FTV A;  2D7R A;  1HJL A;  4M2B A;  2E3D A;  4K6R A;  2OI7 A;  2PX7 A;  1NQI B;  1ZI3 A;  5C4D A;  2DPW A;  4HO5 A;  1ON8 A;  1R7X A;  3DUV A;  5HS2 A;  1LZ7 A;  1R7Y A;  3U2V A;  3SX3 A;  4EE5 A;  2FFU A;  4FRD A;  3V8Z A;  4EE4 A;  4NAL A;  1FGX A;  2ZU7 A;  2W0V A;  1ZCU A;  3NGW A;  5IFY A;  1LL3 A;  3T7O A;  2BO7 A;  2W0W A;  4HCQ A;  3PKQ A;  2XWN A;  3HL3 A;  1R81 A;  2A8U A;  2RIZ A;  4EEM A;  1H5T A;  2WVM A;  4EEG A;  2CU2 A;  5C4F A;  3DK5 A;  2YC3 A;  1JVD A;  2QKX A;  4JD0 A;  3CU0 A;  5C36 A;  4B2X A;  5L6V A;  1MP3 A;  2VSH A;  2Y4L A;  1YP3 A;  1LL0 A;  1XHB A;  4ECM A;  1PZT A;  2QGI A;  3F1Y A;  4Y62 A;  3V0L A;  5CQM X;  1EYR A;  4KNX A;  3BCV A;  4Y7G A;  3ZGG A;  1GX0 A;  1S4N A;  4KPX A;  1R82 A;  2AM4 A;  3OKR A;  4CJC A;  1FRW A;  1S4O A;  2ICX A;  2FYD B;  2VXM A;  4EEA A;  1NMM B;  2RJ1 A;  2YQJ A;  3I0H A;  1FXO A;  3FWW A;  4HG6 A;  3OAM A;  4KPZ A;  2RIY A;  1EZI A;  4DDZ A;  2BO4 A;  1TZF A;  1WT3 A;  3ZGF A;  2YES A;  4UEG A;  3RMV A;  2VS3 A;  1H5S A;  3LW6 A;  3I0I X;  1YP2 A;  1JV3 A;  3KIA A;  1WSZ A;  1VZU A;  1ZJ0 A;  2FYC B;  5CMJ A;  2AE7 A;  2BO6 A;  1NKH B;  1R7T A;  3V0Q A;  2FY7 A;  2YQC A;  2JCO A;  1FXJ A;  1LZJ A;  1ZHJ A;  1KWS A;  4FRH A;  3SX7 A;  2ZU8 A;  4ZDQ A;  1WT2 A;  3I0J A;  3F1C A;  5CQO A;  2RJ6 A;  2AM3 A;  2AEC A;  2UX8 A;  3Q4S A;  1WVC A;  1ZI4 A;  2APC A;  3DJ4 A;  1ON6 A;  4B42 A;  2Y4M A;  5EIY A;  2P72 A;  3K8D A;  2V0K A;  1TW5 A;  2XWL A;  3I0F A;  1H4C A;  4NAN A;  3OC9 A;  4CJ8 A;  1GX4 A;  3RSB A;  2GGO A;  2OI5 A;  5EJZ A;  2O1G A;  2Y6P A;  1INJ A;  4BQH A;  1VGU A;  5CMI A;  2YCM A;  2D0J A;  1FWY A;  2WVK A;  1ZJO A;  4AYJ A;  4FRO A;  1R7U A;  4D0T A;  4EVW A;  2JCL A;  2X65 A;  3JTJ A;  3OH2 A;  1FO8 A;  1YP4 A;  1G2V A;  1K4V A;  1G97 A;  1XZ6 A;  1ZI1 A;  1ZJ1 A;  5C1G A;  3USR A;  3RMW A;  4CVH A;  3POL A;  1ZDG A;  2RJ5 A;  3SXG A;  3JUK A;  2I5K A;  4D48 A;  1MC3 A;  5FV9 A;  1MP4 A;  2RJ0 A;  4KQL A;  5C8R A;  4P02 A;  1VGW A;  1W55 A;  4D11 C;  4B4M A;  1FR9 A;  2I7B A;  2AM5 A;  5C38 