3D5NA

Crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
MNIGVIILAAGEGKRFGGDKLLAKIDNTPIIMRTIRIYGDLEKIIIVGKYVNEMLPLLMDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDMPFVTKEDVNKIINTFKPNCKAVIPTHKGERGNPVLISKSLFNEIEKLRGDVGARVILNKIKIEELCFIECSEGVLIDIDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Q97W15_SULSO
publication title Crystal structure of the Q97W15_SULSO protein from Sulfolobus solfataricus. NESG target SsR125.
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3d5nA00
3D8VA 1W57A 5CMJA 2Y6PA 1FGXA 2APCA 5C36A 1QG8A 4KC1A 4LW6A 4D48A 2XWMA 2ICYA 5FU8A 2XWNA 1EZIA 3V8ZA 3V90A 4EEMA 1FO8A 1R81A 4FCUA 1HM8A 3GUEA 1JYLA 2OI6A 3OC9A 4FQWA 2XWLA 4DECA 2VS3A 2Z87A 5FUHA 5CQMX 2WVKA 2RJ4A 1H7TA 4KC2A 3U2WA 4Y63A 5I1FA 4K6RA 1JVDA 3I0LA 2FFUA 2AH9A 2UX8A 3OH0A 4AYJA 1GQ9A 2RIYA 4KRVA 5C1LA 3PKPA 2A8UA 4FCEA 3IOHA 1IIMA 5CQOA 3QVBA 3JUJA 3USQA 3TQDA 1JV3A 2Z86A 4KT7A 5C4EA 4LW3A 3RSBA 4JISA 4CJBA 3SXAA 4KNRA 1INJA 5FYEA 2PX7A 2O1GA 2QKXA 2VD4A 1H7QA 3R3IA 1G1LA 1R82A 3NGWA 4ZDQA 2GGOA 2I5EA 4EE4A 4HO3A 4CVHA 1PZYB 3D98A 1TW5A 2RJ7A 2VSHA 2RJ8A 1H4CA 1YP3A 1ZI4A 3U2UA 2FYAA 2OI5A 5FTSA 2W0VA 1WT0A 3ST8A 4B5BA 2X5ZA 2YC5A 3ZGFA 1OMXA 1HM9A 5DDTA 5CMFX 4UEGA 3SXEA 4E1KA 4B4GA 2V0KA 1FXJA 1ZCYA 4CJ8A 3I0JA 3PKQA 1OQMB 5FV9A 3T7MA 5C38A 2YQCA 4M4KA 1LVWA 1R7UA 4D11C 1H7HA 4NAIA 5C3DA 1V83A 4EE3A 1MP3A 3ZF8A 2RJ1A 3SX7A 3DK5A 4KPXA 3V0NA 4BQHA 1ZJ3A 4KXOA 1K4VA 1QGQA 1HM0A 2D7RA 5JQQA 4HOCA 1H5SC 4M28A 2O1HA 4B4BA 4Y7VA 3U2TA 5CQNX 4NAKA 2ZU9A 1YP2A 3SPTA 3ZGGA 3ZLLA 1S4OA 4B2XA 1PZTA 1ZJOA 4B42A 5BXCA 1YROB 1FOAA 1G8OA 4NANA 3U2VA 2WGZA 1YP4A 3USRA 1FO9A 1R7TA 3I0KA 3JUKA 1QWJA 1R80A 4KNXA 2CU2A 2YESA 3T7NA 2X60A 4Y7GA 2VS4A 2V0JA 3E26A 2V0IA 1FG5N 3N9WA 1FWYA 1H5SD 5EJZA 4NALA 1WT2A 2VXMA 4HO8A 1O7OA 1G3LA 1LZIA 3I0FA 2RJ0A 2JCKA 1FRWA 2D0JA 1O0RA 2BO6A 3OGZA 4G3QA 1ZIZA 1FZWA 1VPAA 1ZI5A 2XMHA 1OMZA 1LL3A 1LL0A 3I0DA 5DDVA 1H5RA 1NF5B 4D0ZA 2V0HA 1HJLA 1O23B 4J18A 4AYLA 3JTJA 2W0WA 4CJCA 1LZ7A 3I0CA 1JVGA 1VGUA 3SXDA 2RJ5A 3TZTA 5C4FA 4D11A 1W55A 1WT1A 1ZCVA 1H3MA 2RJ6A 1GWWA 3OH3A 4G3PA 3I0IX 3LW6A 1JYKA 1ON8A 4Y7UA 1VM8A 2BO7A 1H5SA 1VH1A 3CKNA 1G0RA 1G93A 1H5RB 3K8EA 1FGGA 1VZTA 3V0PA 2WAWA 1GQCA 1H7LA 4FRBA 4ECMA 4HO5A 1INIA 5CMIA 3F1CA 4FRHA 4MYBA 4EEOA 1WSZA 2PGYA 2AECA 2JCOA 2FYCB 1ZJ0A 3POLA 1ZJ1A 4M2BA 1LZ0A 2ZU7A 3EE5A 4R7PA 4IRPA 4Y64A 4HG6A 1H5SB 4EEGA 2D7IA 3T7OA 5IDSA 4KC4A 5AJOA 1V82A 4DDZA 4Y6NA 1MC3A 5C49A 3SXGA 4JD0A 3IOIA 2WVLA 4HO4A 1VGTA 2RIZA 3CKOA 3PNNA 4MNDA 5CMHA 3V0MA 4HO9A 5C1HA 4XWIA 1WT3A 2Y4JA 1E5KA 4FRLA 5AJNA 3OAMA 2P72A 4FRQA 4YS8A 1GX0A 2VFZA 2JCJA 3CKQA 2BO8A 3OH1A 1ZI1A 2WEEA 1ZJPA 3CKJA 5C4CA 1HV9A 3I0EA 1H7FA 1MP4A 2OI7A 5EJ1A 5CMGX 1H7GA 4Y7FA 2RIXA 1W77A 1NWGB 1ZCTA 2YC3A 3F1YA 2AESA 2E3DA 5L6SA 1V84A 2YQSA 3U2XA 4M2AA 3SX5A 2FYDB 2PA4A 4Y6UA 4D0TA 2VXLA 5C1GA 2VSIA 2XMEA 2ZU8A 5C8RA 2YQHA 1NMMB 5FU0A 5C47A 3IOJA 4HCQA 3FWWA 1H4EA 1VICA 1TW1A 5C4BA 2VS5A 1TZFA 4G3SA 1S4NA 3OKRA 3SX3A 4DE7A 2FY7A 2ICXA 2QH5A 5C3BA 5IFYA 1MP5A 3FOQA 2AE7A 2FFVA 3BRKX 3RMVA 1GWVA 3CKVA 2OEFA 1Z90A 2AM4A 3KIAA 2AM3A 3R2WA 2RITA 5L6VA 2OEGA 1H4DA 2MZBA 5J49A 4FRPA 3U0XA 2WE9A 3SXCA 1R7VA 4IRQA 4AAWA 2AGDA 4ASJA 2X5SA 1S4PA 3D5NA 4B3UA 1G95A 2YCMA 3V0QA 2Q4JA 3Q80A 1SS9A 4Y62A 2Y7AA 1EYRA 1VGWA 4FRDA 1G97A 1HJJA 2NXVA 3U0YA 3SXBA 4ARWA 2GGQA 3CU0A 2RJ9A 3OH4A 5C3AA 5C4DA 3SX8A 2JCLA 3OH2A 1LL2A 2BO4A 2QGIA 3Q7UA 2DPWA 1R7YA 2Y4LA 1O7QA 4AC3A 1ZDGA 4P02A 1G23A 4KPZA 1FXOA 3V0LA 4HO2A 