2PGVA

Gtb c209a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
271
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRMEMISDFCERRFLSEVDYLVAVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title The effect of heavy atoms on the conformation of the active-site polypeptide loop in human ABO(H) blood-group glycosyltransferase B.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 271
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2pgvA00
5BXCA 2QH5A 3SXDA 3ZLLA 1LL3A 1OMXA 2UX8A 1R7UA 3D5NA 1G1LA 2VFZA 2JCLA 2WE9A 5C1LA 1G2VA 2FYCB 4KPZA 4BQHA 2RJ1A 2P6WA 4HO9A 4KQLA 4P00A 5I1FA 1YP3A 3Q80A 1H7FA 4EE4A 3I0JA 3U0YA 1ZJ0A 4G3SA 4KNXA 2JCKA 1VGZA 1ZI3A 2Y4MA 3V0OA 2ZU8A 4CJBA 1JYKA 3SXBA 1H5RA 4KC2A 1VGWA 2A8UA 2PGVA 1LVWA 5C38A 3ZGGA 1YP2A 3U2VA 3I0HA 1FXJA 5CQNX 4ECMA 1TVYA 2YQHA 5CMGX 5CQOA 3BCVA 2QKXA 4Y62A 3USQA 1WT0A 2GGQA 1H5SC 1H5SA 5AJOA 2E3DA 1VICA 3PKPA 2ICYA 3I0KA 1WVCA 3U2TA 2V0HA 3RSBA 4J18A 1O23B 1H5SD 2V0LA 5EJ1A 3OKRA 4HO6A 4FREA 4MNDA 4FRPA 2VXLA 4KXOA 1G97A 2OI5A 4AYLA 1VH1A 1XZ6A 1LL0A 1G23A 3Q4SA 1H7HA 2AGDA 4HO3A 1R81A 5AJPA 5C3AA 1FGXA 3I0DA 1VZUA 4LW3A 1H7LA 1JV1A 1V83A 4R7PA 1W55A 3V90A 3V91A 2O1GA 4M2BA 4KPXA 1ZI5A 4Y7VA 4D11C 2VS4A 1MP5A 3OC9A 2VSHA 4Y7TA 3TZTA 1OMZA 1H7TA 2X65A 4K6RA 3LW6A 2RIZA 2FYDB 3FWWA 1HM0A 2RJ8A 4L41C 2YC3A 2QGIA 2A8WA 2XMEA 5J49A 3DK5A 4M2AA 3PKQA 3QVBA 1W77A 4B5BA 1WT1A 2FY7A 2YQJA 1ZI4A 2V0JA 4C2SA 2D7RA 2X5SA 3USRA 1G8OA 1GWVA 1JV3A 1WSZA 3CU0A 3V0LA 5L6SA 1EZIA 2XWLA 3POLA 1R82A 2XWMA 5CMJA 1EYRA 3IOHA 2WVMA 1HJJA 3V0QA 1LZIA 1YROB 3SXCA 1GQCA 2YC5A 2E8BA 4ZDQA 1G9RA 5C4CA 2YQCA 5C48A 2WEEA 2NXVA 4B2WA 3I0IX 1NKHB 1HJLA 1PZYB 1ZCUA 1FG5N 1V82A 3EE5A 4D0ZA 1LL2A 5C4DA 4B4BA 4M4KA 4Y63A 5IDTA 5C4FA 1NHEB 2WVLA 2AE7A 4XWIA 1O7QA 4FCUA 3ZLKA 1ZJPA 1FXOA 4EE5A 2CU2A 1ZHJA 2OI7A 1H5TA 3TQDA 3V8YA 3RMWA 1GX0A 4ASJA 2FYAA 1SS9A 2GGOA 2XWNA 3R2WA 2O1FA 2Y7AA 4EEGA 4FRQA 1FR8A 1QG8A 2P72A 1IIMA 3SX8A 4GBPA 2AM4A 5FYEA 3T7MA 1H5RB 1I52A 4HOCA 4P02A 2MZBA 4KNRA 1R7XA 1ZJOA 4KRVA 2FFUA 3U2UA 2Z87A 4Y7FA 1ZJ3A 3CKJA 4EVWA 1H5SB 3CKNA 4D0TA 2RIYA 1GA8A 5C49A 2RJ9A 4NAKA 1FO8A 3V0MA 1S4OA 4FRHA 1KWSA 3SXGA 5FTSA 4E1KA 3V0PA 1Z90A 3V8ZA 4D11A 4MYBA 2JCOA 2DPWA 3V0NA 2Y4LA 2Y6PA 2WGZA 1S4NA 1K4VA 1LZJA 1R7TA 3ZF8A 1ZCTA 3I0CA 2VS3A 2O1HA 1VGTA 3I0LA 4LW6A 4D48A 2D7IA 4Y64A 4HO5A 4BMAA 4KC1A 4DDZA 3NGWA 1E5KA 5EIYA 5C1GA 3CKQA 3I0GA 4KC4A 5C47A 4FROA 2BO8A 2PGYA 1INJA 1GX4A 2RJ4A 3HL3A 1MP3A 1NWGB 3E26A 2I5KA 5L6VA 5FU8A 4EEMA 4FRBA 4FRLA 3OH2A 3D98A 1G0RA 5CMIA 1QWJA 5C8RA 3T7NA 4Y9XA 3RMVA 4B3UA 2X5ZA 3U0XA 2Z86A 4B4GA 1GWWA 1ZDFA 4G3PA 3CGXA 1OQMB 3JTJA 2AESA 3OGZA 1TW1A 5C36A 1HV9A 2ICXA 2P73A 3OH3A 1FO9A 1ZDGA 4HG6A 3T7OA 4DE7A 4CVHA 4KT7A 1JVGA 4YS8A 1R7YA 2OEFA 4HO2A 5CQPA 5C4BA 5C3DA 3SX3A 1G93A 2YCMA 2YESA 2ZU7A 4UEGA 5EJZA 5FTVA 4HO4A 4AAWA 3PNNA 5FV9A 2APCA 1R80A 5CQLX 4ARWA 2PA4A 5C3BA 1ZIZA 2ZU9A 1GQ9A 5DDTA 4EEOA 1WT2A 1JVDA 2FYBA 1WT3A 2VD4A 1YP4A 3ZGFA 4NANA 3I0EA 1VH3A 1HM9A 1ZCVA 3E25A 1MC3A 1TZFA 2AECA 2FFVA 5CQMX 1LZ7A 4FRDA 3DUVA 4ASYA 1VGUA 5C4EA 4AC3A 3N9WA 3Q7UA 1S4PA 1ZI1A 4JISA 4M28A 1H5TB 2AH9A 2JCJA 2RJ6A 2OEGA 2Y4JA 2VS5A 2BO4A 3U2WA 3D8VA 5CMHA 2YQSA 1QGQA 1ON6A 1H4EA 2Q4JA 3SXAA 2D0JA 1QGSA 2VXMA 1FRWA 3JUKA 2V0KA 5IDSA 3FOQA 4IRPA 2RJ7A 1TW5A 3SXEA 3SX5A 3R3IA 3F1YA 2W0VA 4B2XA 4FCEA 2WVKA 4JD0A 4NAIA 1W57A 4FRAA 1VZTA 2Y4KA 2RJ5A 5JQQA 1NF5B 3OH4A 1JYLA 1H7EA 4DECA 2RITA 2I7BA 2V0IA 1PZTA 1FGGA 1NMMB 2PX7A 1IINA 4G87A 