3SXGA

Crystal structure of aaaa+udp+gal with mpd as the cryoprotectant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
293
structure length
291
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 291
sequence length 293
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sxgA00
1XHBA 1FRWA 1WT2A 2ZU8A 3CKVA 2MZBA 2OI7A 3CU0A 2Y7AA 3SXDA 1H7TA 1LVWA 1EYRA 2P6WA 3CKNA 4FRDA 5CQOA 2YESA 5CQLX 2V0IA 3SXCA 2VS5A 3RSBA 3I0FA 1R7UA 4Y7TA 2V0KA 1MP3A 2A8UA 2XWMA 4HO0A 3V0OA 3HL3A 3ZF8A 4KC1A 5CQNX 4KNRA 3U2WA 5CMFX 3JTJA 3N9WA 3IOIA 3SX8A 5C3DA 2RJ7A 1ZIZA 4EEOA 2RJ9A 4DE7A 4XWIA 3I0LA 1NHEB 4EVWA 4EE4A 2WGZA 2NXVA 3K8DA 1H5SA 2PA4A 4CVHA 3R3IA 2RJ8A 3DJ4A 4B4GA 1ZI3A 1H5SB 3V91A 5C36A 1VPAA 3FOQA 2APCA 1H7LA 1GA8A 5EJZA 2AESA 4NAKA 3I0IX 4CJBA 1G9RA 4FCEA 3V0MA 1VGZA 4KPXA 2X5ZA 1O0RA 4LW6A 4AAWA 4MNDA 5C48A 5EIYA 3SX3A 1JV1A 3PNNA 4HO6A 2XWLA 4DDZA 2I5EA 3U0YA 4B3UA 2WEEA 1JVGA 3OH1A 2AM3A 4LW3A 1QWJA 1O23B 3ZLLA 2WVMA 5FYEA 1FO9A 3LW6A 3PKQA 3CKJA 2VXMA 2YQHA 2V0HA 3V8YA 4KPZA 4P00A 5IFYA 1LZ0A 1GX0A 1R7YA 3I0EA 1XZ6A 1R7TA 5C1LA 2ZU9A 2CU2A 4GBPA 4D48A 1G95A 1NMMB 1H5RA 2BO4A 1G2VA 2Y4KA 2I7BA 2X60A 1H7QA 3V90A 4EEGA 5C49A 2RJ1A 1MP5A 4ASYA 2PX7A 2D7IA 5EJ1A 1ZJ1A 1OQMB 1H5RB 1WVCA 5C4EA 2YQCA 5JQQA 1K4VA 3ST8A 1Z90A 4FCUA 4KRVA 3IOHA 1HM9A 5C8RA 3DUVA 3SPTA 2XMHA 5AJOA 5CMIA 2Y4JA 2Y4LA 1YP4A 3TZTA 3V0NA 1YP2A 3Q80A 2JCKA 4NALA 2VFZA 1VGWA 3SX7A 1R7VA 4Y7FA 1OMXA 4M2BA 5CMGX 5C4CA 2BO8A 1QG8A 4KC4A 1ZDGA 3QVBA 1PZYB 1LL3A 3T7NA 3D98A 2FYCB 1ZHJA 2V0LA 4HO2A 4D11C 1V83A 4Y64A 1G93A 4K6RA 4FRAA 3POLA 5C4BA 1E5KA 4KNXA 4B4MA 3D8VA 1G3LA 4KT7A 1FO8A 4Y7UA 3T7OA 3I0CA 2WE9A 2RJ0A 5BXCA 3BCVA 5CQPA 3CGXA 3JUKA 2BO6A 1OMZA 1VGUA 4FRBA 4L41C 2X65A 4R7PA 2VS3A 1G8OA 4B4BA 2D7RA 1WSZA 1FXOA 2OI5A 2VXLA 1ZJ0A 1G97A 4G3SA 1GX4A 2ICYA 