5CMIA

Gta mutant without mercury - e303d
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
282
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDDSHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Glycosyltransfer in mutants of putative catalytic residue Glu303 of the human ABO(H) A and B blood group glycosyltransferases GTA and GTB proceeds through a labile active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 282
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5cmiA00
5CQNX 4Y64A 3RMWA 4FRAA 3IOIA 1H4DA 1MP4A 1ZIZA 1G23A 1WSZA 2JCKA 3ZLKA 2AM3A 5C47A 1JVDA 5IFYA 2OI5A 1FGGA 2WGZA 1FO9A 1ZJPA 3T7NA 2FYAA 5FU0A 4NALA 4G3PA 5AJNA 5EJZA 2VXLA 1ZHJA 3GUEA 1ZI1A 3N9WA 2P72A 1H7TA 3SPTA 1R7TA 4EE3A 1INJA 3CKQA 2RJ4A 2D7RA 1VGZA 2BO7A 3CKNA 1W77A 4NAKA 4G3SA 1VH1A 1EZIA 4ARWA 3U2UA 2PGYA 3BRKX 2WEEA 4FRQA 1S4PA 4J18A 1NKHB 4EE5A 3RMVA 4D0TA 1JV3A 2ICYA 3DJ4A 4KRVA 3V0MA 5FU8A 1R7VA 4HG6A 1ZDFA 2VFZA 1YROB 4EE4A 2XMHA 1NQIB 2QKXA 1FR8A 1HJLA 2I5EA 3QVBA 2JCOA 4NANA 1NWGB 3KIAA 1WT2A 3ST8A 4B2WA 3ZF8A 4KNXA 4L41C 5CQLX 5C4BA 1VPAA 4Y62A 2O1GA 3K8EA 4Y7TA 5CMHA 2X60A 1QGSA 1VZUA 2Y6PA 1H7EA 3DK5A 2AM4A 1H4CA 3LW6A 3D8VA 4ZDQA 5C48A 4HO9A 2VSHA 1NHEB 4CJBA 2YQJA 4FRLA 5CQOA 3IOJA 4IRPA 1H5SD 4FCEA 3I0IX 2V0HA 3DUVA 1QGQA 2XWNA 4D0ZA 1R7XA 4DDZA 2VD4A 1FXJA 1K4VA 1O7QA 2Y4KA 1OMXA 3SXGA 2BO8A 3OKRA 1H7GA 3OH3A 1ZJ3A 1ZJ1A 2CU2A 4B2XA 1H4EA 2FFUA 1WT1A 5C4FA 1EYRA 2WAWA 4FRDA 4M2AA 2DPWA 5C4EA 2XWMA 1IIMA 2FYDB 1TZFA 4XWIA 1V82A 4D48A 4Y6NA 1JVGA 5DDVA 4B4GA 4JD0A 2O1FA 2BO6A 2P6WA 1H7LA 4GBPA 4IRQA 4E1KA 3Q7UA 4YS8A 1VICA 1GX4A 3V0PA 3POLA 1MP5A 1H7QA 5C1HA 5C4DA 2PA4A 1H7FA 3HL3A 4B5BA 1GWVA 3V90A 3I0DA 1G8OA 4KT7A 1FG5N 2FYBA 3OH1A 2XWLA 1H7HA 4G3QA 3D5NA 3ZGFA 2YQCA 2UX8A 4DECA 3IOHA 4HO6A 3OAMA 2E8BA 2X65A 4LW6A 4D11A 3SX5A 2AM5A 1INIA 3SXCA 1O23B 1Z90A 2JCLA 4BQHA 1VZXA 1HM9A 2RIZA 1S4NA 2RJ7A 1PZYB 2Z87A 2GGOA 3SX8A 1JV1A 3CKOA 2X5SA 2E3DA 2A8UA 2V0JA 2VS5A 1GA8A 3O3PA 2MZBA 2YESA 3U2TA 3OH2A 4HO2A 1LL3A 3I0EA 1ZI4A 4FRBA 1GQ9A 1VZTA 4FRHA 2AECA 5C38A 3E25A 4B4BA 3CU0A 2D0JA 2Q4JA 3OH0A 5C8RA 1OQMB 5CQPA 3V0OA 4AC3A 2D7IA 1FR9A 4CVHA 2FFVA 1HM0A 1G1LA 4ASJA 3V8YA 4D11C 2PGVA 4HO3A 1HM8A 1TVYA 4EEMA 3D98A 4Y7VA 3V0QA 4DE7A 2RJ6A 4ASYA 2AH9A 1FOAA 5I1FA 4M4KA 3R2WA 3T7MA 5IDSA 1LZ0A 2OEFA 1FXOA 5C1GA 1JYKA 1VGWA 4Y7GA 1G93A 4HOCA 3E26A 4K6RA 2VXMA 1ZJOA 3FWWA 2AESA 5JQQA 4AAWA 1LL0A 4HO4A 2OI6A 1ZJ0A 2RITA 2RIXA 1ZI3A 2VS4A 4UEGA 1ZJ2A 2ZU8A 2AE7A 3TZTA 2P73A 5CMFX 2Y7AA 1ZI5A 4MYBA 4EEOA 5AJPA 1NMMB 1G3LA 3JTJA 4M2BA 5CMJA 2BO4A 4B4MA 4FREA 1VGUA 1R7YA 5C36A 4R7PA 3BCVA 1FO8A 1TW5A 3CKVA 4KPXA 4AYJA 2JCJA 3CGXA 2YQHA 2APCA 1VM8A 3PKPA 2Y4MA 2XMEA 2ICXA 2YC5A 3U2XA 4EVWA 1FWYA 4P00A 3SXEA 3SXAA 3ZLLA 1VH3A 1FZWA 1R81A 3TQDA 1ON8A 5CQMX 3I0LA 3Q4SA 1W57A 2RJ9A 1V83A 3EE5A 1MC3A 4FQWA 4G87A 5C3DA 1PZTA 3OC9A 4KPZA 1G97A 2YCMA 4P02A 1MP3A 3JUKA 1OMZA 1V84A 1LL2A 4EEAA 5FUHA 5FV9A 2GGQA 1R80A 1GQCA 1QWJA 2WE9A 4Y6UA 3OH4A 3F1YA 3I0HA 1ZDGA 5CMGX 1H5RA 4AYLA 1GX0A 4NAIA 3FOQA 3V0NA 2ZU7A 1O0RA 5HS2A 4B3UA 5L6VA 2V0IA 4B42A 5BXCA 1HV9A 5CMIA 3K8DA 2NXVA 1LZJA 3I0GA 2QH5A 4LW3A 4FCUA 1H5TA 3I0KA 2RJ5A 3USRA 1WVCA 4MNDA 3I0JA 1H5SA 2FYCB 5DDTA 2FY7A 3SX3A 2Y4JA 1IINA 3V91A 4Y7UA 1ZCTA 5C3BA 1H3MA 3F1CA 4KQLA 4Y9XA 1W55A 3SXDA 3NGWA 3I0FA 2A8WA 2RIYA 5AJOA 5J49A 1HJJA 4HCQA 2VSIA 2WVLA 2RJ8A 1I52A 3USQA 1S4OA 4KNRA 3V8ZA 1ZCYA 4KC2A 4FROA 1FRWA 2ZU9A 1LZIA 1SS9A 2Y4LA 3Q80A 2YC3A 5EIYA 4HO0A 4Y7FA 5FYEA 