A;  1HJJ A;  1H5S B;  1G3L A;  1QGQ A;  1FOA A;  3OH0 A;  2I5E A;  2WEE A;  1JYL A;  3SXE A;  2VSI A;  5CMF X;  2YQH A;  2P73 A;  3CKQ A;  3I0G A;  1S4P A;  1WT0 A;  1H7E A;  5L6S A;  2Y7A A;  1H4D A;  3R2W A;  2QH5 A;  1GQC A;  2JCK A;  1VGZ A;  3GUE A;  1GWV A;  4MYB A;  1H7F A;  1ZJ2 A;  5C3A A;  2E8B A;  3U2X A;  2OEF A;  4CJB A;  2OEG A;  4KC1 A;  2V0H A;  3T7N A;  4HO9 A;  1G95 A;  1QGS A;  4AYL A;  1G8O A;  1G0R A;  1IIN A;  2XWM A;  1G1L A;  4YS8 A;  4LW3 A;  1FR8 A;  4IRP A;  5C3B A;  1H7G A;  3I0D A;  3O3P A;  4KNR A;  1E5K A;  1TW1 A;  2WE9 A;  4Y63 A;  4KC2 A;  3CKV A;  3D98 A;  2O1F A;  1H7H A;  1NWG B;  3ST8 A;  2ZU9 A;  2AGD A;  1YRO B;  1JV1 A;  2RIX A;  3D5N A;  1OQM B;  3I0E A;  1ZCV A;  3OH4 A;  4FCU A;  4P00 A;  4G87 A;  1G93 A;  1GQ9 A;  3SPT A;  4HO6 A;  4Y7F A;  4FRB A;  2X60 A;  5CQP A;  2VFZ A;  3SXB A;  4GBP A;  3ZF8 A;  4B3U A;  5C49 A;  1LL2 A;  4FQW A;  3SXA A;  1V82 A;  2O1H A;  4FCE A;  4B2W A;  1O0R A;  2BO8 A;  3V0N A;  2Z87 A;  4EEO A;  1ZJ3 A;  5CMG X;  5CQN X;  4Y7U A;  3U2W A;  4FRA A;  4AAW A;  1VGT A;  1NF5 B;  1H5S C;  4DEC A;  3E25 A;  4B4B A;  2FYA A;  4ASJ A;  4Y9X A;  3JUJ A;  5IDS A;  1HM8 A;  3I0K A;  1O7O A;  5FUH A;  3U0X A;  3V91 A;  2V0J A;  1GA8 A;  1VIC A;  1FZW A;  1HM0 A;  3ZLK A;  4L41 C;  1FGG A;  3BRK X;  3SXC A;  4FRP A;  1G23 A;  1I52 A; 
#chains in the Genus database with same CATH topology
 5FYE A;  1JVG A;  2PA4 A;  2AES A;  3SX8 A;  2Y4J A;  3EE5 A;  5C1L A;  1O23 B;  2Q4J A;  5BXC A;  5D92 A;  2Y4K A;  4MND A;  5AJP A;  4LW6 A;  3E26 A;  3V0O A;  4R7P A;  1FG5 N;  1O7Q A;  2V0L A;  1ZI5 A;  1ZDF A;  5DDV A;  4DE7 A;  1OMX A;  4M2A A;  2VS4 A;  5C4B A;  3CGX A;  1VZX A;  3V0P A;  1JYK A;  2VS5 A;  3T7M A;  1H7Q A;  1VH3 A;  1NHE B;  2WGZ A;  1H5R A;  4AC3 A;  2XME A;  1H7T A;  4B5B A;  4C2S A;  2PGV A;  4G3S A;  3IOJ A;  4KC4 A;  4FIX A;  2FFV A;  3U0Y A;  2RJ8 A;  5J49 A;  4MIX A;  2XMH A;  2Z86 A;  2RJ4 A;  4HO0 A;  1FO9 A;  3V90 A;  4HO2 A;  4KRV A;  2A8W A;  3FOQ A;  5EJ1 A;  3IOH A;  4ARW A;  2RJ7 A;  