1ZHJA 3V91A 5C48A 3I0GA 5IDTA 1FR8A 3HL3A 2E8BA 1VZXA 1LZJA 1H5TA 4HO0A 4C2SA 1ZCUA 1I52A 1XZ6A 1H7EA 2PGVA 1ON6A 4FROA 3ZLKA 1FR9A 4B4MA 1QGSA 3BCVA 2Y4KA 5EIYA 1VGZA 4B2WA 2O1FA 1NKHB 1GX4A 5FTVA 1ZDFA 4FRAA 4HO6A 1ZJ2A 5AJPA 4BMAA 1TVYA 1VH3A 2YQJA 1R7XA 1IINA 4P00A 2FYBA 1G2VA 4Y7TA 4FRMA 3E25A 2V0LA 2P73A 1XHBA 3I0HA 1WVCA 1KWSA 4GBPA 4EE5A 1G9RA 1NQIB 1VZUA 4EEAA 4G87A 2WVMA 4FREA 5CQLX 2Y4MA 3Q4SA 1H5TB 2P6WA 1NHEB 4EVWA 4Y9XA 1GA8A 5CQPA 1ZI3A 2I7BA 3RMWA 2X65A 2AM5A 3CGXA 3K8DA 3V8YA 4L41C 4KQLA 5HS2A 1JV1A 4ASYA 3DJ4A 2I5KA 3O3PA 3V0OA 3DUVA 2A8WA
chains in the Genus database with same CATH superfamily
3D8VA 1W57A 5CMJA 2Y6PA 1FGXA 2APCA 5C36A 1QG8A 4KC1A 4LW6A 4D48A 2XWMA 2ICYA 5FU8A 2XWNA 1EZIA 3V8ZA 3V90A 4EEMA 1FO8A 1R81A 4FCUA 1HM8A 3GUEA 1JYLA 2OI6A 3OC9A 4FQWA 2XWLA 4DECA 2VS3A 2C0NA 2Z87A 5FUHA 5CQMX 2WVKA 2RJ4A 1H7TA 4KC2A 3U2WA 4Y63A 5I1FA 4K6RA 1JVDA 3I0LA 2FFUA 2AH9A 2UX8A 3OH0A 4AYJA 1GQ9A 2RIYA 4KRVA 5C1LA 3PKPA 2A8UA 4FCEA 3IOHA 1IIMA 5CQOA 3QVBA 3JUJA 3USQA 3TQDA 1JV3A 2Z86A 4KT7A 5C4EA 4LW3A 3RSBA 4JISA 4CJBA 3SXAA 4KNRA 1INJA 5FYEA 2PX7A 5D91A 2O1GA 2QKXA 2VD4A 1H7QA 3R3IA 1G1LA 1R82A 3NGWA 4ZDQA 2GGOA 2I5EA 4EE4A 4HO3A 4CVHA 1PZYB 3D98A 1TW5A 2RJ7A 2VSHA 2RJ8A 1H4CA 1YP3A 1ZI4A 3U2UA 2FYAA 2OI5A 5FTSA 2W0VA 1WT0A 3ST8A 4B5BA 2X5ZA 2YC5A 3ZGFA 1OMXA 1HM9A 5DDTA 5CMFX 4UEGA 3SXEA 4E1KA 4B4GA 2V0KA 1FXJA 1ZCYA 4CJ8A 3I0JA 3PKQA 1OQMB 5FV9A 3T7MA 5C38A 2J0BA 2YQCA 4M4KA 1LVWA 1R7UA 4D11C 1H7HA 4NAIA 5C3DA 1V83A 4EE3A 1MP3A 3ZF8A 2RJ1A 3SX7A 3DK5A 4KPXA 3V0NA 4BQHA 1ZJ3A 4KXOA 1K4VA 1QGQA 1HM0A 2D7RA 5JQQA 4HOCA 1H5SC 4M28A 2O1HA 4B4BA 4Y7VA 3U2TA 5CQNX 4NAKA 2ZU9A 1YP2A 3SPTA 3ZGGA 3ZLLA 1S4OA 4B2XA 1PZTA 1ZJOA 4B42A 5BXCA 1YROB 1FOAA 1G8OA 4NANA 3U2VA 2WGZA 1YP4A 3USRA 1FO9A 1R7TA 3I0KA 3JUKA 1QWJA 1R80A 2J0AA 4KNXA 2CU2A 2YESA 3T7NA 2X60A 4Y7GA 4O6MA 2VS4A 2V0JA 3E26A 2V0IA 1FG5N 3N9WA 5D92A 1FWYA 1H5SD 5EJZA 4NALA 1WT2A 2VXMA 4HO8A 1O7OA 1G3LA 1LZIA 3I0FA 2RJ0A 2JCKA 1FRWA 2D0JA 1O0RA 2BO6A 3OGZA 4G3QA 1ZIZA 1FZWA 1VPAA 1ZI5A 2XMHA 1OMZA 1LL3A 1LL0A 3I0DA 5DDVA 1H5RA 1NF5B 4D0ZA 2V0HA 1HJLA 1O23B 4J18A 4AYLA 3JTJA 2W0WA 4CJCA 1LZ7A 3I0CA 1JVGA 1VGUA 4FIYA 3SXDA 2RJ5A 3TZTA 5C4FA 4D11A 1W55A 1WT1A 1ZCVA 1H3MA 2RJ6A 1GWWA 3OH3A 4G3PA 3I0IX 3LW6A 1JYKA 1ON8A 4Y7UA 1VM8A 2BO7A 1H5SA 1VH1A 3CKNA 1G0RA 1G93A 1H5RB 3K8EA 1FGGA 1VZTA 3V0PA 2WAWA 1GQCA 1H7LA 4FRBA 4ECMA 4HO5A 1INIA 5CMIA 3F1CA 4FRHA 4MYBA 4EEOA 1WSZA 2PGYA 2AECA 2JCOA 2FYCB 1ZJ0A 3POLA 1ZJ1A 4M2BA 1LZ0A 2ZU7A 3EE5A 4R7PA 4IRPA 4Y64A 4HG6A 1H5SB 4EEGA 2D7IA 3T7OA 5IDSA 4KC4A 5AJOA 1V82A 4DDZA 4Y6NA 1MC3A 5C49A 3SXGA 4JD0A 3IOIA 2WVLA 4HO4A 1VGTA 2RIZA 3CKOA 3PNNA 4MNDA 5CMHA 3V0MA 4HO9A 5C1HA 4XWIA 1WT3A 2Y4JA 1E5KA 4FRLA 5AJNA 3OAMA 2P72A 4FRQA 4YS8A 1GX0A 2VFZA 2JCJA 3CKQA 2BO8A 3OH1A 1ZI1A 2WEEA 1ZJPA 3CKJA 5C4CA 1HV9A 3I0EA 1H7FA 1MP4A 2OI7A 5EJ1A 5CMGX 1H7GA 4Y7FA 2RIXA 1W77A 1NWGB 1ZCTA 2YC3A 3F1YA 2AESA 2E3DA 5L6SA 1V84A 2YQSA 3U2XA 4M2AA 3SX5A 2FYDB 2PA4A 4Y6UA 4MIXA 4D0TA 2VXLA 5C1GA 2VSIA 2XMEA 2ZU8A 5C8RA 2YQHA 1NMMB 5FU0A 5C47A 3IOJA 4HCQA 3FWWA 1H4EA 1VICA 1TW1A 2VK9A 5C4BA 2VS5A 1TZFA 4G3SA 1S4NA 3OKRA 3SX3A 4DE7A 2FY7A 2ICXA 2QH5A 4O6NA 5C3BA 5IFYA 1MP5A 3FOQA 2AE7A 2FFVA 3BRKX 3RMVA 1GWVA 3CKVA 2OEFA 1Z90A 2AM4A 3KIAA 2AM3A 3R2WA 2RITA 5L6VA 2OEGA 1H4DA 2MZBA 5J49A 4FRPA 3U0XA 2WE9A 3SXCA 1R7VA 4IRQA 4AAWA 2AGDA 4ASJA 2X5SA 1S4PA 3D5NA 4B3UA 1G95A 2YCMA 3V0QA 2Q4JA 3Q80A 1SS9A 4Y62A 2Y7AA 1EYRA 1VGWA 4FRDA 