2PX7A 5IDTA 1H5RB 2I5KA 3PNNA 1ON6A 5L6SA 1TW1A 4KC4A 3RSBA 4BMAA 3U0YA 3R3IA 1R7UA 2O1HA 4C2SA 3PKQA 5FTSA 4HO8A 3U2WA 4KXOA 1H5SC 1YP2A 3ZGGA 2V0LA 5EJ1A 5C1LA 5C4CA 1H5TB 2X5ZA 1YP3A 4HO5A 4Y63A 1ZCVA 2Z86A 1KWSA 2OI7A 5FTVA 1XZ6A 1G0RA 1H5SB 2WVKA 4KC1A 1YP4A 1LZ7A 1JYLA 2OEGA 3SX7A 2RJ1A 2W0WA 3SXBA 1FGXA 2RJ0A 3U2VA 4EEGA 3JUJA 3T7OA 4ECMA 2AGDA 4CJCA 1WT3A 1LVWA 2WVMA 4M28A 3CKJA 1ZCUA 1XHBA 1E5KA 1GWWA 3I0CA 4FRMA 1WT0A 1O7OA 1R82A 2VS3A 1G9RA 2V0KA 1VGTA 5C3AA 1G95A 4JISA 1QG8A 2YQSA 2I7BA 3U0XA 3V0LA 4CJ8A 2QGIA 1G2VA 2W0VA 5C49A 1NF5B 4FRPA 3OGZA
chains in the Genus database with same CATH superfamily
5CQNX 4Y64A 3RMWA 4FRAA 3IOIA 1H4DA 1MP4A 1ZIZA 1G23A 1WSZA 2JCKA 3ZLKA 2AM3A 5C47A 1JVDA 5IFYA 2OI5A 1FGGA 2WGZA 1FO9A 1ZJPA 3T7NA 2FYAA 5FU0A 4NALA 4G3PA 5AJNA 5EJZA 2VXLA 1ZHJA 3GUEA 1ZI1A 3N9WA 2P72A 1H7TA 3SPTA 1R7TA 4EE3A 1INJA 3CKQA 2RJ4A 2D7RA 1VGZA 2BO7A 3CKNA 1W77A 4NAKA 4G3SA 1VH1A 1EZIA 4ARWA 3U2UA 2PGYA 3BRKX 2WEEA 4FRQA 1S4PA 4J18A 1NKHB 4EE5A 3RMVA 4D0TA 1JV3A 2ICYA 3DJ4A 4KRVA 3V0MA 5FU8A 1R7VA 4HG6A 1ZDFA 2VFZA 1YROB 4EE4A 2XMHA 1NQIB 2QKXA 1FR8A 1HJLA 2I5EA 3QVBA 2JCOA 4NANA 1NWGB 3KIAA 1WT2A 3ST8A 4B2WA 3ZF8A 4KNXA 4L41C 5CQLX 5C4BA 1VPAA 4Y62A 2O1GA 3K8EA 4Y7TA 5CMHA 2X60A 1QGSA 1VZUA 2Y6PA 1H7EA 3DK5A 2AM4A 1H4CA 3LW6A 3D8VA 4ZDQA 5C48A 4HO9A 2VSHA 1NHEB 4CJBA 2YQJA 4FRLA 5CQOA 3IOJA 4IRPA 1H5SD 4FCEA 3I0IX 2V0HA 3DUVA 1QGQA 2XWNA 4D0ZA 1R7XA 4DDZA 2VD4A 1FXJA 2J0AA 1K4VA 1O7QA 2Y4KA 1OMXA 3SXGA 2BO8A 3OKRA 1H7GA 3OH3A 1ZJ3A 1ZJ1A 2CU2A 4B2XA 1H4EA 2FFUA 1WT1A 5C4FA 1EYRA 2WAWA 4FRDA 4M2AA 2DPWA 5C4EA 2XWMA 1IIMA 2FYDB 1TZFA 4XWIA 1V82A 4D48A 4Y6NA 1JVGA 5DDVA 4B4GA 4JD0A 2O1FA 2BO6A 2P6WA 1H7LA 4GBPA 4IRQA 4E1KA 3Q7UA 4YS8A 1VICA 1GX4A 3V0PA 3POLA 1MP5A 1H7QA 5C1HA 5C4DA 2PA4A 1H7FA 3HL3A 4B5BA 1GWVA 4Q7CA 3V90A 3I0DA 1G8OA 4KT7A 1FG5N 2FYBA 3OH1A 2XWLA 1H7HA 4G3QA 3D5NA 3ZGFA 2YQCA 2UX8A 4DECA 3IOHA 4HO6A 3OAMA 2E8BA 2X65A 4LW6A 4D11A 3SX5A 2AM5A 1INIA 3SXCA 1O23B 1Z90A 2JCLA 4BQHA 1VZXA 1HM9A 2RIZA 1S4NA 2RJ7A 1PZYB 2Z87A 2GGOA 3SX8A 1JV1A 3CKOA 2X5SA 2E3DA 2A8UA 2V0JA 2VS5A 1GA8A 3O3PA 2MZBA 2YESA 3U2TA 3OH2A 4HO2A 1LL3A 3I0EA 1ZI4A 4FRBA 1GQ9A 1VZTA 4FRHA 2AECA 5C38A 3E25A 4B4BA 3CU0A 2D0JA 2Q4JA 3OH0A 5C8RA 1OQMB 5CQPA 3V0OA 5D91A 4AC3A 2D7IA 1FR9A 4CVHA 2FFVA 1HM0A 1G1LA 4ASJA 3V8YA 4D11C 2J0BA 2PGVA 4HO3A 1HM8A 1TVYA 4EEMA 3D98A 4Y7VA 3V0QA 4DE7A 2RJ6A 4ASYA 2AH9A 1FOAA 4FIYA 5I1FA 4M4KA 3R2WA 3T7MA 5IDSA 1LZ0A 2OEFA 1FXOA 5C1GA 1JYKA 1VGWA 4Y7GA 1G93A 4HOCA 3E26A 4K6RA 2VXMA 1ZJOA 3FWWA 2AESA 5JQQA 4AAWA 1LL0A 4HO4A 2OI6A 1ZJ0A 4O6NA 2RITA 2RIXA 1ZI3A 2VS4A 4UEGA 1ZJ2A 2ZU8A 2AE7A 3TZTA 2P73A 5CMFX 2Y7AA 1ZI5A 4MYBA 4EEOA 5AJPA 1NMMB 1G3LA 3JTJA 4M2BA 5CMJA 2BO4A 4B4MA 4FREA 1VGUA 1R7YA 5C36A 4R7PA 3BCVA 1FO8A 1TW5A 3CKVA 4KPXA 4AYJA 2JCJA 3CGXA 2YQHA 2APCA 1VM8A 3PKPA 2Y4MA 2XMEA 2ICXA 2YC5A 3U2XA 4EVWA 1FWYA 4P00A 3SXEA 3SXAA 3ZLLA 1VH3A 1FZWA 1R81A 3TQDA 1ON8A 5CQMX 3I0LA 3Q4SA 1W57A 2RJ9A 1V83A 3EE5A 1MC3A 4FQWA 4G87A 5C3DA 1PZTA 3OC9A 4KPZA 1G97A 2YCMA 4P02A 1MP3A 3JUKA 2C0NA 1OMZA 1V84A 1LL2A 4EEAA 5FUHA 5FV9A 2GGQA 1R80A 1GQCA 1QWJA 2WE9A 4Y6UA 3OH4A 3F1YA 3I0HA 1ZDGA 5CMGX 1H5RA 4AYLA 1GX0A 4NAIA 3FOQA 3V0NA 2ZU7A 1O0RA 5HS2A 4B3UA 5L6VA 2V0IA 4B42A 5BXCA 1HV9A 5CMIA 3K8DA 2NXVA 1LZJA 3I0GA 2QH5A 4LW3A 4FCUA 1H5TA 3I0KA 2RJ5A 3USRA 1WVCA 2VK9A 4MNDA 3I0JA 1H5SA 2FYCB 5DDTA 2FY7A 3SX3A 2Y4JA 1IINA 3V91A 4Y7UA 1ZCTA 5C3BA 1H3MA 3F1CA 4KQLA 4Y9XA 1W55A 3SXDA 3NGWA 