1VM8 A;  1ZIZ A;  3PNN A;  5CMH A;  3USQ A;  2P6W A;  5C4C A;  1H5S D;  2WVL A;  4FRE A;  1QWJ A;  5FU8 A;  3ZLL A;  2YQS A;  3R3I A;  4FRL A;  3U2U A;  4HOC A;  1G9R A;  3D8V A;  3V0M A;  1QG8 A;  1LZ0 A;  1WT1 A;  2V0I A;  2GGQ A;  1INI A;  4M28 A;  4D0Z A;  4IRQ A;  1SS9 A;  5FTS A;  1H3M A;  2WAW A;  4Y64 A;  3CKN A;  2C0N A;  2PGY A;  4ASY A;  3IOI A;  4E1K A;  2X5Z A;  3PKP A;  1MP5 A;  2YC5 A;  5CQL X;  2RIT A;  5C3D A;  1VH1 A;  4G3P A;  1V83 A;  1VPA A;  4Y7V A;  2VD4 A;  4HO4 A;  5I1F A;  4NAK A;  1H4E A;  5AJN A;  1PZY B;  2RJ9 A;  4HO3 A;  3I0C A;  4HO8 A;  1TVY A;  4Y6U A;  1ZCT A;  1H7L A;  4BMA A;  3QVB A;  2X5S A;  1IIM A;  1Z90 A;  5AJO A;  4B4G A;  5IDT A;  3TZT A;  5JQQ A;  5FU0 A;  1LVW A;  1H5R B;  2MZB A;  1R7V A;  1OMZ A;  1GWW A;  3SX5 A;  4G3Q A;  2D7I A;  4KXO A;  4FRM A;  4M4K A;  2AH9 A;  2FYB A;  4KT7 A;  1R80 A;  1V84 A;  3N9W A;  3Q7U A;  4EE3 A;  3OGZ A;  3OH1 A;  5C1H A;  3TQD A;  1VZT A;  3K8E A;  3CKO A;  4J18 A;  1H5T B;  3OH3 A;  1W57 A;  2JCJ A;  2VXL A;  4NAI A;  3Q80 A;  1ZCY A;  5C47 A;  2ICY A;  4Y7T A;  5C48 A;  4Y6N A;  1HM9 A;  4FRQ A;  4JIS A;  3SXD A;  4D11 A;  1W77 A;  4XWI A;  3V8Y A;  5C4E A;  1HV9 A;  1LZI A;  2NXV A;  3CKJ A;  2OI6 A;  3U2T A;  1ZJP A;  3I0L A;  5DDT A;  5FTV A;  2D7R A;  1HJL A;  4M2B A;  2E3D A;  4K6R A;  2OI7 A;  2PX7 A;  1NQI B;  1ZI3 A;  5C4D A;  2DPW A;  4HO5 A;  1ON8 A;  1R7X A;  3DUV A;  5HS2 A;  1LZ7 A;  1R7Y A;  3U2V A;  3SX3 A;  4EE5 A;  2FFU A;  4FRD A;  3V8Z A;  4EE4 A;  4NAL A;  1FGX A;  2ZU7 A;  2W0V A;  1ZCU A;  3NGW A;  5IFY A;  1LL3 A;  3T7O A;  2BO7 A;  2W0W A;  4HCQ A;  3PKQ A;  2XWN A;  3HL3 A;  1R81 A;  2A8U A;  2RIZ A;  4EEM A;  1H5T A;  2WVM A;  4EEG A;  2CU2 A;  5C4F A;  3DK5 A;  2YC3 A;  1JVD A;  2QKX A;  4JD0 A;  3CU0 A;  4Q7C A;  5C36 A;  4B2X A;  5L6V A;  1MP3 A;  2VSH A;  2Y4L A;  1YP3 A;  1LL0 A;  1XHB A;  4ECM A;  1PZT A;  2QGI A;  3F1Y A;  4Y62 A;  3V0L A;  5CQM X;  1EYR A;  4KNX A;  3BCV A;  4Y7G A;  3ZGG A;  1GX0 A;  1S4N A;  4KPX A;  1R82 A;  2AM4 A;  3OKR A;  