1G97A 1HJJA 2NXVA 3U0YA 3SXBA 4ARWA 2GGQA 3CU0A 2RJ9A 3OH4A 5C3AA 5C4DA 3SX8A 2JCLA 3OH2A 1LL2A 2BO4A 2QGIA 3Q7UA 2DPWA 1R7YA 2Y4LA 1O7QA 4AC3A 1ZDGA 4P02A 1G23A 4KPZA 1FXOA 3V0LA 4HO2A 1ZHJA 3V91A 5C48A 3I0GA 5IDTA 1FR8A 3HL3A 2E8BA 1VZXA 4Q7CA 1LZJA 1H5TA 4HO0A 4C2SA 1ZCUA 1I52A 1XZ6A 1H7EA 2PGVA 1ON6A 4FROA 3ZLKA 1FR9A 4B4MA 1QGSA 3BCVA 2Y4KA 5EIYA 1VGZA 4B2WA 4FIXA 2O1FA 1NKHB 1GX4A 5FTVA 1ZDFA 4FRAA 4HO6A 1ZJ2A 5AJPA 4BMAA 1TVYA 1VH3A 2YQJA 1R7XA 1IINA 4P00A 2FYBA 1G2VA 4Y7TA 4FRMA 3E25A 2V0LA 2P73A 1XHBA 3I0HA 1WVCA 1KWSA 4GBPA 4EE5A 1G9RA 1NQIB 1VZUA 4EEAA 4G87A 2WVMA 4FREA 5CQLX 2Y4MA 3Q4SA 1H5TB 2P6WA 1NHEB 4EVWA 4Y9XA 1GA8A 5CQPA 1ZI3A 2I7BA 3RMWA 2X65A 2AM5A 3CGXA 3K8DA 3V8YA 4L41C 4KQLA 5HS2A 1JV1A 4ASYA 3DJ4A 2I5KA 3O3PA 3V0OA 3DUVA 2A8WA
chains in the Genus database with same CATH topology
3D8VA 1W57A 5CMJA 2Y6PA 1FGXA 2APCA 5C36A 1QG8A 4KC1A 4LW6A 4D48A 2XWMA 2ICYA 5FU8A 2XWNA 1EZIA 3V8ZA 3V90A 4EEMA 1FO8A 1R81A 4FCUA 1HM8A 3GUEA 1JYLA 2OI6A 3OC9A 4FQWA 2XWLA 4DECA 2VS3A 2C0NA 2Z87A 5FUHA 5CQMX 2WVKA 2RJ4A 1H7TA 4KC2A 3U2WA 4Y63A 5I1FA 4K6RA 1JVDA 3I0LA 2FFUA 2AH9A 2UX8A 3OH0A 4AYJA 1GQ9A 2RIYA 4KRVA 5C1LA 3PKPA 2A8UA 4FCEA 3IOHA 1IIMA 5CQOA 3QVBA 3JUJA 3USQA 3TQDA 1JV3A 2Z86A 4KT7A 5C4EA 4LW3A 3RSBA 4JISA 4CJBA 3SXAA 4KNRA 1INJA 5FYEA 2PX7A 5D91A 2O1GA 2QKXA 2VD4A 1H7QA 3R3IA 1G1LA 1R82A 3NGWA 4ZDQA 2GGOA 2I5EA 4EE4A 4HO3A 4CVHA 1PZYB 3D98A 1TW5A 2RJ7A 2VSHA 2RJ8A 1H4CA 1YP3A 1ZI4A 3U2UA 2FYAA 2OI5A 5FTSA 2W0VA 1WT0A 3ST8A 4B5BA 2X5ZA 2YC5A 3ZGFA 1OMXA 1HM9A 5DDTA 5CMFX 4UEGA 3SXEA 4E1KA 4B4GA 2V0KA 1FXJA 1ZCYA 4CJ8A 3I0JA 3PKQA 1OQMB 5FV9A 3T7MA 5C38A 2J0BA 2YQCA 4M4KA 1LVWA 1R7UA 4D11C 1H7HA 4NAIA 5C3DA 1V83A 4EE3A 1MP3A 3ZF8A 2RJ1A 3SX7A 3DK5A 4KPXA 3V0NA 4BQHA 1ZJ3A 4KXOA 1K4VA 1QGQA 1HM0A 2D7RA 5JQQA 4HOCA 1H5SC 4M28A 2O1HA 4B4BA 4Y7VA 3U2TA 5CQNX 4NAKA 2ZU9A 1YP2A 3SPTA 3ZGGA 3ZLLA 1S4OA 4B2XA 1PZTA 1ZJOA 4B42A 5BXCA 1YROB 1FOAA 1G8OA 4NANA 3U2VA 2WGZA 1YP4A 3USRA 1FO9A 1R7TA 3I0KA 3JUKA 1QWJA 1R80A 2J0AA 4KNXA 2CU2A 2YESA 3T7NA 2X60A 4Y7GA 4O6MA 2VS4A 2V0JA 3E26A 2V0IA 1FG5N 3N9WA 5D92A 1FWYA 1H5SD 5EJZA 4NALA 1WT2A 2VXMA 4HO8A 1O7OA 1G3LA 1LZIA 3I0FA 2RJ0A 2JCKA 1FRWA 2D0JA 1O0RA 2BO6A 3OGZA 4G3QA 1ZIZA 1FZWA 1VPAA 1ZI5A 2XMHA 1OMZA 1LL3A 1LL0A 3I0DA 5DDVA 1H5RA 1NF5B 4D0ZA 2V0HA 1HJLA 1O23B 4J18A 4AYLA 3JTJA 2W0WA 4CJCA 1LZ7A 3I0CA 1JVGA 1VGUA 4FIYA 3SXDA 2RJ5A 3TZTA 5C4FA 4D11A 1W55A 1WT1A 1ZCVA 1H3MA 2RJ6A 1GWWA 3OH3A 4G3PA 3I0IX 3LW6A 1JYKA 1ON8A 4Y7UA 1VM8A 2BO7A 1H5SA 1VH1A 3CKNA 1G0RA 1G93A 1H5RB 3K8EA 1FGGA 1VZTA 3V0PA 2WAWA 1GQCA 1H7LA 4FRBA 4ECMA 4HO5A 1INIA 5CMIA 3F1CA 4FRHA 4MYBA 4EEOA 1WSZA 2PGYA 2AECA 2JCOA 2FYCB 1ZJ0A 3POLA 1ZJ1A 4M2BA 1LZ0A 2ZU7A 3EE5A 4R7PA 4IRPA 4Y64A 4HG6A 1H5SB 4EEGA 2D7IA 3T7OA 5IDSA 4KC4A 5AJOA 1V82A 4DDZA 4Y6NA 1MC3A 5C49A 3SXGA 4JD0A 3IOIA 2WVLA 4HO4A 1VGTA 2RIZA 3CKOA 3PNNA 4MNDA 5CMHA 3V0MA 4HO9A 5C1HA 4XWIA 1WT3A 2Y4JA 1E5KA 4FRLA 5AJNA 3OAMA 2P72A 4FRQA 4YS8A 1GX0A 2VFZA 2JCJA 3CKQA 2BO8A 3OH1A 1ZI1A 2WEEA 1ZJPA 3CKJA 5C4CA 1HV9A 3I0EA 1H7FA 1MP4A 2OI7A 5EJ1A 5CMGX 1H7GA 4Y7FA 2RIXA 1W77A 1NWGB 1ZCTA 2YC3A 3F1YA 2AESA 2E3DA 5L6SA 1V84A 2YQSA 3U2XA 4M2AA 3SX5A 2FYDB 2PA4A 4Y6UA 4MIXA 4D0TA 2VXLA 5C1GA 2VSIA 2XMEA 2ZU8A 5C8RA 2YQHA 1NMMB 5FU0A 5C47A 3IOJA 4HCQA 3FWWA 1H4EA 1VICA 1TW1A 2VK9A 5C4BA 2VS5A 1TZFA 4G3SA 1S4NA 3OKRA 3SX3A 4DE7A 2FY7A 2ICXA 2QH5A 4O6NA 5C3BA 5IFYA 1MP5A 3FOQA 2AE7A 2FFVA 3BRKX 3RMVA 1GWVA 3CKVA 2OEFA 1Z90A 2AM4A 3KIAA 