3I0FA 2A8WA 2RIYA 5AJOA 5J49A 1HJJA 4HCQA 5D92A 2VSIA 2WVLA 2RJ8A 4FIXA 1I52A 3USQA 1S4OA 4KNRA 3V8ZA 1ZCYA 4KC2A 4FROA 1FRWA 2ZU9A 1LZIA 1SS9A 2Y4LA 3Q80A 2YC3A 5EIYA 4HO0A 4Y7FA 5FYEA 2PX7A 5IDTA 1H5RB 2I5KA 3PNNA 1ON6A 5L6SA 1TW1A 4KC4A 3RSBA 4BMAA 3U0YA 3R3IA 1R7UA 2O1HA 4C2SA 3PKQA 5FTSA 4O6MA 4HO8A 3U2WA 4KXOA 1H5SC 1YP2A 3ZGGA 2V0LA 5EJ1A 5C1LA 5C4CA 1H5TB 2X5ZA 1YP3A 4HO5A 4Y63A 1ZCVA 2Z86A 1KWSA 2OI7A 5FTVA 1XZ6A 1G0RA 1H5SB 2WVKA 4KC1A 1YP4A 1LZ7A 1JYLA 2OEGA 3SX7A 2RJ1A 2W0WA 3SXBA 1FGXA 2RJ0A 3U2VA 4EEGA 3JUJA 3T7OA 4ECMA 2AGDA 4MIXA 1WT3A 4CJCA 1LVWA 2WVMA 4M28A 3CKJA 1ZCUA 1XHBA 1E5KA 1GWWA 3I0CA 4FRMA 1WT0A 1O7OA 1R82A 2VS3A 1G9RA 2V0KA 1VGTA 5C3AA 1G95A 4JISA 1QG8A 2YQSA 2I7BA 3U0XA 3V0LA 4CJ8A 2QGIA 1G2VA 2W0VA 5C49A 1NF5B 4FRPA 3OGZA
chains in the Genus database with same CATH topology
5CQNX 4Y64A 3RMWA 4FRAA 3IOIA 1H4DA 1MP4A 1ZIZA 1G23A 1WSZA 2JCKA 3ZLKA 2AM3A 5C47A 1JVDA 5IFYA 2OI5A 1FGGA 2WGZA 1FO9A 1ZJPA 3T7NA 2FYAA 5FU0A 4NALA 4G3PA 5AJNA 5EJZA 2VXLA 1ZHJA 3GUEA 1ZI1A 3N9WA 2P72A 1H7TA 3SPTA 1R7TA 4EE3A 1INJA 3CKQA 2RJ4A 2D7RA 1VGZA 2BO7A 3CKNA 1W77A 4NAKA 4G3SA 1VH1A 1EZIA 4ARWA 3U2UA 2PGYA 3BRKX 2WEEA 4FRQA 1S4PA 4J18A 1NKHB 4EE5A 3RMVA 4D0TA 1JV3A 2ICYA 3DJ4A 4KRVA 3V0MA 5FU8A 1R7VA 4HG6A 1ZDFA 2VFZA 1YROB 4EE4A 2XMHA 1NQIB 2QKXA 1FR8A 1HJLA 2I5EA 3QVBA 2JCOA 4NANA 1NWGB 3KIAA 1WT2A 3ST8A 4B2WA 3ZF8A 4KNXA 4L41C 5CQLX 5C4BA 1VPAA 4Y62A 2O1GA 3K8EA 4Y7TA 5CMHA 2X60A 1QGSA 1VZUA 2Y6PA 1H7EA 3DK5A 2AM4A 1H4CA 3LW6A 3D8VA 4ZDQA 5C48A 4HO9A 2VSHA 1NHEB 4CJBA 2YQJA 4FRLA 5CQOA 3IOJA 4IRPA 1H5SD 4FCEA 3I0IX 2V0HA 3DUVA 1QGQA 2XWNA 4D0ZA 1R7XA 4DDZA 2VD4A 1FXJA 2J0AA 1K4VA 1O7QA 2Y4KA 1OMXA 3SXGA 2BO8A 3OKRA 1H7GA 3OH3A 1ZJ3A 1ZJ1A 2CU2A 4B2XA 1H4EA 2FFUA 1WT1A 5C4FA 1EYRA 2WAWA 4FRDA 4M2AA 2DPWA 5C4EA 2XWMA 1IIMA 2FYDB 1TZFA 4XWIA 1V82A 4D48A 4Y6NA 1JVGA 5DDVA 4B4GA 4JD0A 2O1FA 2BO6A 2P6WA 1H7LA 4GBPA 4IRQA 4E1KA 3Q7UA 4YS8A 1VICA 1GX4A 3V0PA 3POLA 1MP5A 1H7QA 5C1HA 5C4DA 2PA4A 1H7FA 3HL3A 4B5BA 1GWVA 4Q7CA 3V90A 3I0DA 1G8OA 4KT7A 1FG5N 2FYBA 3OH1A 2XWLA 1H7HA 4G3QA 3D5NA 3ZGFA 2YQCA 2UX8A 4DECA 3IOHA 4HO6A 3OAMA 2E8BA 2X65A 4LW6A 4D11A 3SX5A 2AM5A 1INIA 3SXCA 1O23B 1Z90A 2JCLA 4BQHA 1VZXA 1HM9A 2RIZA 1S4NA 2RJ7A 1PZYB 2Z87A 2GGOA 3SX8A 1JV1A 3CKOA 2X5SA 2E3DA 2A8UA 2V0JA 2VS5A 1GA8A 3O3PA 2MZBA 2YESA 3U2TA 3OH2A 4HO2A 1LL3A 3I0EA 1ZI4A 4FRBA 1GQ9A 1VZTA 4FRHA 2AECA 5C38A 3E25A 4B4BA 3CU0A 2D0JA 2Q4JA 3OH0A 5C8RA 1OQMB 5CQPA 3V0OA 5D91A 4AC3A 2D7IA 1FR9A 4CVHA 2FFVA 1HM0A 1G1LA 4ASJA 3V8YA 4D11C 2J0BA 2PGVA 4HO3A 1HM8A 1TVYA 4EEMA 3D98A 4Y7VA 3V0QA 4DE7A 2RJ6A 4ASYA 2AH9A 1FOAA 4FIYA 5I1FA 4M4KA 3R2WA 3T7MA 5IDSA 1LZ0A 2OEFA 1FXOA 5C1GA 1JYKA 1VGWA 4Y7GA 1G93A 4HOCA 3E26A 4K6RA 2VXMA 1ZJOA 3FWWA 2AESA 5JQQA 4AAWA 1LL0A 4HO4A 2OI6A 1ZJ0A 4O6NA 2RITA 2RIXA 1ZI3A 2VS4A 4UEGA 1ZJ2A 2ZU8A 2AE7A 3TZTA 2P73A 5CMFX 2Y7AA 1ZI5A 4MYBA 4EEOA 5AJPA 1NMMB 1G3LA 3JTJA 4M2BA 5CMJA 2BO4A 4B4MA 4FREA 1VGUA 1R7YA 5C36A 4R7PA 3BCVA 1FO8A 1TW5A 3CKVA 4KPXA 4AYJA 2JCJA 3CGXA 2YQHA 2APCA 1VM8A 3PKPA 2Y4MA 2XMEA 2ICXA 2YC5A 3U2XA 4EVWA 1FWYA 4P00A 3SXEA 3SXAA 3ZLLA 1VH3A 1FZWA 1R81A 3TQDA 1ON8A 5CQMX 3I0LA 3Q4SA 1W57A 2RJ9A 1V83A 3EE5A 1MC3A 4FQWA 4G87A 5C3DA 1PZTA 3OC9A 4KPZA 1G97A 2YCMA 4P02A 1MP3A 3JUKA 2C0NA 1OMZA 1V84A 1LL2A 4EEAA 5FUHA 5FV9A 2GGQA 1R80A 1GQCA 1QWJA 2WE9A 4Y6UA 3OH4A 3F1YA 3I0HA 1ZDGA 5CMGX 1H5RA 4AYLA 1GX0A 4NAIA 3FOQA 3V0NA 2ZU7A 1O0RA 5HS2A 4B3UA 5L6VA 2V0IA 4B42A 5BXCA 1HV9A 5CMIA 3K8DA 