3OAMA 4NALA 3K8DA 4Y6NA 3CKVA 3F1CA 2WAWA 2RJ0A 3KIAA 4CJCA 4EEAA 1G95A 1VM8A 2W0WA 4Y7UA 2X60A 3JUJA 1ZJ2A 2AM5A 4G3QA 5DDVA 2VSIA 1H7QA 4HO8A 3OH1A 2AM3A 5C1HA 3GUEA 3O3PA 4HO0A 3CKOA 5CMFX 1FOAA 1H3MA 4B4MA 3IOIA 1H4DA 3OH0A 1R7VA 1ZCYA 4FQWA 4FRMA 4HCQA 1V84A 4Y6UA 1VZXA 2BO6A 2BO7A 3BRKX 3SX7A 2I5EA 5AJNA 4B42A 4Y7GA 2RIXA 3I0FA 5HS2A 1O0RA 4AYJA 1MP4A 1H7GA 4IRQA 5FU0A 4EE3A 5IFYA 1ZJ1A 3U2XA 1VPAA 1XHBA 5FUHA 2OI6A 2XMHA 3K8EA 1LZ0A 3DJ4A 1FZWA 4CJ8A 3SPTA 1H4CA 1HM8A 3IOJA 3ST8A 1O7OA 1ON8A 1FWYA 1G3LA 1NQIB 1FR9A 1INIA
chains in the Genus database with same CATH superfamily
5BXCA 2QH5A 3SXDA 3ZLLA 1LL3A 1OMXA 2UX8A 1R7UA 3D5NA 4O6NA 1G1LA 2VFZA 2JCLA 4FIYA 2WE9A 5C1LA 1G2VA 2FYCB 4KPZA 4BQHA 2RJ1A 2P6WA 4HO9A 4KQLA 4P00A 5I1FA 1YP3A 3Q80A 1H7FA 4EE4A 3I0JA 3U0YA 1ZJ0A 4G3SA 4KNXA 2JCKA 1VGZA 1ZI3A 2Y4MA 3V0OA 2ZU8A 4CJBA 1JYKA 3SXBA 1H5RA 4KC2A 1VGWA 2A8UA 2PGVA 1LVWA 5C38A 3ZGGA 1YP2A 3U2VA 3I0HA 1FXJA 5CQNX 4ECMA 1TVYA 2YQHA 5CMGX 5CQOA 3BCVA 2QKXA 4Y62A 3USQA 1WT0A 2GGQA 1H5SC 1H5SA 5AJOA 2E3DA 1VICA 3PKPA 2ICYA 3I0KA 1WVCA 3U2TA 2V0HA 3RSBA 4J18A 2VK9A 1O23B 1H5SD 2V0LA 5EJ1A 3OKRA 4HO6A 4FREA 4MNDA 4FRPA 2VXLA 4KXOA 1G97A 2OI5A 4AYLA 1VH1A 1XZ6A 1LL0A 1G23A 3Q4SA 1H7HA 2AGDA 4HO3A 1R81A 5AJPA 5C3AA 1FGXA 3I0DA 1VZUA 4LW3A 1H7LA 1JV1A 1V83A 4R7PA 1W55A 3V90A 3V91A 2O1GA 4M2BA 4KPXA 1ZI5A 4Y7VA 4D11C 2VS4A 1MP5A 3OC9A 2VSHA 4Y7TA 3TZTA 1OMZA 1H7TA 2X65A 4K6RA 3LW6A 2RIZA 2FYDB 3FWWA 1HM0A 2RJ8A 4L41C 2YC3A 2QGIA 2A8WA 2XMEA 5J49A 3DK5A 4M2AA 3PKQA 3QVBA 1W77A 4B5BA 1WT1A 2FY7A 2YQJA 1ZI4A 2V0JA 4C2SA 2D7RA 2X5SA 3USRA 1G8OA 1GWVA 1JV3A 1WSZA 3CU0A 3V0LA 5L6SA 1EZIA 2XWLA 3POLA 4O6MA 1R82A 2XWMA 5CMJA 1EYRA 3IOHA 2WVMA 1HJJA 3V0QA 1LZIA 1YROB 3SXCA 1GQCA 2YC5A 2E8BA 4ZDQA 1G9RA 5C4CA 2YQCA 5C48A 2WEEA 2NXVA 4B2WA 3I0IX 1NKHB 1HJLA 1PZYB 1ZCUA 1FG5N 1V82A 3EE5A 4D0ZA 1LL2A 5C4DA 4B4BA 4M4KA 4Y63A 5IDTA 2C0NA 5C4FA 1NHEB 2WVLA 2AE7A 4XWIA 1O7QA 4FCUA 3ZLKA 1ZJPA 1FXOA 4EE5A 2CU2A 1ZHJA 2OI7A 1H5TA 3TQDA 3V8YA 3RMWA 1GX0A 4ASJA 2FYAA 1SS9A 2GGOA 2XWNA 3R2WA 2O1FA 2Y7AA 4EEGA 4FIXA 4FRQA 1FR8A 1QG8A 2P72A 1IIMA 3SX8A 4GBPA 2AM4A 5FYEA 3T7MA 1H5RB 1I52A 4HOCA 4P02A 2MZBA 4KNRA 1R7XA 1ZJOA 4KRVA 2FFUA 3U2UA 2Z87A 4Y7FA 1ZJ3A 3CKJA 4EVWA 1H5SB 3CKNA 4D0TA 2RIYA 1GA8A 5C49A 2RJ9A 4NAKA 1FO8A 3V0MA 1S4OA 2J0BA 4FRHA 1KWSA 3SXGA 5FTSA 4E1KA 3V0PA 1Z90A 3V8ZA 4D11A 4MYBA 2JCOA 2DPWA 3V0NA 2Y4LA 2Y6PA 2WGZA 1S4NA 1K4VA 1LZJA 1R7TA 3ZF8A 1ZCTA 5D91A 3I0CA 2VS3A 2O1HA 1VGTA 3I0LA 4LW6A 4D48A 2D7IA 4Y64A 4HO5A 4BMAA 4KC1A 4DDZA 3NGWA 1E5KA 5EIYA 5C1GA 3CKQA 3I0GA 4KC4A 5C47A 4FROA 2BO8A 4MIXA 2PGYA 1INJA 1GX4A 2RJ4A 3HL3A 1MP3A 1NWGB 3E26A 2I5KA 5L6VA 5FU8A 4EEMA 4FRBA 4FRLA 3OH2A 3D98A 1G0RA 5CMIA 1QWJA 5C8RA 3T7NA 4Y9XA 3RMVA 4B3UA 2X5ZA 3U0XA 2Z86A 4B4GA 1GWWA 1ZDFA 4G3PA 3CGXA 1OQMB 3JTJA 2AESA 3OGZA 1TW1A 5C36A 1HV9A 2ICXA 2P73A 3OH3A 1FO9A 1ZDGA 4HG6A 3T7OA 4DE7A 4CVHA 4KT7A 1JVGA 4YS8A 1R7YA 2OEFA 4HO2A 5CQPA 5C4BA 5C3DA 3SX3A 1G93A 2YCMA 2YESA 2ZU7A 4UEGA 5EJZA 5FTVA 4HO4A 4AAWA 3PNNA 5FV9A 2APCA 1R80A 5CQLX 4ARWA 2PA4A 5C3BA 1ZIZA 2ZU9A 1GQ9A 5DDTA 4EEOA 1WT2A 1JVDA 2FYBA 1WT3A 2VD4A 1YP4A 3ZGFA 4NANA 3I0EA 1VH3A 1HM9A 1ZCVA 3E25A 1MC3A 1TZFA 5D92A 2AECA 2FFVA 5CQMX 1LZ7A 4FRDA 3DUVA 4ASYA 1VGUA 5C4EA 4AC3A 3N9WA 3Q7UA 1S4PA 1ZI1A 4JISA 4M28A 1H5TB 2AH9A 2JCJA 2RJ6A 2OEGA 2Y4JA 2VS5A 2BO4A 3U2WA 3D8VA 5CMHA 2YQSA 1QGQA 1ON6A 1H4EA 2Q4JA 3SXAA 2D0JA 1QGSA 2VXMA 4Q7CA 1FRWA 3JUKA 2V0KA 5IDSA 3FOQA 4IRPA 