2AM3A 3R2WA 2RITA 5L6VA 2OEGA 1H4DA 2MZBA 5J49A 4FRPA 3U0XA 2WE9A 3SXCA 1R7VA 4IRQA 4AAWA 2AGDA 4ASJA 2X5SA 1S4PA 3D5NA 4B3UA 1G95A 2YCMA 3V0QA 2Q4JA 3Q80A 1SS9A 4Y62A 2Y7AA 1EYRA 1VGWA 4FRDA 1G97A 1HJJA 2NXVA 3U0YA 3SXBA 4ARWA 2GGQA 3CU0A 2RJ9A 3OH4A 5C3AA 5C4DA 3SX8A 2JCLA 3OH2A 1LL2A 2BO4A 2QGIA 3Q7UA 2DPWA 1R7YA 2Y4LA 1O7QA 4AC3A 1ZDGA 4P02A 1G23A 4KPZA 1FXOA 3V0LA 4HO2A 1ZHJA 3V91A 5C48A 3I0GA 5IDTA 1FR8A 3HL3A 2E8BA 1VZXA 4Q7CA 1LZJA 1H5TA 4HO0A 4C2SA 1ZCUA 1I52A 1XZ6A 1H7EA 2PGVA 1ON6A 4FROA 3ZLKA 1FR9A 4B4MA 1QGSA 3BCVA 2Y4KA 5EIYA 1VGZA 4B2WA 4FIXA 2O1FA 1NKHB 1GX4A 5FTVA 1ZDFA 4FRAA 4HO6A 1ZJ2A 5AJPA 4BMAA 1TVYA 1VH3A 2YQJA 1R7XA 1IINA 4P00A 2FYBA 1G2VA 4Y7TA 4FRMA 3E25A 2V0LA 2P73A 1XHBA 3I0HA 1WVCA 1KWSA 4GBPA 4EE5A 1G9RA 1NQIB 1VZUA 4EEAA 4G87A 2WVMA 4FREA 5CQLX 2Y4MA 3Q4SA 1H5TB 2P6WA 1NHEB 4EVWA 4Y9XA 1GA8A 5CQPA 1ZI3A 2I7BA 3RMWA 2X65A 2AM5A 3CGXA 3K8DA 3V8YA 4L41C 4KQLA 5HS2A 1JV1A 4ASYA 3DJ4A 2I5KA 3O3PA 3V0OA 3DUVA 2A8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8V A;  1W57 A;  5CMJ A;  2Y6P A;  1FGX A;  2APC A;  5C36 A;  1QG8 A;  4KC1 A;  4LW6 A;  4D48 A;  2XWM A;  2ICY A;  5FU8 A;  2XWN A;  1EZI A;  3V8Z A;  3V90 A;  4EEM A;  1FO8 A;  1R81 A;  4FCU A;  1HM8 A;  3GUE A;  1JYL A;  2OI6 A;  3OC9 A;  4FQW A;  2XWL A;  4DEC A;  2VS3 A;  2Z87 A;  5FUH A;  5CQM X;  2WVK A;  2RJ4 A;  1H7T A;  4KC2 A;  3U2W A;  4Y63 A;  5I1F A;  4K6R A;  1JVD A;  3I0L A;  2FFU A;  2AH9 A;  2UX8 A;  3OH0 A;  4AYJ A;  1GQ9 A;  2RIY A;  4KRV A;  5C1L A;  3PKP A;  2A8U A;  4FCE A;  3IOH A;  1IIM A;  5CQO A;  3QVB A;  3JUJ A;  3USQ A;  3TQD A;  1JV3 A;  2Z86 A;  4KT7 A;  5C4E A;  4LW3 A;  3RSB A;  4JIS A;  4CJB A;  3SXA A;  4KNR A;  1INJ A;  5FYE A;  2PX7 A;  2O1G A;  2QKX A;  2VD4 A;  1H7Q A;  3R3I A;  1G1L A;  1R82 A;  3NGW A;  4ZDQ A;  2GGO A;  2I5E A;  4EE4 A;  4HO3 A;  4CVH A;  1PZY B;  3D98 A;  1TW5 A;  2RJ7 A;  2VSH A;  2RJ8 A;  1H4C A;  1YP3 A;  1ZI4 A;  3U2U A;  2FYA A;  2OI5 A;  5FTS A;  2W0V A;  1WT0 A;  3ST8 A;  4B5B A;  2X5Z A;  2YC5 A;  3ZGF A;  1OMX A;  1HM9 A;  5DDT A;  5CMF X;  4UEG A;  3SXE A;  4E1K A;  4B4G A;  2V0K A;  1FXJ A;  1ZCY A;  4CJ8 A;  3I0J A;  3PKQ A;  1OQM B;  5FV9 A;  3T7M A;  5C38 A;  2YQC A;  4M4K A;  1LVW A;  1R7U A;  4D11 C;  1H7H A;  4NAI A;  5C3D A;  1V83 A;  4EE3 A;  1MP3 A;  3ZF8 A;  2RJ1 A;  3SX7 A;  3DK5 A;  4KPX A;  3V0N A;  4BQH A;  1ZJ3 A;  4KXO A;  1K4V A;  1QGQ A;  1HM0 A;  2D7R A;  5JQQ A;  4HOC A;  1H5S C;  4M28 A;  2O1H A;  4B4B A;  4Y7V A;  3U2T A;  5CQN X;  4NAK A;  2ZU9 A;  1YP2 A;  3SPT A;  3ZGG A;  3ZLL A;  1S4O A;  4B2X A;  1PZT A;  1ZJO A;  4B42 A;  5BXC A;  1YRO B;  1FOA A;  1G8O A;  4NAN A;  3U2V A;  2WGZ A;  1YP4 A;  3USR A;  1FO9 A;  1R7T A;  3I0K A;  3JUK A;  1QWJ A;  1R80 A;  4KNX A;  2CU2 A;  2YES A;  3T7N A;  2X60 A;  4Y7G A;  2VS4 A;  2V0J A;  3E26 A;  2V0I A;  1FG5 N;  3N9W A;  1FWY A;  1H5S D;  5EJZ A;  4NAL A;  1WT2 A;  2VXM A;  4HO8 A;  1O7O A;  1G3L A;  1LZI A;  3I0F A;  2RJ0 A;  2JCK A;  1FRW A;  2D0J A;  1O0R A;  2BO6 A;  3OGZ A;  4G3Q A;  1ZIZ A;  1FZW A;  1VPA A;  1ZI5 A;  2XMH A;  1OMZ A;  1LL3 A;  1LL0 A;  3I0D A;  5DDV A;  1H5R A;  1NF5 B;  4D0Z A;  2V0H A;  1HJL A;  1O23 B;  4J18 A;  4AYL A;  3JTJ A;  2W0W A;  4CJC A;  1LZ7 A;  3I0C A;  1JVG A;  1VGU A;  3SXD A;  2RJ5 A;  3TZT A;  5C4F A;  4D11 A;  1W55 A;  1WT1 A;  1ZCV A;  1H3M A;  2RJ6 A;  1GWW A;  3OH3 A;  4G3P A;  3I0I X;  3LW6 A;  1JYK A;  1ON8 A;  4Y7U A;  1VM8 A;  2BO7 A;  