2NXVA 1LZJA 3I0GA 2QH5A 4LW3A 4FCUA 1H5TA 3I0KA 2RJ5A 3USRA 1WVCA 2VK9A 4MNDA 3I0JA 1H5SA 2FYCB 5DDTA 2FY7A 3SX3A 2Y4JA 1IINA 3V91A 4Y7UA 1ZCTA 5C3BA 1H3MA 3F1CA 4KQLA 4Y9XA 1W55A 3SXDA 3NGWA 3I0FA 2A8WA 2RIYA 5AJOA 5J49A 1HJJA 4HCQA 5D92A 2VSIA 2WVLA 2RJ8A 4FIXA 1I52A 3USQA 1S4OA 4KNRA 3V8ZA 1ZCYA 4KC2A 4FROA 1FRWA 2ZU9A 1LZIA 1SS9A 2Y4LA 3Q80A 2YC3A 5EIYA 4HO0A 4Y7FA 5FYEA 2PX7A 5IDTA 1H5RB 2I5KA 3PNNA 1ON6A 5L6SA 1TW1A 4KC4A 3RSBA 4BMAA 3U0YA 3R3IA 1R7UA 2O1HA 4C2SA 3PKQA 5FTSA 4O6MA 4HO8A 3U2WA 4KXOA 1H5SC 1YP2A 3ZGGA 2V0LA 5EJ1A 5C1LA 5C4CA 1H5TB 2X5ZA 1YP3A 4HO5A 4Y63A 1ZCVA 2Z86A 1KWSA 2OI7A 5FTVA 1XZ6A 1G0RA 1H5SB 2WVKA 4KC1A 1YP4A 1LZ7A 1JYLA 2OEGA 3SX7A 2RJ1A 2W0WA 3SXBA 1FGXA 2RJ0A 3U2VA 4EEGA 3JUJA 3T7OA 4ECMA 2AGDA 4MIXA 1WT3A 4CJCA 1LVWA 2WVMA 4M28A 3CKJA 1ZCUA 1XHBA 1E5KA 1GWWA 3I0CA 4FRMA 1WT0A 1O7OA 1R82A 2VS3A 1G9RA 2V0KA 1VGTA 5C3AA 1G95A 4JISA 1QG8A 2YQSA 2I7BA 3U0XA 3V0LA 4CJ8A 2QGIA 1G2VA 2W0VA 5C49A 1NF5B 4FRPA 3OGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQN X;  4Y64 A;  3RMW A;  4FRA A;  3IOI A;  1H4D A;  1MP4 A;  1ZIZ A;  1G23 A;  1WSZ A;  2JCK A;  3ZLK A;  2AM3 A;  5C47 A;  1JVD A;  5IFY A;  2OI5 A;  1FGG A;  2WGZ A;  1FO9 A;  1ZJP A;  3T7N A;  2FYA A;  5FU0 A;  4NAL A;  4G3P A;  5AJN A;  5EJZ A;  2VXL A;  1ZHJ A;  3GUE A;  1ZI1 A;  3N9W A;  2P72 A;  1H7T A;  3SPT A;  1R7T A;  4EE3 A;  1INJ A;  3CKQ A;  2RJ4 A;  2D7R A;  1VGZ A;  2BO7 A;  3CKN A;  1W77 A;  4NAK A;  4G3S A;  1VH1 A;  1EZI A;  4ARW A;  3U2U A;  2PGY A;  3BRK X;  2WEE A;  4FRQ A;  1S4P A;  4J18 A;  1NKH B;  4EE5 A;  3RMV A;  4D0T A;  1JV3 A;  2ICY A;  3DJ4 A;  4KRV A;  3V0M A;  5FU8 A;  1R7V A;  4HG6 A;  1ZDF A;  2VFZ A;  1YRO B;  4EE4 A;  2XMH A;  1NQI B;  2QKX A;  1FR8 A;  1HJL A;  2I5E A;  3QVB A;  2JCO A;  4NAN A;  1NWG B;  3KIA A;  1WT2 A;  3ST8 A;  4B2W A;  3ZF8 A;  4KNX A;  4L41 C;  5CQL X;  5C4B A;  1VPA A;  4Y62 A;  2O1G A;  3K8E A;  4Y7T A;  5CMH A;  2X60 A;  1QGS A;  1VZU A;  2Y6P A;  1H7E A;  3DK5 A;  2AM4 A;  1H4C A;  3LW6 A;  3D8V A;  4ZDQ A;  5C48 A;  4HO9 A;  2VSH A;  1NHE B;  4CJB A;  2YQJ A;  4FRL A;  5CQO A;  3IOJ A;  4IRP A;  1H5S D;  4FCE A;  3I0I X;  2V0H A;  3DUV A;  1QGQ A;  2XWN A;  4D0Z A;  1R7X A;  4DDZ A;  2VD4 A;  1FXJ A;  1K4V A;  1O7Q A;  2Y4K A;  1OMX A;  3SXG A;  2BO8 A;  3OKR A;  1H7G A;  3OH3 A;  1ZJ3 A;  1ZJ1 A;  2CU2 A;  4B2X A;  1H4E A;  2FFU A;  1WT1 A;  5C4F A;  1EYR A;  2WAW A;  4FRD A;  4M2A A;  2DPW A;  5C4E A;  2XWM A;  1IIM A;  2FYD B;  1TZF A;  4XWI A;  1V82 A;  4D48 A;  4Y6N A;  1JVG A;  5DDV A;  4B4G A;  4JD0 A;  2O1F A;  2BO6 A;  2P6W A;  1H7L A;  4GBP A;  4IRQ A;  4E1K A;  3Q7U A;  4YS8 A;  1VIC A;  1GX4 A;  3V0P A;  3POL A;  1MP5 A;  1H7Q A;  5C1H A;  5C4D A;  2PA4 A;  1H7F A;  3HL3 A;  4B5B A;  1GWV A;  3V90 A;  3I0D A;  1G8O A;  4KT7 A;  1FG5 N;  2FYB A;  3OH1 A;  2XWL A;  1H7H A;  4G3Q A;  3D5N A;  3ZGF A;  2YQC A;  2UX8 A;  4DEC A;  3IOH A;  4HO6 A;  3OAM A;  2E8B A;  2X65 A;  4LW6 A;  4D11 A;  3SX5 A;  2AM5 A;  1INI A;  3SXC A;  1O23 B;  1Z90 A;  2JCL A;  4BQH A;  1VZX A;  1HM9 A;  2RIZ A;  1S4N A;  2RJ7 A;  1PZY B;  2Z87 A;  2GGO A;  3SX8 A;  1JV1 A;  3CKO A;  2X5S A;  2E3D A;  2A8U A;  2V0J A;  2VS5 A;  1GA8 A;  3O3P A;  2MZB A;  2YES A;  3U2T A;  3OH2 A;  4HO2 A;  1LL3 A;  3I0E A;  1ZI4 A;  4FRB A;  1GQ9 A;  1VZT A;  4FRH A;  2AEC A;  5C38 A;  3E25 A;  4B4B A;  3CU0 A;  2D0J A;  2Q4J A;  3OH0 A;  5C8R A;  1OQM B;  5CQP A;  3V0O A;  4AC3 A;  2D7I A;  