4CJC A;  1FRW A;  1S4O A;  2ICX A;  2FYD B;  2VXM A;  4EEA A;  1NMM B;  2RJ1 A;  2YQJ A;  3I0H A;  1FXO A;  3FWW A;  4HG6 A;  3OAM A;  2J0B A;  4KPZ A;  2RIY A;  1EZI A;  4DDZ A;  2BO4 A;  1TZF A;  1WT3 A;  2J0A A;  3ZGF A;  2YES A;  4UEG A;  3RMV A;  2VS3 A;  1H5S A;  3LW6 A;  3I0I X;  1YP2 A;  1JV3 A;  3KIA A;  1WSZ A;  1VZU A;  1ZJ0 A;  2FYC B;  5CMJ A;  2AE7 A;  2BO6 A;  1NKH B;  1R7T A;  3V0Q A;  2FY7 A;  2YQC A;  2JCO A;  1FXJ A;  1LZJ A;  1ZHJ A;  1KWS A;  4FRH A;  3SX7 A;  2ZU8 A;  4ZDQ A;  1WT2 A;  3I0J A;  3F1C A;  5CQO A;  2RJ6 A;  2AM3 A;  2AEC A;  2UX8 A;  3Q4S A;  1WVC A;  2VK9 A;  1ZI4 A;  2APC A;  3DJ4 A;  1ON6 A;  4B42 A;  2Y4M A;  5EIY A;  2P72 A;  3K8D A;  2V0K A;  1TW5 A;  2XWL A;  3I0F A;  1H4C A;  4NAN A;  3OC9 A;  4CJ8 A;  1GX4 A;  3RSB A;  2GGO A;  2OI5 A;  5EJZ A;  2O1G A;  2Y6P A;  1INJ A;  4BQH A;  1VGU A;  5CMI A;  2YCM A;  2D0J A;  1FWY A;  2WVK A;  1ZJO A;  4AYJ A;  4FRO A;  1R7U A;  4D0T A;  4EVW A;  2JCL A;  2X65 A;  3JTJ A;  3OH2 A;  1FO8 A;  1YP4 A;  1G2V A;  1K4V A;  1G97 A;  1XZ6 A;  1ZI1 A;  1ZJ1 A;  5C1G A;  3USR A;  3RMW A;  4CVH A;  3POL A;  1ZDG A;  2RJ5 A;  3SXG A;  3JUK A;  2I5K A;  4D48 A;  1MC3 A;  5FV9 A;  1MP4 A;  2RJ0 A;  4KQL A;  5C8R A;  4P02 A;  1VGW A;  1W55 A;  4D11 C;  4B4M A;  1FR9 A;  2I7B A;  2AM5 A;  5C38 A;  1HJJ A;  1H5S B;  4O6M A;  1G3L A;  1QGQ A;  1FOA A;  3OH0 A;  2I5E A;  2WEE A;  1JYL A;  3SXE A;  2VSI A;  5CMF X;  2YQH A;  2P73 A;  3CKQ A;  3I0G A;  1S4P A;  1WT0 A;  1H7E A;  5L6S A;  2Y7A A;  1H4D A;  3R2W A;  2QH5 A;  1GQC A;  2JCK A;  1VGZ A;  3GUE A;  1GWV A;  4MYB A;  1H7F A;  1ZJ2 A;  5C3A A;  2E8B A;  3U2X A;  2OEF A;  4CJB A;  2OEG A;  4KC1 A;  2V0H A;  3T7N A;  4HO9 A;  1G95 A;  1QGS A;  4AYL A;  1G8O A;  1G0R A;  1IIN A;  2XWM A;  1G1L A;  4YS8 A;  4LW3 A;  1FR8 A;  4IRP A;  5C3B A;  1H7G A;  3I0D A;  3O3P A;  4KNR A;  1E5K A;  1TW1 A;  2WE9 A;  4Y63 A;  4KC2 A;  3CKV A;  3D98 A;  2O1F A;  1H7H A;  1NWG B;  3ST8 A;  2ZU9 A;  2AGD A;  1YRO B;  1JV1 A;  2RIX A;  3D5N A;  1OQM B;  4O6N A;  3I0E