1H5S A;  1VH1 A;  3CKN A;  1G0R A;  1G93 A;  1H5R B;  3K8E A;  1FGG A;  1VZT A;  3V0P A;  2WAW A;  1GQC A;  1H7L A;  4FRB A;  4ECM A;  4HO5 A;  1INI A;  5CMI A;  3F1C A;  4FRH A;  4MYB A;  4EEO A;  1WSZ A;  2PGY A;  2AEC A;  2JCO A;  2FYC B;  1ZJ0 A;  3POL A;  1ZJ1 A;  4M2B A;  1LZ0 A;  2ZU7 A;  3EE5 A;  4R7P A;  4IRP A;  4Y64 A;  4HG6 A;  1H5S B;  4EEG A;  2D7I A;  3T7O A;  5IDS A;  4KC4 A;  5AJO A;  1V82 A;  4DDZ A;  4Y6N A;  1MC3 A;  5C49 A;  3SXG A;  4JD0 A;  3IOI A;  2WVL A;  4HO4 A;  1VGT A;  2RIZ A;  3CKO A;  3PNN A;  4MND A;  5CMH A;  3V0M A;  4HO9 A;  5C1H A;  4XWI A;  1WT3 A;  2Y4J A;  1E5K A;  4FRL A;  5AJN A;  3OAM A;  2P72 A;  4FRQ A;  4YS8 A;  1GX0 A;  2VFZ A;  2JCJ A;  3CKQ A;  2BO8 A;  3OH1 A;  1ZI1 A;  2WEE A;  1ZJP A;  3CKJ A;  5C4C A;  1HV9 A;  3I0E A;  1H7F A;  1MP4 A;  2OI7 A;  5EJ1 A;  5CMG X;  1H7G A;  4Y7F A;  2RIX A;  1W77 A;  1NWG B;  1ZCT A;  2YC3 A;  3F1Y A;  2AES A;  2E3D A;  5L6S A;  1V84 A;  2YQS A;  3U2X A;  4M2A A;  3SX5 A;  2FYD B;  2PA4 A;  4Y6U A;  4D0T A;  2VXL A;  5C1G A;  2VSI A;  2XME A;  2ZU8 A;  5C8R A;  2YQH A;  1NMM B;  5FU0 A;  5C47 A;  3IOJ A;  4HCQ A;  3FWW A;  1H4E A;  1VIC A;  1TW1 A;  5C4B A;  2VS5 A;  1TZF A;  4G3S A;  1S4N A;  3OKR A;  3SX3 A;  4DE7 A;  2FY7 A;  2ICX A;  2QH5 A;  5C3B A;  5IFY A;  1MP5 A;  3FOQ A;  2AE7 A;  2FFV A;  3BRK X;  3RMV A;  1GWV A;  3CKV A;  2OEF A;  1Z90 A;  2AM4 A;  3KIA A;  2AM3 A;  3R2W A;  2RIT A;  5L6V A;  2OEG A;  1H4D A;  2MZB A;  5J49 A;  4FRP A;  3U0X A;  2WE9 A;  3SXC A;  1R7V A;  4IRQ A;  4AAW A;  2AGD A;  4ASJ A;  2X5S A;  1S4P A;  3D5N A;  4B3U A;  1G95 A;  2YCM A;  3V0Q A;  2Q4J A;  3Q80 A;  1SS9 A;  4Y62 A;  2Y7A A;  1EYR A;  1VGW A;  4FRD A;  1G97 A;  1HJJ A;  2NXV A;  3U0Y A;  3SXB A;  4ARW A;  2GGQ A;  3CU0 A;  2RJ9 A;  3OH4 A;  5C3A A;  5C4D A;  3SX8 A;  2JCL A;  3OH2 A;  1LL2 A;  2BO4 A;  2QGI A;  3Q7U A;  2DPW A;  1R7Y A;  2Y4L A;  1O7Q A;  4AC3 A;  1ZDG A;  4P02 A;  1G23 A;  4KPZ A;  1FXO A;  3V0L A;  4HO2 A;  1ZHJ A;  3V91 A;  5C48 A;  3I0G A;  5IDT A;  1FR8 A;  3HL3 A;  2E8B A;  1VZX A;  1LZJ A;  1H5T A;  4HO0 A;  4C2S A;  1ZCU A;  1I52 A;  1XZ6 A;  1H7E A;  2PGV A;  1ON6 A;  4FRO A;  3ZLK A;  1FR9 A;  4B4M A;  1QGS A;  3BCV A;  2Y4K A;  5EIY A;  1VGZ A;  4B2W A;  2O1F A;  1NKH B;  1GX4 A;  5FTV A;  1ZDF A;  4FRA A;  4HO6 A;  1ZJ2 A;  5AJP A;  4BMA A;  1TVY A;  1VH3 A;  2YQJ A;  1R7X A;  1IIN A;  4P00 A;  2FYB A;  1G2V A;  4Y7T A;  4FRM A;  3E25 A;  2V0L A;  2P73 A;  1XHB A;  3I0H A;  1WVC A;  1KWS A;  4GBP A;  4EE5 A;  1G9R A;  1NQI B;  1VZU A;  4EEA A;  4G87 A;  2WVM A;  4FRE A;  5CQL X;  2Y4M A;  3Q4S A;  1H5T B;  2P6W A;  1NHE B;  4EVW A;  4Y9X A;  1GA8 A;  5CQP A;  1ZI3 A;  2I7B A;  3RMW A;  2X65 A;  2AM5 A;  3CGX A;  3K8D A;  3V8Y A;  4L41 C;  4KQL A;  5HS2 A;  1JV1 A;  4ASY A;  3DJ4 A;  2I5K A;  3O3P A;  3V0O A;  3DUV A;  2A8W A; 
#chains in the Genus database with same CATH topology
 3D8V A;  1W57 A;  5CMJ A;  2Y6P A;  1FGX A;  2APC A;  5C36 A;  1QG8 A;  4KC1 A;  4LW6 A;  4D48 A;  2XWM A;  2ICY A;  5FU8 A;  2XWN A;  1EZI A;  3V8Z A;  3V90 A;  4EEM A;  1FO8 A;  1R81 A;  4FCU A;  1HM8 A;  3GUE A;  1JYL A;  2OI6 A;  3OC9 A;  4FQW A;  2XWL A;  4DEC A;  2VS3 A;  2C0N A;  2Z87 A;  5FUH A;  5CQM X;  2WVK A;  2RJ4 A;  1H7T A;  4KC2 A;  3U2W A;  4Y63 A;  5I1F A;  4K6R A;  1JVD A;  3I0L A;  2FFU A;  2AH9 A;  2UX8 A;  3OH0 A;  4AYJ A;  1GQ9 A;  2RIY A;  4KRV A;  5C1L A;  3PKP A;  2A8U A;  4FCE A;  3IOH A;  1IIM