1FR9 A;  4CVH A;  2FFV A;  1HM0 A;  1G1L A;  4ASJ A;  3V8Y A;  4D11 C;  2PGV A;  4HO3 A;  1HM8 A;  1TVY A;  4EEM A;  3D98 A;  4Y7V A;  3V0Q A;  4DE7 A;  2RJ6 A;  4ASY A;  2AH9 A;  1FOA A;  5I1F A;  4M4K A;  3R2W A;  3T7M A;  5IDS A;  1LZ0 A;  2OEF A;  1FXO A;  5C1G A;  1JYK A;  1VGW A;  4Y7G A;  1G93 A;  4HOC A;  3E26 A;  4K6R A;  2VXM A;  1ZJO A;  3FWW A;  2AES A;  5JQQ A;  4AAW A;  1LL0 A;  4HO4 A;  2OI6 A;  1ZJ0 A;  2RIT A;  2RIX A;  1ZI3 A;  2VS4 A;  4UEG A;  1ZJ2 A;  2ZU8 A;  2AE7 A;  3TZT A;  2P73 A;  5CMF X;  2Y7A A;  1ZI5 A;  4MYB A;  4EEO A;  5AJP A;  1NMM B;  1G3L A;  3JTJ A;  4M2B A;  5CMJ A;  2BO4 A;  4B4M A;  4FRE A;  1VGU A;  1R7Y A;  5C36 A;  4R7P A;  3BCV A;  1FO8 A;  1TW5 A;  3CKV A;  4KPX A;  4AYJ A;  2JCJ A;  3CGX A;  2YQH A;  2APC A;  1VM8 A;  3PKP A;  2Y4M A;  2XME A;  2ICX A;  2YC5 A;  3U2X A;  4EVW A;  1FWY A;  4P00 A;  3SXE A;  3SXA A;  3ZLL A;  1VH3 A;  1FZW A;  1R81 A;  3TQD A;  1ON8 A;  5CQM X;  3I0L A;  3Q4S A;  1W57 A;  2RJ9 A;  1V83 A;  3EE5 A;  1MC3 A;  4FQW A;  4G87 A;  5C3D A;  1PZT A;  3OC9 A;  4KPZ A;  1G97 A;  2YCM A;  4P02 A;  1MP3 A;  3JUK A;  1OMZ A;  1V84 A;  1LL2 A;  4EEA A;  5FUH A;  5FV9 A;  2GGQ A;  1R80 A;  1GQC A;  1QWJ A;  2WE9 A;  4Y6U A;  3OH4 A;  3F1Y A;  3I0H A;  1ZDG A;  5CMG X;  1H5R A;  4AYL A;  1GX0 A;  4NAI A;  3FOQ A;  3V0N A;  2ZU7 A;  1O0R A;  5HS2 A;  4B3U A;  5L6V A;  2V0I A;  4B42 A;  5BXC A;  1HV9 A;  5CMI A;  3K8D A;  2NXV A;  1LZJ A;  3I0G A;  2QH5 A;  4LW3 A;  4FCU A;  1H5T A;  3I0K A;  2RJ5 A;  3USR A;  1WVC A;  4MND A;  3I0J A;  1H5S A;  2FYC B;  5DDT A;  2FY7 A;  3SX3 A;  2Y4J A;  1IIN A;  3V91 A;  4Y7U A;  1ZCT A;  5C3B A;  1H3M A;  3F1C A;  4KQL A;  4Y9X A;  1W55 A;  3SXD A;  3NGW A;  3I0F A;  2A8W A;  2RIY A;  5AJO A;  5J49 A;  1HJJ A;  4HCQ A;  2VSI A;  2WVL A;  2RJ8 A;  1I52 A;  3USQ A;  1S4O A;  4KNR A;  3V8Z A;  1ZCY A;  4KC2 A;  4FRO A;  1FRW A;  2ZU9 A;  1LZI A;  1SS9 A;  2Y4L A;  3Q80 A;  2YC3 A;  5EIY A;  4HO0 A;  4Y7F A;  5FYE A;  2PX7 A;  5IDT A;  1H5R B;  2I5K A;  3PNN A;  1ON6 A;  5L6S A;  1TW1 A;  4KC4 A;  3RSB A;  4BMA A;  3U0Y A;  3R3I A;  1R7U A;  2O1H A;  4C2S A;  3PKQ A;  5FTS A;  4HO8 A;  3U2W A;  4KXO A;  1H5S C;  1YP2 A;  3ZGG A;  2V0L A;  5EJ1 A;  5C1L A;  5C4C A;  1H5T B;  2X5Z A;  1YP3 A;  4HO5 A;  4Y63 A;  1ZCV A;  2Z86 A;  1KWS A;  2OI7 A;  5FTV A;  1XZ6 A;  1G0R A;  1H5S B;  2WVK A;  4KC1 A;  1YP4 A;  1LZ7 A;  1JYL A;  2OEG A;  3SX7 A;  2RJ1 A;  2W0W A;  3SXB A;  1FGX A;  2RJ0 A;  3U2V A;  4EEG A;  3JUJ A;  3T7O A;  4ECM A;  2AGD A;  4CJC A;  1WT3 A;  1LVW A;  2WVM A;  4M28 A;  3CKJ A;  1ZCU A;  1XHB A;  1E5K A;  1GWW A;  3I0C A;  4FRM A;  1WT0 A;  1O7O A;  1R82 A;  2VS3 A;  1G9R A;  2V0K A;  1VGT A;  5C3A A;  1G95 A;  4JIS A;  1QG8 A;  2YQS A;  2I7B A;  3U0X A;  3V0L A;  4CJ8 A;  2QGI A;  1G2V A;  2W0V A;  5C49 A;  1NF5 B;  4FRP A;  3OGZ A; 
#chains in the Genus database with same CATH topology
 5CQN X;  4Y64 A;  3RMW A;  4FRA A;  3IOI A;  1H4D A;  1MP4 A;  1ZIZ A;  1G23 A;  1WSZ A;  2JCK A;  3ZLK A;  2AM3 A;  5C47 A;  1JVD A;  5IFY A;  2OI5 A;  1FGG A;  2WGZ A;  1FO9 A;  1ZJP A;  3T7N A;  2FYA A;  5FU0 A;  4NAL A;  4G3P A;  5AJN A;  5EJZ A;  2VXL A;  1ZHJ A;  3GUE A;  1ZI1 A;  3N9W A;  2P72 A;  1H7T A;  3SPT A;  1R7T A;  4EE3 A;  1INJ A;  3CKQ A;  2RJ4 A;  2D7R A;  1VGZ A;  2BO7 A;  3CKN A;  1W77 A;  4NAK A;  4G3S A;  1VH1 A;  1EZI A;  4ARW A;  3U2U A;  2PGY A;  3BRK X;  2WEE A;  4FRQ A;  1S4P A;  4J18 A;  1NKH