2RJ7A 1TW5A 3SXEA 3SX5A 3R3IA 3F1YA 2W0VA 4B2XA 4FCEA 2WVKA 4JD0A 4NAIA 1W57A 4FRAA 1VZTA 2Y4KA 2RJ5A 5JQQA 1NF5B 3OH4A 1JYLA 1H7EA 4DECA 2RITA 2I7BA 2V0IA 2J0AA 1PZTA 1FGGA 1NMMB 2PX7A 1IINA 4G87A 3OAMA 4NALA 3K8DA 4Y6NA 3CKVA 3F1CA 2WAWA 2RJ0A 3KIAA 4CJCA 4EEAA 1G95A 1VM8A 2W0WA 4Y7UA 2X60A 3JUJA 1ZJ2A 2AM5A 4G3QA 5DDVA 2VSIA 1H7QA 4HO8A 3OH1A 2AM3A 5C1HA 3GUEA 3O3PA 4HO0A 3CKOA 5CMFX 1FOAA 1H3MA 4B4MA 3IOIA 1H4DA 3OH0A 1R7VA 1ZCYA 4FQWA 4FRMA 4HCQA 1V84A 4Y6UA 1VZXA 2BO6A 2BO7A 3BRKX 3SX7A 2I5EA 5AJNA 4B42A 4Y7GA 2RIXA 3I0FA 5HS2A 1O0RA 4AYJA 1MP4A 1H7GA 4IRQA 5FU0A 4EE3A 5IFYA 1ZJ1A 3U2XA 1VPAA 1XHBA 5FUHA 2OI6A 2XMHA 3K8EA 1LZ0A 3DJ4A 1FZWA 4CJ8A 3SPTA 1H4CA 1HM8A 3IOJA 3ST8A 1O7OA 1ON8A 1FWYA 1G3LA 1NQIB 1FR9A 1INIA
chains in the Genus database with same CATH topology
5BXCA 2QH5A 3SXDA 3ZLLA 1LL3A 1OMXA 2UX8A 1R7UA 3D5NA 4O6NA 1G1LA 2VFZA 2JCLA 4FIYA 2WE9A 5C1LA 1G2VA 2FYCB 4KPZA 4BQHA 2RJ1A 2P6WA 4HO9A 4KQLA 4P00A 5I1FA 1YP3A 3Q80A 1H7FA 4EE4A 3I0JA 3U0YA 1ZJ0A 4G3SA 4KNXA 2JCKA 1VGZA 1ZI3A 2Y4MA 3V0OA 2ZU8A 4CJBA 1JYKA 3SXBA 1H5RA 4KC2A 1VGWA 2A8UA 2PGVA 1LVWA 5C38A 3ZGGA 1YP2A 3U2VA 3I0HA 1FXJA 5CQNX 4ECMA 1TVYA 2YQHA 5CMGX 5CQOA 3BCVA 2QKXA 4Y62A 3USQA 1WT0A 2GGQA 1H5SC 1H5SA 5AJOA 2E3DA 1VICA 3PKPA 2ICYA 3I0KA 1WVCA 3U2TA 2V0HA 3RSBA 4J18A 2VK9A 1O23B 1H5SD 2V0LA 5EJ1A 3OKRA 4HO6A 4FREA 4MNDA 4FRPA 2VXLA 4KXOA 1G97A 2OI5A 4AYLA 1VH1A 1XZ6A 1LL0A 1G23A 3Q4SA 1H7HA 2AGDA 4HO3A 1R81A 5AJPA 5C3AA 1FGXA 3I0DA 1VZUA 4LW3A 1H7LA 1JV1A 1V83A 4R7PA 1W55A 3V90A 3V91A 2O1GA 4M2BA 4KPXA 1ZI5A 4Y7VA 4D11C 2VS4A 1MP5A 3OC9A 2VSHA 4Y7TA 3TZTA 1OMZA 1H7TA 2X65A 4K6RA 3LW6A 2RIZA 2FYDB 3FWWA 1HM0A 2RJ8A 4L41C 2YC3A 2QGIA 2A8WA 2XMEA 5J49A 3DK5A 4M2AA 3PKQA 3QVBA 1W77A 4B5BA 1WT1A 2FY7A 2YQJA 1ZI4A 2V0JA 4C2SA 2D7RA 2X5SA 3USRA 1G8OA 1GWVA 1JV3A 1WSZA 3CU0A 3V0LA 5L6SA 1EZIA 2XWLA 3POLA 4O6MA 1R82A 2XWMA 5CMJA 1EYRA 3IOHA 2WVMA 1HJJA 3V0QA 1LZIA 1YROB 3SXCA 1GQCA 2YC5A 2E8BA 4ZDQA 1G9RA 5C4CA 2YQCA 5C48A 2WEEA 2NXVA 4B2WA 3I0IX 1NKHB 1HJLA 1PZYB 1ZCUA 1FG5N 1V82A 3EE5A 4D0ZA 1LL2A 5C4DA 4B4BA 4M4KA 4Y63A 5IDTA 2C0NA 5C4FA 1NHEB 2WVLA 2AE7A 4XWIA 1O7QA 4FCUA 3ZLKA 1ZJPA 1FXOA 4EE5A 2CU2A 1ZHJA 2OI7A 1H5TA 3TQDA 3V8YA 3RMWA 1GX0A 4ASJA 2FYAA 1SS9A 2GGOA 2XWNA 3R2WA 2O1FA 2Y7AA 4EEGA 4FIXA 4FRQA 1FR8A 1QG8A 2P72A 1IIMA 3SX8A 4GBPA 2AM4A 5FYEA 3T7MA 1H5RB 1I52A 4HOCA 4P02A 2MZBA 4KNRA 1R7XA 1ZJOA 4KRVA 2FFUA 3U2UA 2Z87A 4Y7FA 1ZJ3A 3CKJA 4EVWA 1H5SB 3CKNA 4D0TA 2RIYA 1GA8A 5C49A 2RJ9A 4NAKA 1FO8A 3V0MA 1S4OA 2J0BA 4FRHA 1KWSA 3SXGA 5FTSA 4E1KA 3V0PA 1Z90A 3V8ZA 4D11A 4MYBA 2JCOA 2DPWA 3V0NA 2Y4LA 2Y6PA 2WGZA 1S4NA 1K4VA 1LZJA 1R7TA 3ZF8A 1ZCTA 5D91A 3I0CA 2VS3A 2O1HA 1VGTA 3I0LA 4LW6A 4D48A 2D7IA 4Y64A 4HO5A 4BMAA 4KC1A 4DDZA 3NGWA 1E5KA 5EIYA 5C1GA 3CKQA 3I0GA 4KC4A 5C47A 4FROA 2BO8A 4MIXA 2PGYA 1INJA 1GX4A 2RJ4A 3HL3A 1MP3A 1NWGB 3E26A 2I5KA 5L6VA 5FU8A 4EEMA 4FRBA 4FRLA 3OH2A 3D98A 1G0RA 5CMIA 1QWJA 5C8RA 3T7NA 4Y9XA 3RMVA 4B3UA 2X5ZA 3U0XA 2Z86A 4B4GA 1GWWA 1ZDFA 4G3PA 3CGXA 1OQMB 3JTJA 2AESA 3OGZA 1TW1A 5C36A 1HV9A 2ICXA 2P73A 3OH3A 1FO9A 1ZDGA 4HG6A 3T7OA 4DE7A 4CVHA 4KT7A 1JVGA 4YS8A 1R7YA 2OEFA 4HO2A 5CQPA 5C4BA 5C3DA 3SX3A 1G93A 2YCMA 2YESA 2ZU7A 4UEGA 5EJZA 5FTVA 4HO4A 4AAWA 3PNNA 5FV9A 2APCA 1R80A 5CQLX 4ARWA 2PA4A 5C3BA 1ZIZA 2ZU9A 1GQ9A 5DDTA 4EEOA 1WT2A 1JVDA 2FYBA 1WT3A 2VD4A 1YP4A 3ZGFA 4NANA 3I0EA 1VH3A 1HM9A 1ZCVA 3E25A 1MC3A 1TZFA 5D92A 2AECA 2FFVA 5CQMX 1LZ7A 4FRDA 3DUVA 4ASYA 1VGUA 5C4EA 4AC3A 