A;  5CQO A;  3QVB A;  3JUJ A;  3USQ A;  3TQD A;  1JV3 A;  2Z86 A;  4KT7 A;  5C4E A;  4LW3 A;  3RSB A;  4JIS A;  4CJB A;  3SXA A;  4KNR A;  1INJ A;  5FYE A;  2PX7 A;  5D91 A;  2O1G A;  2QKX A;  2VD4 A;  1H7Q A;  3R3I A;  1G1L A;  1R82 A;  3NGW A;  4ZDQ A;  2GGO A;  2I5E A;  4EE4 A;  4HO3 A;  4CVH A;  1PZY B;  3D98 A;  1TW5 A;  2RJ7 A;  2VSH A;  2RJ8 A;  1H4C A;  1YP3 A;  1ZI4 A;  3U2U A;  2FYA A;  2OI5 A;  5FTS A;  2W0V A;  1WT0 A;  3ST8 A;  4B5B A;  2X5Z A;  2YC5 A;  3ZGF A;  1OMX A;  1HM9 A;  5DDT A;  5CMF X;  4UEG A;  3SXE A;  4E1K A;  4B4G A;  2V0K A;  1FXJ A;  1ZCY A;  4CJ8 A;  3I0J A;  3PKQ A;  1OQM B;  5FV9 A;  3T7M A;  5C38 A;  2J0B A;  2YQC A;  4M4K A;  1LVW A;  1R7U A;  4D11 C;  1H7H A;  4NAI A;  5C3D A;  1V83 A;  4EE3 A;  1MP3 A;  3ZF8 A;  2RJ1 A;  3SX7 A;  3DK5 A;  4KPX A;  3V0N A;  4BQH A;  1ZJ3 A;  4KXO A;  1K4V A;  1QGQ A;  1HM0 A;  2D7R A;  5JQQ A;  4HOC A;  1H5S C;  4M28 A;  2O1H A;  4B4B A;  4Y7V A;  3U2T A;  5CQN X;  4NAK A;  2ZU9 A;  1YP2 A;  3SPT A;  3ZGG A;  3ZLL A;  1S4O A;  4B2X A;  1PZT A;  1ZJO A;  4B42 A;  5BXC A;  1YRO B;  1FOA A;  1G8O A;  4NAN A;  3U2V A;  2WGZ A;  1YP4 A;  3USR A;  1FO9 A;  1R7T A;  3I0K A;  3JUK A;  1QWJ A;  1R80 A;  2J0A A;  4KNX A;  2CU2 A;  2YES A;  3T7N A;  2X60 A;  4Y7G A;  4O6M A;  2VS4 A;  2V0J A;  3E26 A;  2V0I A;  1FG5 N;  3N9W A;  5D92 A;  1FWY A;  1H5S D;  5EJZ A;  4NAL A;  1WT2 A;  2VXM A;  4HO8 A;  1O7O A;  1G3L A;  1LZI A;  3I0F A;  2RJ0 A;  2JCK A;  1FRW A;  2D0J A;  1O0R A;  2BO6 A;  3OGZ A;  4G3Q A;  1ZIZ A;  1FZW A;  1VPA A;  1ZI5 A;  2XMH A;  1OMZ A;  1LL3 A;  1LL0 A;  3I0D A;  5DDV A;  1H5R A;  1NF5 B;  4D0Z A;  2V0H A;  1HJL A;  1O23 B;  4J18 A;  4AYL A;  3JTJ A;  2W0W A;  4CJC A;  1LZ7 A;  3I0C A;  1JVG A;  1VGU A;  4FIY A;  3SXD A;  2RJ5 A;  3TZT A;  5C4F A;  4D11 A;  1W55 A;  1WT1 A;  1ZCV A;  1H3M A;  2RJ6 A;  1GWW A;  3OH3 A;  4G3P A;  3I0I X;  3LW6 A;  1JYK A;  1ON8 A;  4Y7U A;  1VM8 A;  2BO7 A;  1H5S A;  1VH1 A;  3CKN A;  1G0R A;  1G93 A;  1H5R B;  3K8E A;  1FGG A;  1VZT A;  3V0P A;  2WAW A;  1GQC A;  1H7L A;  4FRB A;  4ECM A;  4HO5 A;  1INI A;  5CMI A;  3F1C A;  4FRH A;  4MYB A;  4EEO A;  1WSZ A;  2PGY A;  2AEC A;  2JCO A;  2FYC B;  1ZJ0 A;  3POL A;  1ZJ1 A;  4M2B A;  1LZ0 A;  2ZU7 A;  3EE5 A;  4R7P A;  4IRP A;  4Y64 A;  4HG6 A;  1H5S B;  4EEG A;  2D7I A;  3T7O A;  5IDS A;  4KC4 A;  5AJO A;  1V82 A;  4DDZ A;  4Y6N A;  1MC3 A;  5C49 A;  3SXG A;  4JD0 A;  3IOI A;  2WVL A;  4HO4 A;  1VGT A;  2RIZ A;  3CKO A;  3PNN A;  4MND A;  5CMH A;  3V0M A;  4HO9 A;  5C1H A;  4XWI A;  1WT3 A;  2Y4J A;  1E5K A;  4FRL A;  5AJN A;  3OAM A;  2P72 A;  4FRQ A;  4YS8 A;  1GX0 A;  2VFZ A;  2JCJ A;  3CKQ A;  2BO8 A;  3OH1 A;  1ZI1 A;  2WEE A;  1ZJP A;  3CKJ A;  5C4C A;  1HV9 A;  3I0E A;  1H7F A;  1MP4 A;  2OI7 A;  5EJ1 A;  5CMG X;  1H7G A;  4Y7F A;  2RIX A;  1W77 A;  1NWG B;  1ZCT A;  2YC3 A;  3F1Y A;  2AES A;  2E3D A;  5L6S A;  1V84 A;  2YQS A;  3U2X A;  4M2A A;  3SX5 A;  2FYD B;  2PA4 A;  4Y6U A;  4MIX A;  4D0T A;  2VXL A;  5C1G A;  2VSI A;  2XME A;  2ZU8 A;  5C8R A;  2YQH A;  1NMM B;  5FU0 A;  5C47 A;  3IOJ A;  4HCQ A;  3FWW A;  1H4E A;  1VIC A;  1TW1 A;  2VK9 A;  5C4B A;  2VS5 A;  1TZF A;  4G3S A;  1S4N A;  3OKR A;  3SX3 A;  4DE7 A;  2FY7 A;  2ICX A;  2QH5 A;  4O6N A;  5C3B A;  5IFY A;  1MP5 A;  3FOQ A;  2AE7 A;  2FFV A;  3BRK X;  3RMV A;  1GWV A;  3CKV A;  2OEF A;  1Z90 A;  2AM4 A;  3KIA A;  2AM3 A;  3R2W A;  2RIT A;  5L6V A;  2OEG A;  1H4D A;  2MZB