B;  4EE5 A;  3RMV A;  4D0T A;  1JV3 A;  2ICY A;  3DJ4 A;  4KRV A;  3V0M A;  5FU8 A;  1R7V A;  4HG6 A;  1ZDF A;  2VFZ A;  1YRO B;  4EE4 A;  2XMH A;  1NQI B;  2QKX A;  1FR8 A;  1HJL A;  2I5E A;  3QVB A;  2JCO A;  4NAN A;  1NWG B;  3KIA A;  1WT2 A;  3ST8 A;  4B2W A;  3ZF8 A;  4KNX A;  4L41 C;  5CQL X;  5C4B A;  1VPA A;  4Y62 A;  2O1G A;  3K8E A;  4Y7T A;  5CMH A;  2X60 A;  1QGS A;  1VZU A;  2Y6P A;  1H7E A;  3DK5 A;  2AM4 A;  1H4C A;  3LW6 A;  3D8V A;  4ZDQ A;  5C48 A;  4HO9 A;  2VSH A;  1NHE B;  4CJB A;  2YQJ A;  4FRL A;  5CQO A;  3IOJ A;  4IRP A;  1H5S D;  4FCE A;  3I0I X;  2V0H A;  3DUV A;  1QGQ A;  2XWN A;  4D0Z A;  1R7X A;  4DDZ A;  2VD4 A;  1FXJ A;  2J0A A;  1K4V A;  1O7Q A;  2Y4K A;  1OMX A;  3SXG A;  2BO8 A;  3OKR A;  1H7G A;  3OH3 A;  1ZJ3 A;  1ZJ1 A;  2CU2 A;  4B2X A;  1H4E A;  2FFU A;  1WT1 A;  5C4F A;  1EYR A;  2WAW A;  4FRD A;  4M2A A;  2DPW A;  5C4E A;  2XWM A;  1IIM A;  2FYD B;  1TZF A;  4XWI A;  1V82 A;  4D48 A;  4Y6N A;  1JVG A;  5DDV A;  4B4G A;  4JD0 A;  2O1F A;  2BO6 A;  2P6W A;  1H7L A;  4GBP A;  4IRQ A;  4E1K A;  3Q7U A;  4YS8 A;  1VIC A;  1GX4 A;  3V0P A;  3POL A;  1MP5 A;  1H7Q A;  5C1H A;  5C4D A;  2PA4 A;  1H7F A;  3HL3 A;  4B5B A;  1GWV A;  4Q7C A;  3V90 A;  3I0D A;  1G8O A;  4KT7 A;  1FG5 N;  2FYB A;  3OH1 A;  2XWL A;  1H7H A;  4G3Q A;  3D5N A;  3ZGF A;  2YQC A;  2UX8 A;  4DEC A;  3IOH A;  4HO6 A;  3OAM A;  2E8B A;  2X65 A;  4LW6 A;  4D11 A;  3SX5 A;  2AM5 A;  1INI A;  3SXC A;  1O23 B;  1Z90 A;  2JCL A;  4BQH A;  1VZX A;  1HM9 A;  2RIZ A;  1S4N A;  2RJ7 A;  1PZY B;  2Z87 A;  2GGO A;  3SX8 A;  1JV1 A;  3CKO A;  2X5S A;  2E3D A;  2A8U A;  2V0J A;  2VS5 A;  1GA8 A;  3O3P A;  2MZB A;  2YES A;  3U2T A;  3OH2 A;  4HO2 A;  1LL3 A;  3I0E A;  1ZI4 A;  4FRB A;  1GQ9 A;  1VZT A;  4FRH A;  2AEC A;  5C38 A;  3E25 A;  4B4B A;  3CU0 A;  2D0J A;  2Q4J A;  3OH0 A;  5C8R A;  1OQM B;  5CQP A;  3V0O A;  5D91 A;  4AC3 A;  2D7I A;  1FR9 A;  4CVH A;  2FFV A;  1HM0 A;  1G1L A;  4ASJ A;  3V8Y A;  4D11 C;  2J0B A;  2PGV A;  4HO3 A;  1HM8 A;  1TVY A;  4EEM A;  3D98 A;  4Y7V A;  3V0Q A;  4DE7 A;  2RJ6 A;  4ASY A;  2AH9 A;  1FOA A;  4FIY A;  5I1F A;  4M4K A;  3R2W A;  3T7M A;  5IDS A;  1LZ0 A;  2OEF A;  1FXO A;  5C1G A;  1JYK A;  1VGW A;  4Y7G A;  1G93 A;  4HOC A;  3E26 A;  4K6R A;  2VXM A;  1ZJO A;  3FWW A;  2AES A;  5JQQ A;  4AAW A;  1LL0 A;  4HO4 A;  2OI6 A;  1ZJ0 A;  4O6N A;  2RIT A;  2RIX A;  1ZI3 A;  2VS4 A;  4UEG A;  1ZJ2 A;  2ZU8 A;  2AE7 A;  3TZT A;  2P73 A;  5CMF X;  2Y7A A;  1ZI5 A;  4MYB A;  4EEO A;  5AJP A;  1NMM B;  1G3L A;  3JTJ A;  4M2B A;  5CMJ A;  2BO4 A;  4B4M A;  4FRE A;  1VGU A;  1R7Y A;  5C36 A;  4R7P A;  3BCV A;  1FO8 A;  1TW5 A;  3CKV A;  4KPX A;  4AYJ A;  2JCJ A;  3CGX A;  2YQH A;  2APC A;  1VM8 A;  3PKP A;  2Y4M A;  2XME A;  2ICX A;  2YC5 A;  3U2X A;  4EVW A;  1FWY A;  4P00 A;  3SXE A;  3SXA A;  3ZLL A;  1VH3 A;  1FZW A;  1R81 A;  3TQD A;  1ON8 A;  5CQM X;  3I0L A;  3Q4S A;  1W57 A;  2RJ9 A;  1V83 A;  3EE5 A;  1MC3 A;  4FQW A;  4G87 A;  5C3D A;  1PZT A;  3OC9 A;  4KPZ A;  1G97 A;  2YCM A;  4P02 A;  1MP3 A;  3JUK A;  2C0N A;  1OMZ A;  1V84 A;  1LL2 A;  4EEA A;  5FUH A;  5FV9 A;  2GGQ A;  1R80 A;  1GQC A;  1QWJ A;  2WE9 A;  4Y6U A;  3OH4 A;  3F1Y A;  3I0H A;  1ZDG A;  5CMG X;  1H5R A;  4AYL A;  1GX0 A;  4NAI A;  3FOQ A;  3V0N A;  2ZU7 A;  1O0R A;  5HS2 A;  4B3U A;  5L6V A;  2V0I A;  4B42 A;  5BXC A;  1HV9 A;  5CMI A;  3K8D A;  2NXV A;  1LZJ A;  3I0G A;  2QH5 A;  4LW3 A;  4FCU A;  1H5T