3N9WA 3Q7UA 1S4PA 1ZI1A 4JISA 4M28A 1H5TB 2AH9A 2JCJA 2RJ6A 2OEGA 2Y4JA 2VS5A 2BO4A 3U2WA 3D8VA 5CMHA 2YQSA 1QGQA 1ON6A 1H4EA 2Q4JA 3SXAA 2D0JA 1QGSA 2VXMA 4Q7CA 1FRWA 3JUKA 2V0KA 5IDSA 3FOQA 4IRPA 2RJ7A 1TW5A 3SXEA 3SX5A 3R3IA 3F1YA 2W0VA 4B2XA 4FCEA 2WVKA 4JD0A 4NAIA 1W57A 4FRAA 1VZTA 2Y4KA 2RJ5A 5JQQA 1NF5B 3OH4A 1JYLA 1H7EA 4DECA 2RITA 2I7BA 2V0IA 2J0AA 1PZTA 1FGGA 1NMMB 2PX7A 1IINA 4G87A 3OAMA 4NALA 3K8DA 4Y6NA 3CKVA 3F1CA 2WAWA 2RJ0A 3KIAA 4CJCA 4EEAA 1G95A 1VM8A 2W0WA 4Y7UA 2X60A 3JUJA 1ZJ2A 2AM5A 4G3QA 5DDVA 2VSIA 1H7QA 4HO8A 3OH1A 2AM3A 5C1HA 3GUEA 3O3PA 4HO0A 3CKOA 5CMFX 1FOAA 1H3MA 4B4MA 3IOIA 1H4DA 3OH0A 1R7VA 1ZCYA 4FQWA 4FRMA 4HCQA 1V84A 4Y6UA 1VZXA 2BO6A 2BO7A 3BRKX 3SX7A 2I5EA 5AJNA 4B42A 4Y7GA 2RIXA 3I0FA 5HS2A 1O0RA 4AYJA 1MP4A 1H7GA 4IRQA 5FU0A 4EE3A 5IFYA 1ZJ1A 3U2XA 1VPAA 1XHBA 5FUHA 2OI6A 2XMHA 3K8EA 1LZ0A 3DJ4A 1FZWA 4CJ8A 3SPTA 1H4CA 1HM8A 3IOJA 3ST8A 1O7OA 1ON8A 1FWYA 1G3LA 1NQIB 1FR9A 1INIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXC A;  2QH5 A;  3SXD A;  3ZLL A;  1LL3 A;  1OMX A;  2UX8 A;  1R7U A;  3D5N A;  1G1L A;  2VFZ A;  2JCL A;  2WE9 A;  5C1L A;  1G2V A;  2FYC B;  4KPZ A;  4BQH A;  2RJ1 A;  2P6W A;  4HO9 A;  4KQL A;  4P00 A;  5I1F A;  1YP3 A;  3Q80 A;  1H7F A;  4EE4 A;  3I0J A;  3U0Y A;  1ZJ0 A;  4G3S A;  4KNX A;  2JCK A;  1VGZ A;  1ZI3 A;  2Y4M A;  3V0O A;  2ZU8 A;  4CJB A;  1JYK A;  3SXB A;  1H5R A;  4KC2 A;  1VGW A;  2A8U A;  2PGV A;  1LVW A;  5C38 A;  3ZGG A;  1YP2 A;  3U2V A;  3I0H A;  1FXJ A;  5CQN X;  4ECM A;  1TVY A;  2YQH A;  5CMG X;  5CQO A;  3BCV A;  2QKX A;  4Y62 A;  3USQ A;  1WT0 A;  2GGQ A;  1H5S C;  1H5S A;  5AJO A;  2E3D A;  1VIC A;  3PKP A;  2ICY A;  3I0K A;  1WVC A;  3U2T A;  2V0H A;  3RSB A;  4J18 A;  1O23 B;  1H5S D;  2V0L A;  5EJ1 A;  3OKR A;  4HO6 A;  4FRE A;  4MND A;  4FRP A;  2VXL A;  4KXO A;  1G97 A;  2OI5 A;  4AYL A;  1VH1 A;  1XZ6 A;  1LL0 A;  1G23 A;  3Q4S A;  1H7H A;  2AGD A;  4HO3 A;  1R81 A;  5AJP A;  5C3A A;  1FGX A;  3I0D A;  1VZU A;  4LW3 A;  1H7L A;  1JV1 A;  1V83 A;  4R7P A;  1W55 A;  3V90 A;  3V91 A;  2O1G A;  4M2B A;  4KPX A;  1ZI5 A;  4Y7V A;  4D11 C;  2VS4 A;  1MP5 A;  3OC9 A;  2VSH A;  4Y7T A;  3TZT A;  1OMZ A;  1H7T A;  2X65 A;  4K6R A;  3LW6 A;  2RIZ A;  2FYD B;  3FWW A;  1HM0 A;  2RJ8 A;  4L41 C;  2YC3 A;  2QGI A;  2A8W A;  2XME A;  5J49 A;  3DK5 A;  4M2A A;  3PKQ A;  3QVB A;  1W77 A;  4B5B A;  1WT1 A;  2FY7 A;  2YQJ A;  1ZI4 A;  2V0J A;  4C2S A;  2D7R A;  2X5S A;  3USR A;  1G8O A;  1GWV A;  1JV3 A;  1WSZ A;  3CU0 A;  3V0L A;  5L6S A;  1EZI A;  2XWL A;  3POL A;  1R82 A;  2XWM A;  5CMJ A;  1EYR A;  3IOH A;  2WVM A;  1HJJ A;  3V0Q A;  1LZI A;  1YRO B;  3SXC A;  1GQC A;  2YC5 A;  2E8B A;  4ZDQ A;  1G9R A;  5C4C A;  2YQC A;  5C48 A;  2WEE A;  2NXV A;  4B2W A;  3I0I X;  1NKH B;  1HJL A;  1PZY B;  1ZCU A;  1FG5 N;  1V82 A;  3EE5 A;  4D0Z A;  1LL2 A;  5C4D A;  4B4B A;  4M4K A;  4Y63 A;  5IDT A;  5C4F A;  1NHE B;  2WVL A;  2AE7 A;  4XWI A;  1O7Q A;  4FCU A;  3ZLK A;  1ZJP A;  1FXO A;  4EE5 A;  2CU2 A;  1ZHJ A;  2OI7 A;  1H5T A;  3TQD A;  3V8Y A;  3RMW A;  1GX0 A;  4ASJ A;  2FYA A;  1SS9 A;  2GGO A;  2XWN A;  3R2W A;  2O1F A;  2Y7A A;  4EEG A;  4FRQ A;  1FR8 A;  1QG8 A;  2P72 A;  1IIM A;  3SX8 A;  4GBP A;  2AM4 A;  5FYE A;  3T7M A;  1H5R B;  1I52 A;  4HOC A;  4P02 A;  2MZB A;  4KNR A;  1R7X A;  1ZJO A;  4KRV A;  2FFU A;  3U2U A;  2Z87 A;  4Y7F A;  1ZJ3 A;  3CKJ A;  4EVW A;  1H5S B;  3CKN A;  4D0T A;  2RIY A;  1GA8 A;  5C49 A;  