A;  5J49 A;  4FRP A;  3U0X A;  2WE9 A;  3SXC A;  1R7V A;  4IRQ A;  4AAW A;  2AGD A;  4ASJ A;  2X5S A;  1S4P A;  3D5N A;  4B3U A;  1G95 A;  2YCM A;  3V0Q A;  2Q4J A;  3Q80 A;  1SS9 A;  4Y62 A;  2Y7A A;  1EYR A;  1VGW A;  4FRD A;  1G97 A;  1HJJ A;  2NXV A;  3U0Y A;  3SXB A;  4ARW A;  2GGQ A;  3CU0 A;  2RJ9 A;  3OH4 A;  5C3A A;  5C4D A;  3SX8 A;  2JCL A;  3OH2 A;  1LL2 A;  2BO4 A;  2QGI A;  3Q7U A;  2DPW A;  1R7Y A;  2Y4L A;  1O7Q A;  4AC3 A;  1ZDG A;  4P02 A;  1G23 A;  4KPZ A;  1FXO A;  3V0L A;  4HO2 A;  1ZHJ A;  3V91 A;  5C48 A;  3I0G A;  5IDT A;  1FR8 A;  3HL3 A;  2E8B A;  1VZX A;  4Q7C A;  1LZJ A;  1H5T A;  4HO0 A;  4C2S A;  1ZCU A;  1I52 A;  1XZ6 A;  1H7E A;  2PGV A;  1ON6 A;  4FRO A;  3ZLK A;  1FR9 A;  4B4M A;  1QGS A;  3BCV A;  2Y4K A;  5EIY A;  1VGZ A;  4B2W A;  4FIX A;  2O1F A;  1NKH B;  1GX4 A;  5FTV A;  1ZDF A;  4FRA A;  4HO6 A;  1ZJ2 A;  5AJP A;  4BMA A;  1TVY A;  1VH3 A;  2YQJ A;  1R7X A;  1IIN A;  4P00 A;  2FYB A;  1G2V A;  4Y7T A;  4FRM A;  3E25 A;  2V0L A;  2P73 A;  1XHB A;  3I0H A;  1WVC A;  1KWS A;  4GBP A;  4EE5 A;  1G9R A;  1NQI B;  1VZU A;  4EEA A;  4G87 A;  2WVM A;  4FRE A;  5CQL X;  2Y4M A;  3Q4S A;  1H5T B;  2P6W A;  1NHE B;  4EVW A;  4Y9X A;  1GA8 A;  5CQP A;  1ZI3 A;  2I7B A;  3RMW A;  2X65 A;  2AM5 A;  3CGX A;  3K8D A;  3V8Y A;  4L41 C;  4KQL A;  5HS2 A;  1JV1 A;  4ASY A;  3DJ4 A;  2I5K A;  3O3P A;  3V0O A;  3DUV A;  2A8W A; 
#chains in the Genus database with same CATH homology
 3D8V A;  1W57 A;  5CMJ A;  2Y6P A;  1FGX A;  2APC A;  5C36 A;  1QG8 A;  4KC1 A;  4LW6 A;  4D48 A;  2XWM A;  2ICY A;  5FU8 A;  2XWN A;  1EZI A;  3V8Z A;  3V90 A;  4EEM A;  1FO8 A;  1R81 A;  4FCU A;  1HM8 A;  3GUE A;  1JYL A;  2OI6 A;  3OC9 A;  4FQW A;  2XWL A;  4DEC A;  2VS3 A;  2C0N A;  2Z87 A;  5FUH A;  5CQM X;  2WVK A;  2RJ4 A;  1H7T A;  4KC2 A;  3U2W A;  4Y63 A;  5I1F A;  4K6R A;  1JVD A;  3I0L A;  2FFU A;  2AH9 A;  2UX8 A;  3OH0 A;  4AYJ A;  1GQ9 A;  2RIY A;  4KRV A;  5C1L A;  3PKP A;  2A8U A;  4FCE A;  3IOH A;  1IIM A;  5CQO A;  3QVB A;  3JUJ A;  3USQ A;  3TQD A;  1JV3 A;  2Z86 A;  4KT7 A;  5C4E A;  4LW3 A;  3RSB A;  4JIS A;  4CJB A;  3SXA A;  4KNR A;  1INJ A;  5FYE A;  2PX7 A;  5D91 A;  2O1G A;  2QKX A;  2VD4 A;  1H7Q A;  3R3I A;  1G1L A;  1R82 A;  3NGW A;  4ZDQ A;  2GGO A;  2I5E A;  4EE4 A;  4HO3 A;  4CVH A;  1PZY B;  3D98 A;  1TW5 A;  2RJ7 A;  2VSH A;  2RJ8 A;  1H4C A;  1YP3 A;  1ZI4 A;  3U2U A;  2FYA A;  2OI5 A;  5FTS A;  2W0V A;  1WT0 A;  3ST8 A;  4B5B A;  2X5Z A;  2YC5 A;  3ZGF A;  1OMX A;  1HM9 A;  5DDT A;  5CMF X;  4UEG A;  3SXE A;  4E1K A;  4B4G A;  2V0K A;  1FXJ A;  1ZCY A;  4CJ8 A;  3I0J A;  3PKQ A;  1OQM B;  5FV9 A;  3T7M A;  5C38 A;  2J0B A;  2YQC A;  4M4K A;  1LVW A;  1R7U A;  4D11 C;  1H7H A;  4NAI A;  5C3D A;  1V83 A;  4EE3 A;  1MP3 A;  3ZF8 A;  2RJ1 A;  3SX7 A;  3DK5 A;  4KPX A;  3V0N A;  4BQH A;  1ZJ3 A;  4KXO A;  1K4V A;  1QGQ A;  1HM0 A;  2D7R A;  5JQQ A;  4HOC A;  1H5S C;  4M28 A;  2O1H A;  4B4B A;  4Y7V A;  3U2T A;  5CQN X;  4NAK A;  2ZU9 A;  1YP2 A;  3SPT A;  3ZGG A;  3ZLL A;  1S4O A;  4B2X A;  1PZT A;  1ZJO A;  4B42 A;  5BXC A;  1YRO B;  1FOA A;  1G8O A;  4NAN A;  3U2V A;  2WGZ A;  1YP4 A;  3USR A;  1FO9 A;  1R7T A;  3I0K A;  3JUK A;  1QWJ A;  1R80 A;  2J0A A;  4KNX A;  2CU2 A;  2YES A;  3T7N A;  2X60 A;  4Y7G A;  4O6M A;  2VS4 A;  2V0J A;  3E26 A;  2V0I A;  1FG5 N;  3N9W A;  5D92 A;  1FWY A;  1H5S D;  5EJZ A;  4NAL A;  1WT2 A;  2VXM A;  4HO8 A;  1O7O A;  1G3L A;  1LZI A;  3I0F A;  