A;  3I0K A;  2RJ5 A;  3USR A;  1WVC A;  2VK9 A;  4MND A;  3I0J A;  1H5S A;  2FYC B;  5DDT A;  2FY7 A;  3SX3 A;  2Y4J A;  1IIN A;  3V91 A;  4Y7U A;  1ZCT A;  5C3B A;  1H3M A;  3F1C A;  4KQL A;  4Y9X A;  1W55 A;  3SXD A;  3NGW A;  3I0F A;  2A8W A;  2RIY A;  5AJO A;  5J49 A;  1HJJ A;  4HCQ A;  5D92 A;  2VSI A;  2WVL A;  2RJ8 A;  4FIX A;  1I52 A;  3USQ A;  1S4O A;  4KNR A;  3V8Z A;  1ZCY A;  4KC2 A;  4FRO A;  1FRW A;  2ZU9 A;  1LZI A;  1SS9 A;  2Y4L A;  3Q80 A;  2YC3 A;  5EIY A;  4HO0 A;  4Y7F A;  5FYE A;  2PX7 A;  5IDT A;  1H5R B;  2I5K A;  3PNN A;  1ON6 A;  5L6S A;  1TW1 A;  4KC4 A;  3RSB A;  4BMA A;  3U0Y A;  3R3I A;  1R7U A;  2O1H A;  4C2S A;  3PKQ A;  5FTS A;  4O6M A;  4HO8 A;  3U2W A;  4KXO A;  1H5S C;  1YP2 A;  3ZGG A;  2V0L A;  5EJ1 A;  5C1L A;  5C4C A;  1H5T B;  2X5Z A;  1YP3 A;  4HO5 A;  4Y63 A;  1ZCV A;  2Z86 A;  1KWS A;  2OI7 A;  5FTV A;  1XZ6 A;  1G0R A;  1H5S B;  2WVK A;  4KC1 A;  1YP4 A;  1LZ7 A;  1JYL A;  2OEG A;  3SX7 A;  2RJ1 A;  2W0W A;  3SXB A;  1FGX A;  2RJ0 A;  3U2V A;  4EEG A;  3JUJ A;  3T7O A;  4ECM A;  2AGD A;  4MIX A;  1WT3 A;  4CJC A;  1LVW A;  2WVM A;  4M28 A;  3CKJ A;  1ZCU A;  1XHB A;  1E5K A;  1GWW A;  3I0C A;  4FRM A;  1WT0 A;  1O7O A;  1R82 A;  2VS3 A;  1G9R A;  2V0K A;  1VGT A;  5C3A A;  1G95 A;  4JIS A;  1QG8 A;  2YQS A;  2I7B A;  3U0X A;  3V0L A;  4CJ8 A;  2QGI A;  1G2V A;  2W0V A;  5C49 A;  1NF5 B;  4FRP A;  3OGZ A; 
#chains in the Genus database with same CATH homology
 5CQN X;  4Y64 A;  3RMW A;  4FRA A;  3IOI A;  1H4D A;  1MP4 A;  1ZIZ A;  1G23 A;  1WSZ A;  2JCK A;  3ZLK A;  2AM3 A;  5C47 A;  1JVD A;  5IFY A;  2OI5 A;  1FGG A;  2WGZ A;  1FO9 A;  1ZJP A;  3T7N A;  2FYA A;  5FU0 A;  4NAL A;  4G3P A;  5AJN A;  5EJZ A;  2VXL A;  1ZHJ A;  3GUE A;  1ZI1 A;  3N9W A;  2P72 A;  1H7T A;  3SPT A;  1R7T A;  4EE3 A;  1INJ A;  3CKQ A;  2RJ4 A;  2D7R A;  1VGZ A;  2BO7 A;  3CKN A;  1W77 A;  4NAK A;  4G3S A;  1VH1 A;  1EZI A;  4ARW A;  3U2U A;  2PGY A;  3BRK X;  2WEE A;  4FRQ A;  1S4P A;  4J18 A;  1NKH B;  4EE5 A;  3RMV A;  4D0T A;  1JV3 A;  2ICY A;  3DJ4 A;  4KRV A;  3V0M A;  5FU8 A;  1R7V A;  4HG6 A;  1ZDF A;  2VFZ A;  1YRO B;  4EE4 A;  2XMH A;  1NQI B;  2QKX A;  1FR8 A;  1HJL A;  2I5E A;  3QVB A;  2JCO A;  4NAN A;  1NWG B;  3KIA A;  1WT2 A;  3ST8 A;  4B2W A;  3ZF8 A;  4KNX A;  4L41 C;  5CQL X;  5C4B A;  1VPA A;  4Y62 A;  2O1G A;  3K8E A;  4Y7T A;  5CMH A;  2X60 A;  1QGS A;  1VZU A;  2Y6P A;  1H7E A;  3DK5 A;  2AM4 A;  1H4C A;  3LW6 A;  3D8V A;  4ZDQ A;  5C48 A;  4HO9 A;  2VSH A;  1NHE B;  4CJB A;  2YQJ A;  4FRL A;  5CQO A;  3IOJ A;  4IRP A;  1H5S D;  4FCE A;  3I0I X;  2V0H A;  3DUV A;  1QGQ A;  2XWN A;  4D0Z A;  1R7X A;  4DDZ A;  2VD4 A;  1FXJ A;  2J0A A;  1K4V A;  1O7Q A;  2Y4K A;  1OMX A;  3SXG A;  2BO8 A;  3OKR A;  1H7G A;  3OH3 A;  1ZJ3 A;  1ZJ1 A;  2CU2 A;  4B2X A;  1H4E A;  2FFU A;  1WT1 A;  5C4F A;  1EYR A;  2WAW A;  4FRD A;  4M2A A;  2DPW A;  5C4E A;  2XWM A;  1IIM A;  2FYD B;  1TZF A;  4XWI A;  1V82 A;  4D48 A;  4Y6N A;  1JVG A;  5DDV A;  4B4G A;  4JD0 A;  2O1F A;  2BO6 A;  2P6W A;  1H7L A;  4GBP A;  4IRQ A;  4E1K A;  3Q7U A;  4YS8 A;  1VIC A;  1GX4 A;  3V0P A;  3POL A;  1MP5 A;  1H7Q A;  5C1H A;  5C4D A;  2PA4 A;  1H7F A;  3HL3 A;  4B5B A;  1GWV A;  4Q7C A;  3V90 A;  3I0D A;  1G8O A;  4KT7 A;  1FG5 N;  2FYB A;  3OH1 A;  2XWL A;  1H7H A;  4G3Q A;  3D5N A;  3ZGF A;  2YQC A;  2UX8 A;  4DEC A;  3IOH A;  4HO6 A;  3OAM A;  2E8B A;  2X65 A;  4LW6 A;  4D11 A;  3SX5 A;  2AM5 A;  1INI A;  