2RJ9 A;  4NAK A;  1FO8 A;  3V0M A;  1S4O A;  4FRH A;  1KWS A;  3SXG A;  5FTS A;  4E1K A;  3V0P A;  1Z90 A;  3V8Z A;  4D11 A;  4MYB A;  2JCO A;  2DPW A;  3V0N A;  2Y4L A;  2Y6P A;  2WGZ A;  1S4N A;  1K4V A;  1LZJ A;  1R7T A;  3ZF8 A;  1ZCT A;  3I0C A;  2VS3 A;  2O1H A;  1VGT A;  3I0L A;  4LW6 A;  4D48 A;  2D7I A;  4Y64 A;  4HO5 A;  4BMA A;  4KC1 A;  4DDZ A;  3NGW A;  1E5K A;  5EIY A;  5C1G A;  3CKQ A;  3I0G A;  4KC4 A;  5C47 A;  4FRO A;  2BO8 A;  2PGY A;  1INJ A;  1GX4 A;  2RJ4 A;  3HL3 A;  1MP3 A;  1NWG B;  3E26 A;  2I5K A;  5L6V A;  5FU8 A;  4EEM A;  4FRB A;  4FRL A;  3OH2 A;  3D98 A;  1G0R A;  5CMI A;  1QWJ A;  5C8R A;  3T7N A;  4Y9X A;  3RMV A;  4B3U A;  2X5Z A;  3U0X A;  2Z86 A;  4B4G A;  1GWW A;  1ZDF A;  4G3P A;  3CGX A;  1OQM B;  3JTJ A;  2AES A;  3OGZ A;  1TW1 A;  5C36 A;  1HV9 A;  2ICX A;  2P73 A;  3OH3 A;  1FO9 A;  1ZDG A;  4HG6 A;  3T7O A;  4DE7 A;  4CVH A;  4KT7 A;  1JVG A;  4YS8 A;  1R7Y A;  2OEF A;  4HO2 A;  5CQP A;  5C4B A;  5C3D A;  3SX3 A;  1G93 A;  2YCM A;  2YES A;  2ZU7 A;  4UEG A;  5EJZ A;  5FTV A;  4HO4 A;  4AAW A;  3PNN A;  5FV9 A;  2APC A;  1R80 A;  5CQL X;  4ARW A;  2PA4 A;  5C3B A;  1ZIZ A;  2ZU9 A;  1GQ9 A;  5DDT A;  4EEO A;  1WT2 A;  1JVD A;  2FYB A;  1WT3 A;  2VD4 A;  1YP4 A;  3ZGF A;  4NAN A;  3I0E A;  1VH3 A;  1HM9 A;  1ZCV A;  3E25 A;  1MC3 A;  1TZF A;  2AEC A;  2FFV A;  5CQM X;  1LZ7 A;  4FRD A;  3DUV A;  4ASY A;  1VGU A;  5C4E A;  4AC3 A;  3N9W A;  3Q7U A;  1S4P A;  1ZI1 A;  4JIS A;  4M28 A;  1H5T B;  2AH9 A;  2JCJ A;  2RJ6 A;  2OEG A;  2Y4J A;  2VS5 A;  2BO4 A;  3U2W A;  3D8V A;  5CMH A;  2YQS A;  1QGQ A;  1ON6 A;  1H4E A;  2Q4J A;  3SXA A;  2D0J A;  1QGS A;  2VXM A;  1FRW A;  3JUK A;  2V0K A;  5IDS A;  3FOQ A;  4IRP A;  2RJ7 A;  1TW5 A;  3SXE A;  3SX5 A;  3R3I A;  3F1Y A;  2W0V A;  4B2X A;  4FCE A;  2WVK A;  4JD0 A;  4NAI A;  1W57 A;  4FRA A;  1VZT A;  2Y4K A;  2RJ5 A;  5JQQ A;  1NF5 B;  3OH4 A;  1JYL A;  1H7E A;  4DEC A;  2RIT A;  2I7B A;  2V0I A;  1PZT A;  1FGG A;  1NMM B;  2PX7 A;  1IIN A;  4G87 A;  3OAM A;  4NAL A;  3K8D A;  4Y6N A;  3CKV A;  3F1C A;  2WAW A;  2RJ0 A;  3KIA A;  4CJC A;  4EEA A;  1G95 A;  1VM8 A;  2W0W A;  4Y7U A;  2X60 A;  3JUJ A;  1ZJ2 A;  2AM5 A;  4G3Q A;  5DDV A;  2VSI A;  1H7Q A;  4HO8 A;  3OH1 A;  2AM3 A;  5C1H A;  3GUE A;  3O3P A;  4HO0 A;  3CKO A;  5CMF X;  1FOA A;  1H3M A;  4B4M A;  3IOI A;  1H4D A;  3OH0 A;  1R7V A;  1ZCY A;  4FQW A;  4FRM A;  4HCQ A;  1V84 A;  4Y6U A;  1VZX A;  2BO6 A;  2BO7 A;  3BRK X;  3SX7 A;  2I5E A;  5AJN A;  4B42 A;  4Y7G A;  2RIX A;  3I0F A;  5HS2 A;  1O0R A;  4AYJ A;  1MP4 A;  1H7G A;  4IRQ A;  5FU0 A;  4EE3 A;  5IFY A;  1ZJ1 A;  3U2X A;  1VPA A;  1XHB A;  5FUH A;  2OI6 A;  2XMH A;  3K8E A;  1LZ0 A;  3DJ4 A;  1FZW A;  4CJ8 A;  3SPT A;  1H4C A;  1HM8 A;  3IOJ A;  3ST8 A;  1O7O A;  1ON8 A;  1FWY A;  1G3L A;  1NQI B;  1FR9 A;  1INI A; 
#chains in the Genus database with same CATH topology
 5BXC A;  2QH5 A;  3SXD A;  3ZLL A;  1LL3 A;  1OMX A;  2UX8 A;  1R7U A;  3D5N A;  4O6N A;  1G1L A;  2VFZ A;  2JCL A;  4FIY A;  2WE9 A;  5C1L A;  1G2V A;  2FYC B;  4KPZ A;  4BQH A;  2RJ1 A;  2P6W A;  4HO9 A;  4KQL A;  4P00 A;  5I1F A;  1YP3 A;  3Q80 A;  1H7F A;  4EE4 A;  3I0J A;  3U0Y A;  1ZJ0 A;  4G3S A;  4KNX A;  2JCK A;  1VGZ A;  1ZI3 A;  2Y4M A;  3V0O A;  2ZU8 A;  4CJB A;  1JYK A;  3SXB A;  1H5R A;  4KC2 A;  1VGW A;  2A8U A;  2PGV A;  1LVW A;  5C38 A;  3ZGG A;  1YP2 A;  3U2V A;  3I0H A;  1FXJ A;  5CQN X;  4ECM A;  1TVY A;  2YQH A;  