1TW5A 1GWWA 1HJJA 2XWNA 1EZIA 2D0JA 5I1FA 1FR8A 5L6VA 3USRA 1FWYA 1ON8A 1SS9A 2UX8A 4Y7GA 4B5BA 5CMJA 2ZU7A 3CKOA 2O1GA 2W0VA 1ZI4A 2AECA 4NAIA 4CJ8A 2QKXA 2RIYA 2JCJA 1VZXA 2FYBA 3U0XA 3OH0A 2GGQA 4G3QA 2YC3A 1NF5B 1FXJA 2AGDA 3V0PA 1ZCTA 4C2SA 1IINA 1FGXA 3ZLKA 2P73A 3I0KA 2A8WA 3NGWA 2JCLA 3I0HA 1INIA 2E8BA 4AYJA 2ICXA 1VZTA 1NKHB 2I5KA 2XMEA 3JUJA 1HV9A 1G1LA 1VH3A 1TVYA 4M2AA 4Y62A 4D0ZA 1ZDFA 2YQJA 1LZ7A 1VICA 1LZIA 4JD0A 2PGYA 5DDVA 2VS4A 1WT3A 1S4PA 2Z87A 5IDTA 2AE7A 1LZJA 3GUEA 5FU0A 1R80A 1H5SD 1VGTA 3TQDA 4P02A 1W77A 1G23A 1JV3A 1W55A 1GQCA 4M4KA 5C3BA 2AM5A 3OH2A 3Q4SA 2E3DA 5CMHA 2OEFA 2WAWA 3E26A 1ZJPA 4E1KA 1MP4A 4FROA 4HO8A 2O1HA 3EE5A 1JYLA 4IRPA 3SXEA 1S4OA 1ZCUA 2RJ6A 3RMWA 5FTVA 1G0RA 5C47A 3RMVA 2DPWA 1S4NA 3SXBA 3OAMA 3V0LA 4AYLA 4NANA 1H3MA 1H7GA 4KXOA 1ON6A 1FR9A 5J49A 4ZDQA 1HM8A 3U2XA 1TW1A 1H4EA 1FZWA 1ZJ2A 4JISA 1TZFA 1H7FA 5FUHA 3F1YA 5C1HA 4FRMA 1ZJ3A 3OKRA 1FGGA 3IOJA 4HO4A 4BMAA 2V0JA 2JCOA 4G87A 3USQA 4ASJA 3DK5A 2Z86A 4HOCA 2PGVA 3CKQA 4ECMA 2YQSA 3U2VA 2FFUA 2Y4MA 4D0TA 5FU8A 5L6SA 2QH5A 3U2TA 2X5SA 2BO7A 4J18A 4EE3A 2VD4A 1JVDA 1PZTA 4FRHA 4MYBA 1ZI5A 1R7XA 1H7HA 4HO9A 3I0JA 2QGIA 5DDTA 2RIXA 1V82A 1GWVA 1IIMA 4D11A 4HG6A 1QGSA 1VZUA 2W0WA 3E25A 2O1FA 3SXGA 4FRQA 3OGZA 5AJNA 2AH9A 1W57A 2WVKA 1NQIB 4ARWA 1ZCYA 1FOAA 1R82A 2FFVA 1QGQA 2OEGA 5HS2A 1ZI1A 1H4CA 1I52A 2Y6PA 3OC9A 4FRLA 1V84A 1YROB 4G3PA 4YS8A 4BQHA 3OH4A 1VM8A 3ZGFA 4B42A 1KWSA 1WT0A 4Y9XA 5C1GA 3V0QA 3I0GA 2YC5A 3FWWA 3I0DA 5C4DA 2VSHA 4Y7VA 1VH1A 4FRPA 4Y6UA 5FV9A 4M28A 3T7MA 2AM4A 2RIZA 5AJPA 1H4DA 1FG5N 2FYAA 1H5TA 4KQLA 1YP3A 1O7OA 1H7EA 4IRQA 4HO5A 1WT1A 2RJ4A 3Q7UA 4EEAA 3U2UA 4FQWA 1LL2A 4Y63A 3KIAA 1H5TB 3O3PA 3SXAA 3ZGGA 1R81A 3BRKX 4CJCA 1HM0A 1O7QA 4B2WA 5CQMX 1LL0A 1JYKA 3F1CA 4FREA 2RITA 5C3AA 3R2WA 4B2XA 4HCQA 1HJLA 2WVLA 3V8ZA 2FY7A 5IDSA 2VSIA 4Y6NA 2RJ5A 1INJA 3SX5A 4UEGA 2Q4JA 5FTSA 2GGOA 5C38A 4EE5A 4DECA 3D5NA 2P72A 2YCMA 1ZCVA 3K8EA 1H5SC 2OI6A 4EEMA 4KC2A 1NWGB 4AC3A 1ZJOA 2FYDB 3PKPA 1MC3A 4HO3A 5C4FA 1GQ9A 3OH3A