A;  1ZCV A;  3OH4 A;  4FCU A;  4P00 A;  4G87 A;  1G93 A;  1GQ9 A;  3SPT A;  4HO6 A;  4Y7F A;  4FRB A;  2X60 A;  5CQP A;  2VFZ A;  3SXB A;  4GBP A;  3ZF8 A;  4FIY A;  4B3U A;  5C49 A;  1LL2 A;  4FQW A;  3SXA A;  1V82 A;  2O1H A;  4FCE A;  4B2W A;  1O0R A;  2BO8 A;  3V0N A;  2Z87 A;  4EEO A;  1ZJ3 A;  5CMG X;  5CQN X;  4Y7U A;  3U2W A;  4FRA A;  4AAW A;  1VGT A;  1NF5 B;  1H5S C;  4DEC A;  3E25 A;  4B4B A;  2FYA A;  4ASJ A;  4Y9X A;  3JUJ A;  5IDS A;  1HM8 A;  3I0K A;  5D91 A;  1O7O A;  5FUH A;  3U0X A;  3V91 A;  2V0J A;  1GA8 A;  1VIC A;  1FZW A;  1HM0 A;  3ZLK A;  4L41 C;  1FGG A;  3BRK X;  3SXC A;  4FRP A;  1G23 A;  1I52 A; 
#chains in the Genus database with same CATH homology
 5FYE A;  1JVG A;  2PA4 A;  2AES A;  3SX8 A;  2Y4J A;  3EE5 A;  5C1L A;  1O23 B;  2Q4J A;  5BXC A;  5D92 A;  2Y4K A;  4MND A;  5AJP A;  4LW6 A;  3E26 A;  3V0O A;  4R7P A;  1FG5 N;  1O7Q A;  2V0L A;  1ZI5 A;  1ZDF A;  5DDV A;  4DE7 A;  1OMX A;  4M2A A;  2VS4 A;  5C4B A;  3CGX A;  1VZX A;  3V0P A;  1JYK A;  2VS5 A;  3T7M A;  1H7Q A;  1VH3 A;  1NHE B;  2WGZ A;  1H5R A;  4AC3 A;  2XME A;  1H7T A;  4B5B A;  4C2S A;  2PGV A;  4G3S A;  3IOJ A;  4KC4 A;  4FIX A;  2FFV A;  3U0Y A;  2RJ8 A;  5J49 A;  4MIX A;  2XMH A;  2Z86 A;  2RJ4 A;  4HO0 A;  1FO9 A;  3V90 A;  4HO2 A;  4KRV A;  2A8W A;  3FOQ A;  5EJ1 A;  3IOH A;  4ARW A;  2RJ7 A;  1VM8 A;  1ZIZ A;  3PNN A;  5CMH A;  3USQ A;  2P6W A;  5C4C A;  1H5S D;  2WVL A;  4FRE A;  1QWJ A;  5FU8 A;  3ZLL A;  2YQS A;  3R3I A;  4FRL A;  3U2U A;  4HOC A;  1G9R A;  3D8V A;  3V0M A;  1QG8 A;  1LZ0 A;  1WT1 A;  2V0I A;  2GGQ A;  1INI A;  4M28 A;  4D0Z A;  4IRQ A;  1SS9 A;  5FTS A;  1H3M A;  2WAW A;  4Y64 A;  3CKN A;  2C0N A;  2PGY A;  4ASY A;  3IOI A;  4E1K A;  2X5Z A;  3PKP A;  1MP5 A;  2YC5 A;  5CQL X;  2RIT A;  5C3D A;  1VH1 A;  4G3P A;  1V83 A;  1VPA A;  4Y7V A;  2VD4 A;  4HO4 A;  5I1F A;  4NAK A;  1H4E A;  5AJN A;  1PZY B;  2RJ9 A;  4HO3 A;  3I0C A;  4HO8 A;  1TVY A;  4Y6U A;  1ZCT A;  1H7L A;  4BMA A;  3QVB A;  2X5S A;  1IIM A;  1Z90 A;  5AJO A;  4B4G A;  5IDT A;  