5CMG X;  5CQO A;  3BCV A;  2QKX A;  4Y62 A;  3USQ A;  1WT0 A;  2GGQ A;  1H5S C;  1H5S A;  5AJO A;  2E3D A;  1VIC A;  3PKP A;  2ICY A;  3I0K A;  1WVC A;  3U2T A;  2V0H A;  3RSB A;  4J18 A;  2VK9 A;  1O23 B;  1H5S D;  2V0L A;  5EJ1 A;  3OKR A;  4HO6 A;  4FRE A;  4MND A;  4FRP A;  2VXL A;  4KXO A;  1G97 A;  2OI5 A;  4AYL A;  1VH1 A;  1XZ6 A;  1LL0 A;  1G23 A;  3Q4S A;  1H7H A;  2AGD A;  4HO3 A;  1R81 A;  5AJP A;  5C3A A;  1FGX A;  3I0D A;  1VZU A;  4LW3 A;  1H7L A;  1JV1 A;  1V83 A;  4R7P A;  1W55 A;  3V90 A;  3V91 A;  2O1G A;  4M2B A;  4KPX A;  1ZI5 A;  4Y7V A;  4D11 C;  2VS4 A;  1MP5 A;  3OC9 A;  2VSH A;  4Y7T A;  3TZT A;  1OMZ A;  1H7T A;  2X65 A;  4K6R A;  3LW6 A;  2RIZ A;  2FYD B;  3FWW A;  1HM0 A;  2RJ8 A;  4L41 C;  2YC3 A;  2QGI A;  2A8W A;  2XME A;  5J49 A;  3DK5 A;  4M2A A;  3PKQ A;  3QVB A;  1W77 A;  4B5B A;  1WT1 A;  2FY7 A;  2YQJ A;  1ZI4 A;  2V0J A;  4C2S A;  2D7R A;  2X5S A;  3USR A;  1G8O A;  1GWV A;  1JV3 A;  1WSZ A;  3CU0 A;  3V0L A;  5L6S A;  1EZI A;  2XWL A;  3POL A;  4O6M A;  1R82 A;  2XWM A;  5CMJ A;  1EYR A;  3IOH A;  2WVM A;  1HJJ A;  3V0Q A;  1LZI A;  1YRO B;  3SXC A;  1GQC A;  2YC5 A;  2E8B A;  4ZDQ A;  1G9R A;  5C4C A;  2YQC A;  5C48 A;  2WEE A;  2NXV A;  4B2W A;  3I0I X;  1NKH B;  1HJL A;  1PZY B;  1ZCU A;  1FG5 N;  1V82 A;  3EE5 A;  4D0Z A;  1LL2 A;  5C4D A;  4B4B A;  4M4K A;  4Y63 A;  5IDT A;  2C0N A;  5C4F A;  1NHE B;  2WVL A;  2AE7 A;  4XWI A;  1O7Q A;  4FCU A;  3ZLK A;  1ZJP A;  1FXO A;  4EE5 A;  2CU2 A;  1ZHJ A;  2OI7 A;  1H5T A;  3TQD A;  3V8Y A;  3RMW A;  1GX0 A;  4ASJ A;  2FYA A;  1SS9 A;  2GGO A;  2XWN A;  3R2W A;  2O1F A;  2Y7A A;  4EEG A;  4FIX A;  4FRQ A;  1FR8 A;  1QG8 A;  2P72 A;  1IIM A;  3SX8 A;  4GBP A;  2AM4 A;  5FYE A;  3T7M A;  1H5R B;  1I52 A;  4HOC A;  4P02 A;  2MZB A;  4KNR A;  1R7X A;  1ZJO A;  4KRV A;  2FFU A;  3U2U A;  2Z87 A;  4Y7F A;  1ZJ3 A;  3CKJ A;  4EVW A;  1H5S B;  3CKN A;  4D0T A;  2RIY A;  1GA8 A;  5C49 A;  2RJ9 A;  4NAK A;  1FO8 A;  3V0M A;  1S4O A;  2J0B A;  4FRH A;  1KWS A;  3SXG A;  5FTS A;  4E1K A;  3V0P A;  1Z90 A;  3V8Z A;  4D11 A;  4MYB A;  2JCO A;  2DPW A;  3V0N A;  2Y4L A;  2Y6P A;  2WGZ A;  1S4N A;  1K4V A;  1LZJ A;  1R7T A;  3ZF8 A;  1ZCT A;  5D91 A;  3I0C A;  2VS3 A;  2O1H A;  1VGT A;  3I0L A;  4LW6 A;  4D48 A;  2D7I A;  4Y64 A;  4HO5 A;  4BMA A;  4KC1 A;  4DDZ A;  3NGW A;  1E5K A;  5EIY A;  5C1G A;  3CKQ A;  3I0G A;  4KC4 A;  5C47 A;  4FRO A;  2BO8 A;  4MIX A;  2PGY A;  1INJ A;  1GX4 A;  2RJ4 A;  3HL3 A;  1MP3 A;  1NWG B;  3E26 A;  2I5K A;  5L6V A;  5FU8 A;  4EEM A;  4FRB A;  4FRL A;  3OH2 A;  3D98 A;  1G0R A;  5CMI A;  1QWJ A;  5C8R A;  3T7N A;  4Y9X A;  3RMV A;  4B3U A;  2X5Z A;  3U0X A;  2Z86 A;  4B4G A;  1GWW A;  1ZDF A;  4G3P A;  3CGX A;  1OQM B;  3JTJ A;  2AES A;  3OGZ A;  1TW1 A;  5C36 A;  1HV9 A;  2ICX A;  2P73 A;  3OH3 A;  1FO9 A;  1ZDG A;  4HG6 A;  3T7O A;  4DE7 A;  4CVH A;  4KT7 A;  1JVG A;  4YS8 A;  1R7Y A;  2OEF A;  4HO2 A;  5CQP A;  5C4B A;  5C3D A;  3SX3 A;  1G93 A;  2YCM A;  2YES A;  2ZU7 A;  4UEG A;  5EJZ A;  5FTV A;  4HO4 A;  4AAW A;  3PNN A;  5FV9 A;  2APC A;  1R80 A;  5CQL X;  4ARW A;  2PA4 A;  5C3B A;  1ZIZ A;  2ZU9 A;  1GQ9 A;  5DDT A;  4EEO A;  1WT2 A;  1JVD A;  2FYB A;  1WT3 A;  2VD4 A;  1YP4 A;  3ZGF A;  4NAN A;  3I0E A;  1VH3 A;  1HM9 A;  1ZCV A;  3E25 A;  1MC3 A;  1TZF A;  5D92 A;  2AEC A;  2FFV A;  5CQM X;  1LZ7 A;  4FRD A;  3DUV A;  4ASY A;  1VGU A;  5C4E A;  4AC3 A;  3N9W A;  3Q7U A;  1S4P A;  1ZI1 A;  