2RJ0 A;  2JCK A;  1FRW A;  2D0J A;  1O0R A;  2BO6 A;  3OGZ A;  4G3Q A;  1ZIZ A;  1FZW A;  1VPA A;  1ZI5 A;  2XMH A;  1OMZ A;  1LL3 A;  1LL0 A;  3I0D A;  5DDV A;  1H5R A;  1NF5 B;  4D0Z A;  2V0H A;  1HJL A;  1O23 B;  4J18 A;  4AYL A;  3JTJ A;  2W0W A;  4CJC A;  1LZ7 A;  3I0C A;  1JVG A;  1VGU A;  4FIY A;  3SXD A;  2RJ5 A;  3TZT A;  5C4F A;  4D11 A;  1W55 A;  1WT1 A;  1ZCV A;  1H3M A;  2RJ6 A;  1GWW A;  3OH3 A;  4G3P A;  3I0I X;  3LW6 A;  1JYK A;  1ON8 A;  4Y7U A;  1VM8 A;  2BO7 A;  1H5S A;  1VH1 A;  3CKN A;  1G0R A;  1G93 A;  1H5R B;  3K8E A;  1FGG A;  1VZT A;  3V0P A;  2WAW A;  1GQC A;  1H7L A;  4FRB A;  4ECM A;  4HO5 A;  1INI A;  5CMI A;  3F1C A;  4FRH A;  4MYB A;  4EEO A;  1WSZ A;  2PGY A;  2AEC A;  2JCO A;  2FYC B;  1ZJ0 A;  3POL A;  1ZJ1 A;  4M2B A;  1LZ0 A;  2ZU7 A;  3EE5 A;  4R7P A;  4IRP A;  4Y64 A;  4HG6 A;  1H5S B;  4EEG A;  2D7I A;  3T7O A;  5IDS A;  4KC4 A;  5AJO A;  1V82 A;  4DDZ A;  4Y6N A;  1MC3 A;  5C49 A;  3SXG A;  4JD0 A;  3IOI A;  2WVL A;  4HO4 A;  1VGT A;  2RIZ A;  3CKO A;  3PNN A;  4MND A;  5CMH A;  3V0M A;  4HO9 A;  5C1H A;  4XWI A;  1WT3 A;  2Y4J A;  1E5K A;  4FRL A;  5AJN A;  3OAM A;  2P72 A;  4FRQ A;  4YS8 A;  1GX0 A;  2VFZ A;  2JCJ A;  3CKQ A;  2BO8 A;  3OH1 A;  1ZI1 A;  2WEE A;  1ZJP A;  3CKJ A;  5C4C A;  1HV9 A;  3I0E A;  1H7F A;  1MP4 A;  2OI7 A;  5EJ1 A;  5CMG X;  1H7G A;  4Y7F A;  2RIX A;  1W77 A;  1NWG B;  1ZCT A;  2YC3 A;  3F1Y A;  2AES A;  2E3D A;  5L6S A;  1V84 A;  2YQS A;  3U2X A;  4M2A A;  3SX5 A;  2FYD B;  2PA4 A;  4Y6U A;  4MIX A;  4D0T A;  2VXL A;  5C1G A;  2VSI A;  2XME A;  2ZU8 A;  5C8R A;  2YQH A;  1NMM B;  5FU0 A;  5C47 A;  3IOJ A;  4HCQ A;  3FWW A;  1H4E A;  1VIC A;  1TW1 A;  2VK9 A;  5C4B A;  2VS5 A;  1TZF A;  4G3S A;  1S4N A;  3OKR A;  3SX3 A;  4DE7 A;  2FY7 A;  2ICX A;  2QH5 A;  4O6N A;  5C3B A;  5IFY A;  1MP5 A;  3FOQ A;  2AE7 A;  2FFV A;  3BRK X;  3RMV A;  1GWV A;  3CKV A;  2OEF A;  1Z90 A;  2AM4 A;  3KIA A;  2AM3 A;  3R2W A;  2RIT A;  5L6V A;  2OEG A;  1H4D A;  2MZB A;  5J49 A;  4FRP A;  3U0X A;  2WE9 A;  3SXC A;  1R7V A;  4IRQ A;  4AAW A;  2AGD A;  4ASJ A;  2X5S A;  1S4P A;  3D5N A;  4B3U A;  1G95 A;  2YCM A;  3V0Q A;  2Q4J A;  3Q80 A;  1SS9 A;  4Y62 A;  2Y7A A;  1EYR A;  1VGW A;  4FRD A;  1G97 A;  1HJJ A;  2NXV A;  3U0Y A;  3SXB A;  4ARW A;  2GGQ A;  3CU0 A;  2RJ9 A;  3OH4 A;  5C3A A;  5C4D A;  3SX8 A;  2JCL A;  3OH2 A;  1LL2 A;  2BO4 A;  2QGI A;  3Q7U A;  2DPW A;  1R7Y A;  2Y4L A;  1O7Q A;  4AC3 A;  1ZDG A;  4P02 A;  1G23 A;  4KPZ A;  1FXO A;  3V0L A;  4HO2 A;  1ZHJ A;  3V91 A;  5C48 A;  3I0G A;  5IDT A;  1FR8 A;  3HL3 A;  2E8B A;  1VZX A;  4Q7C A;  1LZJ A;  1H5T A;  4HO0 A;  4C2S A;  1ZCU A;  1I52 A;  1XZ6 A;  1H7E A;  2PGV A;  1ON6 A;  4FRO A;  3ZLK A;  1FR9 A;  4B4M A;  1QGS A;  3BCV A;  2Y4K A;  5EIY A;  1VGZ A;  4B2W A;  4FIX A;  2O1F A;  1NKH B;  1GX4 A;  5FTV A;  1ZDF A;  4FRA A;  4HO6 A;  1ZJ2 A;  5AJP A;  4BMA A;  1TVY A;  1VH3 A;  2YQJ A;  1R7X A;  1IIN A;  4P00 A;  2FYB A;  1G2V A;  4Y7T A;  4FRM A;  3E25 A;  2V0L A;  2P73 A;  1XHB A;  3I0H A;  1WVC A;  1KWS A;  4GBP A;  4EE5 A;  1G9R A;  1NQI B;  1VZU A;  4EEA A;  4G87 A;  2WVM A;  4FRE A;  5CQL X;  2Y4M A;  3Q4S A;  1H5T B;  2P6W A;  1NHE B;  4EVW A;  4Y9X A;  1GA8 A;  5CQP A;  1ZI3 A;  2I7B A;  3RMW A;  2X65 A;  2AM5 A;  3CGX A;  3K8D A;  3V8Y A;  4L41 C;  4KQL A;  5HS2 A;  1JV1 A;  4ASY A;  3DJ4 A;  2I5K A;  3O3P A;  3V0O A;  3DUV A;  2A8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...