3TZT A;  5JQQ A;  5FU0 A;  1LVW A;  1H5R B;  2MZB A;  1R7V A;  1OMZ A;  1GWW A;  3SX5 A;  4G3Q A;  2D7I A;  4KXO A;  4FRM A;  4M4K A;  2AH9 A;  2FYB A;  4KT7 A;  1R80 A;  1V84 A;  3N9W A;  3Q7U A;  4EE3 A;  3OGZ A;  3OH1 A;  5C1H A;  3TQD A;  1VZT A;  3K8E A;  3CKO A;  4J18 A;  1H5T B;  3OH3 A;  1W57 A;  2JCJ A;  2VXL A;  4NAI A;  3Q80 A;  1ZCY A;  5C47 A;  2ICY A;  4Y7T A;  5C48 A;  4Y6N A;  1HM9 A;  4FRQ A;  4JIS A;  3SXD A;  4D11 A;  1W77 A;  4XWI A;  3V8Y A;  5C4E A;  1HV9 A;  1LZI A;  2NXV A;  3CKJ A;  2OI6 A;  3U2T A;  1ZJP A;  3I0L A;  5DDT A;  5FTV A;  2D7R A;  1HJL A;  4M2B A;  2E3D A;  4K6R A;  2OI7 A;  2PX7 A;  1NQI B;  1ZI3 A;  5C4D A;  2DPW A;  4HO5 A;  1ON8 A;  1R7X A;  3DUV A;  5HS2 A;  1LZ7 A;  1R7Y A;  3U2V A;  3SX3 A;  4EE5 A;  2FFU A;  4FRD A;  3V8Z A;  4EE4 A;  4NAL A;  1FGX A;  2ZU7 A;  2W0V A;  1ZCU A;  3NGW A;  5IFY A;  1LL3 A;  3T7O A;  2BO7 A;  2W0W A;  4HCQ A;  3PKQ A;  2XWN A;  3HL3 A;  1R81 A;  2A8U A;  2RIZ A;  4EEM A;  1H5T A;  2WVM A;  4EEG A;  2CU2 A;  5C4F A;  3DK5 A;  2YC3 A;  1JVD A;  2QKX A;  4JD0 A;  3CU0 A;  4Q7C A;  5C36 A;  4B2X A;  5L6V A;  1MP3 A;  2VSH A;  2Y4L A;  1YP3 A;  1LL0 A;  1XHB A;  4ECM A;  1PZT A;  2QGI A;  3F1Y A;  4Y62 A;  3V0L A;  5CQM X;  1EYR A;  4KNX A;  3BCV A;  4Y7G A;  3ZGG A;  1GX0 A;  1S4N A;  4KPX A;  1R82 A;  2AM4 A;  3OKR A;  4CJC A;  1FRW A;  1S4O A;  2ICX A;  2FYD B;  2VXM A;  4EEA A;  1NMM B;  2RJ1 A;  2YQJ A;  3I0H A;  1FXO A;  3FWW A;  4HG6 A;  3OAM A;  2J0B A;  4KPZ A;  2RIY A;  1EZI A;  4DDZ A;  2BO4 A;  1TZF A;  1WT3 A;  2J0A A;  3ZGF A;  2YES A;  4UEG A;  3RMV A;  2VS3 A;  1H5S A;  3LW6 A;  3I0I X;  1YP2 A;  1JV3 A;  3KIA A;  1WSZ A;  1VZU A;  1ZJ0 A;  2FYC B;  5CMJ A;  2AE7 A;  2BO6 A;  1NKH B;  1R7T A;  3V0Q A;  2FY7 A;  2YQC A;  2JCO A;  1FXJ A;  1LZJ A;  1ZHJ A;  1KWS A;  4FRH A;  3SX7 A;  2ZU8 A;  4ZDQ A;  1WT2 A;  3I0J A;  3F1C A;  5CQO A;  2RJ6 A;  2AM3 A;  2AEC A;  2UX8 A;  3Q4S A;  1WVC A;  2VK9 A;  1ZI4 A;  2APC A;  3DJ4 A;  1ON6 A;  4B42 A;  2Y4M A;  5EIY A;  2P72 A;  3K8D A;  