3SXC A;  1O23 B;  1Z90 A;  2JCL A;  4BQH A;  1VZX A;  1HM9 A;  2RIZ A;  1S4N A;  2RJ7 A;  1PZY B;  2Z87 A;  2GGO A;  3SX8 A;  1JV1 A;  3CKO A;  2X5S A;  2E3D A;  2A8U A;  2V0J A;  2VS5 A;  1GA8 A;  3O3P A;  2MZB A;  2YES A;  3U2T A;  3OH2 A;  4HO2 A;  1LL3 A;  3I0E A;  1ZI4 A;  4FRB A;  1GQ9 A;  1VZT A;  4FRH A;  2AEC A;  5C38 A;  3E25 A;  4B4B A;  3CU0 A;  2D0J A;  2Q4J A;  3OH0 A;  5C8R A;  1OQM B;  5CQP A;  3V0O A;  5D91 A;  4AC3 A;  2D7I A;  1FR9 A;  4CVH A;  2FFV A;  1HM0 A;  1G1L A;  4ASJ A;  3V8Y A;  4D11 C;  2J0B A;  2PGV A;  4HO3 A;  1HM8 A;  1TVY A;  4EEM A;  3D98 A;  4Y7V A;  3V0Q A;  4DE7 A;  2RJ6 A;  4ASY A;  2AH9 A;  1FOA A;  4FIY A;  5I1F A;  4M4K A;  3R2W A;  3T7M A;  5IDS A;  1LZ0 A;  2OEF A;  1FXO A;  5C1G A;  1JYK A;  1VGW A;  4Y7G A;  1G93 A;  4HOC A;  3E26 A;  4K6R A;  2VXM A;  1ZJO A;  3FWW A;  2AES A;  5JQQ A;  4AAW A;  1LL0 A;  4HO4 A;  2OI6 A;  1ZJ0 A;  4O6N A;  2RIT A;  2RIX A;  1ZI3 A;  2VS4 A;  4UEG A;  1ZJ2 A;  2ZU8 A;  2AE7 A;  3TZT A;  2P73 A;  5CMF X;  2Y7A A;  1ZI5 A;  4MYB A;  4EEO A;  5AJP A;  1NMM B;  1G3L A;  3JTJ A;  4M2B A;  5CMJ A;  2BO4 A;  4B4M A;  4FRE A;  1VGU A;  1R7Y A;  5C36 A;  4R7P A;  3BCV A;  1FO8 A;  1TW5 A;  3CKV A;  4KPX A;  4AYJ A;  2JCJ A;  3CGX A;  2YQH A;  2APC A;  1VM8 A;  3PKP A;  2Y4M A;  2XME A;  2ICX A;  2YC5 A;  3U2X A;  4EVW A;  1FWY A;  4P00 A;  3SXE A;  3SXA A;  3ZLL A;  1VH3 A;  1FZW A;  1R81 A;  3TQD A;  1ON8 A;  5CQM X;  3I0L A;  3Q4S A;  1W57 A;  2RJ9 A;  1V83 A;  3EE5 A;  1MC3 A;  4FQW A;  4G87 A;  5C3D A;  1PZT A;  3OC9 A;  4KPZ A;  1G97 A;  2YCM A;  4P02 A;  1MP3 A;  3JUK A;  2C0N A;  1OMZ A;  1V84 A;  1LL2 A;  4EEA A;  5FUH A;  5FV9 A;  2GGQ A;  1R80 A;  1GQC A;  1QWJ A;  2WE9 A;  4Y6U A;  3OH4 A;  3F1Y A;  3I0H A;  1ZDG A;  5CMG X;  1H5R A;  4AYL A;  1GX0 A;  4NAI A;  3FOQ A;  3V0N A;  2ZU7 A;  1O0R A;  5HS2 A;  4B3U A;  5L6V A;  2V0I A;  4B42 A;  5BXC A;  1HV9 A;  5CMI A;  3K8D A;  2NXV A;  1LZJ A;  3I0G A;  2QH5 A;  4LW3 A;  4FCU A;  1H5T A;  3I0K A;  2RJ5 A;  3USR A;  1WVC A;  2VK9 A;  4MND A;  3I0J A;  1H5S A;  2FYC B;  5DDT A;  2FY7 A;  3SX3 A;  2Y4J A;  1IIN A;  3V91 A;  4Y7U A;  1ZCT A;  5C3B A;  1H3M A;  3F1C A;  4KQL A;  4Y9X A;  1W55 A;  3SXD A;  3NGW A;  3I0F A;  2A8W A;  2RIY A;  5AJO A;  5J49 A;  1HJJ A;  4HCQ A;  5D92 A;  2VSI A;  2WVL A;  2RJ8 A;  4FIX A;  1I52 A;  3USQ A;  1S4O A;  4KNR A;  3V8Z A;  1ZCY A;  4KC2 A;  4FRO A;  1FRW A;  2ZU9 A;  1LZI A;  1SS9 A;  2Y4L A;  3Q80 A;  2YC3 A;  5EIY A;  4HO0 A;  4Y7F A;  5FYE A;  2PX7 A;  5IDT A;  1H5R B;  2I5K A;  3PNN A;  1ON6 A;  5L6S A;  1TW1 A;  4KC4 A;  3RSB A;  4BMA A;  3U0Y A;  3R3I A;  1R7U A;  2O1H A;  4C2S A;  3PKQ A;  5FTS A;  4O6M A;  4HO8 A;  3U2W A;  4KXO A;  1H5S C;  1YP2 A;  3ZGG A;  2V0L A;  5EJ1 A;  5C1L A;  5C4C A;  1H5T B;  2X5Z A;  1YP3 A;  4HO5 A;  4Y63 A;  1ZCV A;  2Z86 A;  1KWS A;  2OI7 A;  5FTV A;  1XZ6 A;  1G0R A;  1H5S B;  2WVK A;  4KC1 A;  1YP4 A;  1LZ7 A;  1JYL A;  2OEG A;  3SX7 A;  2RJ1 A;  2W0W A;  3SXB A;  1FGX A;  2RJ0 A;  3U2V A;  4EEG A;  3JUJ A;  3T7O A;  4ECM A;  2AGD A;  4MIX A;  1WT3 A;  4CJC A;  1LVW A;  2WVM A;  4M28 A;  3CKJ A;  1ZCU A;  1XHB A;  1E5K A;  1GWW A;  3I0C A;  4FRM A;  1WT0 A;  1O7O A;  1R82 A;  2VS3 A;  1G9R A;  2V0K A;  1VGT A;  5C3A A;  1G95 A;  4JIS A;  1QG8 A;  2YQS A;  2I7B A;  3U0X A;  3V0L A;  4CJ8 A;  2QGI A;  1G2V A;  2W0V A;  5C49 A;  1NF5 B;  4FRP A;  3OGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...