4JIS A;  4M28 A;  1H5T B;  2AH9 A;  2JCJ A;  2RJ6 A;  2OEG A;  2Y4J A;  2VS5 A;  2BO4 A;  3U2W A;  3D8V A;  5CMH A;  2YQS A;  1QGQ A;  1ON6 A;  1H4E A;  2Q4J A;  3SXA A;  2D0J A;  1QGS A;  2VXM A;  4Q7C A;  1FRW A;  3JUK A;  2V0K A;  5IDS A;  3FOQ A;  4IRP A;  2RJ7 A;  1TW5 A;  3SXE A;  3SX5 A;  3R3I A;  3F1Y A;  2W0V A;  4B2X A;  4FCE A;  2WVK A;  4JD0 A;  4NAI A;  1W57 A;  4FRA A;  1VZT A;  2Y4K A;  2RJ5 A;  5JQQ A;  1NF5 B;  3OH4 A;  1JYL A;  1H7E A;  4DEC A;  2RIT A;  2I7B A;  2V0I A;  2J0A A;  1PZT A;  1FGG A;  1NMM B;  2PX7 A;  1IIN A;  4G87 A;  3OAM A;  4NAL A;  3K8D A;  4Y6N A;  3CKV A;  3F1C A;  2WAW A;  2RJ0 A;  3KIA A;  4CJC A;  4EEA A;  1G95 A;  1VM8 A;  2W0W A;  4Y7U A;  2X60 A;  3JUJ A;  1ZJ2 A;  2AM5 A;  4G3Q A;  5DDV A;  2VSI A;  1H7Q A;  4HO8 A;  3OH1 A;  2AM3 A;  5C1H A;  3GUE A;  3O3P A;  4HO0 A;  3CKO A;  5CMF X;  1FOA A;  1H3M A;  4B4M A;  3IOI A;  1H4D A;  3OH0 A;  1R7V A;  1ZCY A;  4FQW A;  4FRM A;  4HCQ A;  1V84 A;  4Y6U A;  1VZX A;  2BO6 A;  2BO7 A;  3BRK X;  3SX7 A;  2I5E A;  5AJN A;  4B42 A;  4Y7G A;  2RIX A;  3I0F A;  5HS2 A;  1O0R A;  4AYJ A;  1MP4 A;  1H7G A;  4IRQ A;  5FU0 A;  4EE3 A;  5IFY A;  1ZJ1 A;  3U2X A;  1VPA A;  1XHB A;  5FUH A;  2OI6 A;  2XMH A;  3K8E A;  1LZ0 A;  3DJ4 A;  1FZW A;  4CJ8 A;  3SPT A;  1H4C A;  1HM8 A;  3IOJ A;  3ST8 A;  1O7O A;  1ON8 A;  1FWY A;  1G3L A;  1NQI B;  1FR9 A;  1INI A; 
#chains in the Genus database with same CATH homology
 5BXC A;  2QH5 A;  3SXD A;  3ZLL A;  1LL3 A;  1OMX A;  2UX8 A;  1R7U A;  3D5N A;  4O6N A;  1G1L A;  2VFZ A;  2JCL A;  4FIY A;  2WE9 A;  5C1L A;  1G2V A;  2FYC B;  4KPZ A;  4BQH A;  2RJ1 A;  2P6W A;  4HO9 A;  4KQL A;  4P00 A;  5I1F A;  1YP3 A;  3Q80 A;  1H7F A;  4EE4 A;  3I0J A;  3U0Y A;  1ZJ0 A;  4G3S A;  4KNX A;  2JCK A;  1VGZ A;  1ZI3 A;  2Y4M A;  3V0O A;  2ZU8 A;  4CJB A;  1JYK A;  3SXB A;  1H5R A;  4KC2 A;  1VGW A;  2A8U A;  2PGV A;  1LVW A;  5C38 A;  3ZGG A;  1YP2 A;  3U2V A;  3I0H A;  1FXJ A;  5CQN X;  4ECM A;  1TVY A;  2YQH A;  5CMG X;  5CQO A;  3BCV A;  2QKX A;  4Y62 A;  3USQ A;  1WT0 A;  2GGQ A;  1H5S C;  1H5S A;  5AJO A;  2E3D A;  1VIC A;  3PKP A;  2ICY A;  3I0K A;  1WVC A;  3U2T A;  2V0H A;  3RSB A;  4J18 A;  2VK9 A;  1O23 B;  1H5S D;  2V0L A;  5EJ1 A;  3OKR A;  4HO6 A;  4FRE A;  4MND A;  4FRP A;  2VXL A;  4KXO A;  1G97 A;  2OI5 A;  4AYL A;  1VH1 A;  1XZ6 A;  1LL0 A;  1G23 A;  3Q4S A;  1H7H A;  2AGD A;  4HO3 A;  1R81 A;  5AJP A;  5C3A A;  1FGX A;  3I0D A;  1VZU A;  4LW3 A;  1H7L A;  1JV1 A;  1V83 A;  4R7P A;  1W55 A;  3V90 A;  3V91 A;  2O1G A;  4M2B A;  4KPX A;  1ZI5 A;  4Y7V A;  4D11 C;  2VS4 A;  1MP5 A;  3OC9 A;  2VSH A;  4Y7T A;  3TZT A;  1OMZ A;  1H7T A;  2X65 A;  4K6R A;  3LW6 A;  2RIZ A;  2FYD B;  3FWW A;  1HM0 A;  2RJ8 A;  4L41 C;  2YC3 A;  2QGI A;  2A8W A;  2XME A;  5J49 A;  3DK5 A;  4M2A A;  3PKQ A;  3QVB A;  1W77 A;  4B5B A;  1WT1 A;  2FY7 A;  2YQJ A;  1ZI4 A;  2V0J A;  4C2S A;  2D7R A;  2X5S A;  3USR A;  1G8O A;  1GWV A;  1JV3 A;  1WSZ A;  3CU0 A;  3V0L A;  5L6S A;  1EZI A;  2XWL A;  3POL A;  4O6M A;  1R82 A;  2XWM A;  5CMJ A;  1EYR A;  3IOH A;  2WVM A;  1HJJ A;  3V0Q A;  1LZI A;  1YRO B;  3SXC A;  1GQC A;  2YC5 A;  2E8B A;  4ZDQ A;  1G9R A;  5C4C A;  2YQC A;  5C48 A;  2WEE A;  2NXV A;  4B2W A;  3I0I X;  1NKH B;  1HJL A;  1PZY B;  1ZCU A;  1FG5 N;  1V82 A;  3EE5 A;  4D0Z A;  1LL2 A;  5C4D A;  4B4B A;  4M4K A;  4Y63 A;  5IDT A;  2C0N A;  5C4F A;  1NHE B;  2WVL A;  2AE7 A;  4XWI A;  1O7Q A;  4FCU