2V0K A;  1TW5 A;  2XWL A;  3I0F A;  1H4C A;  4NAN A;  3OC9 A;  4CJ8 A;  1GX4 A;  3RSB A;  2GGO A;  2OI5 A;  5EJZ A;  2O1G A;  2Y6P A;  1INJ A;  4BQH A;  1VGU A;  5CMI A;  2YCM A;  2D0J A;  1FWY A;  2WVK A;  1ZJO A;  4AYJ A;  4FRO A;  1R7U A;  4D0T A;  4EVW A;  2JCL A;  2X65 A;  3JTJ A;  3OH2 A;  1FO8 A;  1YP4 A;  1G2V A;  1K4V A;  1G97 A;  1XZ6 A;  1ZI1 A;  1ZJ1 A;  5C1G A;  3USR A;  3RMW A;  4CVH A;  3POL A;  1ZDG A;  2RJ5 A;  3SXG A;  3JUK A;  2I5K A;  4D48 A;  1MC3 A;  5FV9 A;  1MP4 A;  2RJ0 A;  4KQL A;  5C8R A;  4P02 A;  1VGW A;  1W55 A;  4D11 C;  4B4M A;  1FR9 A;  2I7B A;  2AM5 A;  5C38 A;  1HJJ A;  1H5S B;  4O6M A;  1G3L A;  1QGQ A;  1FOA A;  3OH0 A;  2I5E A;  2WEE A;  1JYL A;  3SXE A;  2VSI A;  5CMF X;  2YQH A;  2P73 A;  3CKQ A;  3I0G A;  1S4P A;  1WT0 A;  1H7E A;  5L6S A;  2Y7A A;  1H4D A;  3R2W A;  2QH5 A;  1GQC A;  2JCK A;  1VGZ A;  3GUE A;  1GWV A;  4MYB A;  1H7F A;  1ZJ2 A;  5C3A A;  2E8B A;  3U2X A;  2OEF A;  4CJB A;  2OEG A;  4KC1 A;  2V0H A;  3T7N A;  4HO9 A;  1G95 A;  1QGS A;  4AYL A;  1G8O A;  1G0R A;  1IIN A;  2XWM A;  1G1L A;  4YS8 A;  4LW3 A;  1FR8 A;  4IRP A;  5C3B A;  1H7G A;  3I0D A;  3O3P A;  4KNR A;  1E5K A;  1TW1 A;  2WE9 A;  4Y63 A;  4KC2 A;  3CKV A;  3D98 A;  2O1F A;  1H7H A;  1NWG B;  3ST8 A;  2ZU9 A;  2AGD A;  1YRO B;  1JV1 A;  2RIX A;  3D5N A;  1OQM B;  4O6N A;  3I0E A;  1ZCV A;  3OH4 A;  4FCU A;  4P00 A;  4G87 A;  1G93 A;  1GQ9 A;  3SPT A;  4HO6 A;  4Y7F A;  4FRB A;  2X60 A;  5CQP A;  2VFZ A;  3SXB A;  4GBP A;  3ZF8 A;  4FIY A;  4B3U A;  5C49 A;  1LL2 A;  4FQW A;  3SXA A;  1V82 A;  2O1H A;  4FCE A;  4B2W A;  1O0R A;  2BO8 A;  3V0N A;  2Z87 A;  4EEO A;  1ZJ3 A;  5CMG X;  5CQN X;  4Y7U A;  3U2W A;  4FRA A;  4AAW A;  1VGT A;  1NF5 B;  1H5S C;  4DEC A;  3E25 A;  4B4B A;  2FYA A;  4ASJ A;  4Y9X A;  3JUJ A;  5IDS A;  1HM8 A;  3I0K A;  5D91 A;  1O7O A;  5FUH A;  3U0X A;  3V91 A;  2V0J A;  1GA8 A;  1VIC A;  1FZW A;  1HM0 A;  3ZLK A;  4L41 C;  1FGG A;  3BRK X;  3SXC A;  4FRP A;  1G23 A;  1I52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...