A;  3ZLK A;  1ZJP A;  1FXO A;  4EE5 A;  2CU2 A;  1ZHJ A;  2OI7 A;  1H5T A;  3TQD A;  3V8Y A;  3RMW A;  1GX0 A;  4ASJ A;  2FYA A;  1SS9 A;  2GGO A;  2XWN A;  3R2W A;  2O1F A;  2Y7A A;  4EEG A;  4FIX A;  4FRQ A;  1FR8 A;  1QG8 A;  2P72 A;  1IIM A;  3SX8 A;  4GBP A;  2AM4 A;  5FYE A;  3T7M A;  1H5R B;  1I52 A;  4HOC A;  4P02 A;  2MZB A;  4KNR A;  1R7X A;  1ZJO A;  4KRV A;  2FFU A;  3U2U A;  2Z87 A;  4Y7F A;  1ZJ3 A;  3CKJ A;  4EVW A;  1H5S B;  3CKN A;  4D0T A;  2RIY A;  1GA8 A;  5C49 A;  2RJ9 A;  4NAK A;  1FO8 A;  3V0M A;  1S4O A;  2J0B A;  4FRH A;  1KWS A;  3SXG A;  5FTS A;  4E1K A;  3V0P A;  1Z90 A;  3V8Z A;  4D11 A;  4MYB A;  2JCO A;  2DPW A;  3V0N A;  2Y4L A;  2Y6P A;  2WGZ A;  1S4N A;  1K4V A;  1LZJ A;  1R7T A;  3ZF8 A;  1ZCT A;  5D91 A;  3I0C A;  2VS3 A;  2O1H A;  1VGT A;  3I0L A;  4LW6 A;  4D48 A;  2D7I A;  4Y64 A;  4HO5 A;  4BMA A;  4KC1 A;  4DDZ A;  3NGW A;  1E5K A;  5EIY A;  5C1G A;  3CKQ A;  3I0G A;  4KC4 A;  5C47 A;  4FRO A;  2BO8 A;  4MIX A;  2PGY A;  1INJ A;  1GX4 A;  2RJ4 A;  3HL3 A;  1MP3 A;  1NWG B;  3E26 A;  2I5K A;  5L6V A;  5FU8 A;  4EEM A;  4FRB A;  4FRL A;  3OH2 A;  3D98 A;  1G0R A;  5CMI A;  1QWJ A;  5C8R A;  3T7N A;  4Y9X A;  3RMV A;  4B3U A;  2X5Z A;  3U0X A;  2Z86 A;  4B4G A;  1GWW A;  1ZDF A;  4G3P A;  3CGX A;  1OQM B;  3JTJ A;  2AES A;  3OGZ A;  1TW1 A;  5C36 A;  1HV9 A;  2ICX A;  2P73 A;  3OH3 A;  1FO9 A;  1ZDG A;  4HG6 A;  3T7O A;  4DE7 A;  4CVH A;  4KT7 A;  1JVG A;  4YS8 A;  1R7Y A;  2OEF A;  4HO2 A;  5CQP A;  5C4B A;  5C3D A;  3SX3 A;  1G93 A;  2YCM A;  2YES A;  2ZU7 A;  4UEG A;  5EJZ A;  5FTV A;  4HO4 A;  4AAW A;  3PNN A;  5FV9 A;  2APC A;  1R80 A;  5CQL X;  4ARW A;  2PA4 A;  5C3B A;  1ZIZ A;  2ZU9 A;  1GQ9 A;  5DDT A;  4EEO A;  1WT2 A;  1JVD A;  2FYB A;  1WT3 A;  2VD4 A;  1YP4 A;  3ZGF A;  4NAN A;  3I0E A;  1VH3 A;  1HM9 A;  1ZCV A;  3E25 A;  1MC3 A;  1TZF A;  5D92 A;  2AEC A;  2FFV A;  5CQM X;  1LZ7 A;  4FRD A;  3DUV A;  4ASY A;  1VGU A;  5C4E A;  4AC3 A;  3N9W A;  3Q7U A;  1S4P A;  1ZI1 A;  4JIS A;  4M28 A;  1H5T B;  2AH9 A;  2JCJ A;  2RJ6 A;  2OEG A;  2Y4J A;  2VS5 A;  2BO4 A;  3U2W A;  3D8V A;  5CMH A;  2YQS A;  1QGQ A;  1ON6 A;  1H4E A;  2Q4J A;  3SXA A;  2D0J A;  1QGS A;  2VXM A;  4Q7C A;  1FRW A;  3JUK A;  2V0K A;  5IDS A;  3FOQ A;  4IRP A;  2RJ7 A;  1TW5 A;  3SXE A;  3SX5 A;  3R3I A;  3F1Y A;  2W0V A;  4B2X A;  4FCE A;  2WVK A;  4JD0 A;  4NAI A;  1W57 A;  4FRA A;  1VZT A;  2Y4K A;  2RJ5 A;  5JQQ A;  1NF5 B;  3OH4 A;  1JYL A;  1H7E A;  4DEC A;  2RIT A;  2I7B A;  2V0I A;  2J0A A;  1PZT A;  1FGG A;  1NMM B;  2PX7 A;  1IIN A;  4G87 A;  3OAM A;  4NAL A;  3K8D A;  4Y6N A;  3CKV A;  3F1C A;  2WAW A;  2RJ0 A;  3KIA A;  4CJC A;  4EEA A;  1G95 A;  1VM8 A;  2W0W A;  4Y7U A;  2X60 A;  3JUJ A;  1ZJ2 A;  2AM5 A;  4G3Q A;  5DDV A;  2VSI A;  1H7Q A;  4HO8 A;  3OH1 A;  2AM3 A;  5C1H A;  3GUE A;  3O3P A;  4HO0 A;  3CKO A;  5CMF X;  1FOA A;  1H3M A;  4B4M A;  3IOI A;  1H4D A;  3OH0 A;  1R7V A;  1ZCY A;  4FQW A;  4FRM A;  4HCQ A;  1V84 A;  4Y6U A;  1VZX A;  2BO6 A;  2BO7 A;  3BRK X;  3SX7 A;  2I5E A;  5AJN A;  4B42 A;  4Y7G A;  2RIX A;  3I0F A;  5HS2 A;  1O0R A;  4AYJ A;  1MP4 A;  1H7G A;  4IRQ A;  5FU0 A;  4EE3 A;  5IFY A;  1ZJ1 A;  3U2X A;  1VPA A;  1XHB A;  5FUH A;  2OI6 A;  2XMH A;  3K8E A;  1LZ0 A;  3DJ4 A;  1FZW A;  4CJ8 A;  3SPT A;  1H4C A;  1HM8 A;  3IOJ A;  3ST8 A;  1O7O A;  1ON8 A;  1FWY A;  1G3L A;  1NQI B;  1FR9 A;  1INI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...