chains in the Genus database with same CATH superfamily
1XHBA 1FRWA 1WT2A 2ZU8A 3CKVA 2MZBA 2OI7A 3CU0A 2Y7AA 3SXDA 1H7TA 1LVWA 1EYRA 2P6WA 3CKNA 4FRDA 5CQOA 2YESA 5CQLX 2V0IA 3SXCA 2VS5A 3RSBA 3I0FA 1R7UA 4Y7TA 2V0KA 1MP3A 2A8UA 2XWMA 4HO0A 3V0OA 3HL3A 3ZF8A 4KC1A 5CQNX 4KNRA 3U2WA 5CMFX 3JTJA 3N9WA 3IOIA 3SX8A 5C3DA 2RJ7A 1ZIZA 4EEOA 2RJ9A 4DE7A 4XWIA 5D91A 3I0LA 1NHEB 4EVWA 4EE4A 2WGZA 2NXVA 3K8DA 1H5SA 2PA4A 4CVHA 3R3IA 2RJ8A 3DJ4A 4B4GA 1ZI3A 1H5SB 3V91A 5C36A 1VPAA 3FOQA 2APCA 1H7LA 1GA8A 4O6MA 5EJZA 2AESA 4NAKA 3I0IX 4CJBA 1G9RA 4FCEA 3V0MA 1VGZA 4KPXA 2X5ZA 1O0RA 4LW6A 4AAWA 4MNDA 5C48A 5EIYA 3SX3A 1JV1A 3PNNA 4HO6A 2XWLA 4DDZA 2I5EA 3U0YA 4B3UA 2WEEA 1JVGA 3OH1A 2AM3A 4LW3A 1QWJA 1O23B 3ZLLA 2WVMA 5FYEA 1FO9A 3LW6A 3PKQA 3CKJA 2VXMA 2YQHA 2V0HA 3V8YA 4KPZA 4P00A 5IFYA 1LZ0A 1GX0A 1R7YA 3I0EA 1XZ6A 1R7TA 5C1LA 2ZU9A 2CU2A 4GBPA 4D48A 1G95A 1NMMB 1H5RA 2BO4A 1G2VA 2Y4KA 2I7BA 2X60A 1H7QA 3V90A 4EEGA 5C49A 2RJ1A 1MP5A 4ASYA 2PX7A 2D7IA 5EJ1A 1ZJ1A 1OQMB 1H5RB 1WVCA 5C4EA 2YQCA 5JQQA 1K4VA 3ST8A 1Z90A 4FCUA 4KRVA 3IOHA 1HM9A 5C8RA 3DUVA 3SPTA 2XMHA 5AJOA 5CMIA 2Y4JA 2Y4LA 1YP4A 3TZTA 3V0NA 1YP2A 3Q80A 2JCKA 4NALA 2J0AA 2VFZA 1VGWA 3SX7A 1R7VA 4Y7FA 1OMXA 4M2BA 5CMGX 5C4CA 2BO8A 1QG8A 4KC4A 1ZDGA 3QVBA 1PZYB 1LL3A 3T7NA 3D98A 2FYCB 1ZHJA 2V0LA 4HO2A 4D11C 1V83A 4Y64A 1G93A 4FIYA 4FRAA 4K6RA 3POLA 5C4BA 1E5KA 4KNXA 4B4MA 3D8VA 1G3LA 4KT7A 1FO8A 4Y7UA 3T7OA 2C0NA 3I0CA 2WE9A 2RJ0A 5BXCA 3BCVA 5CQPA 3CGXA 3JUKA 2BO6A 1OMZA 1VGUA 4FRBA 4L41C 2X65A 4R7PA 2VS3A 1G8OA 4B4BA 2D7RA 1WSZA 1FXOA 2OI5A 2VXLA 1ZJ0A 1G97A 4G3SA 1GX4A 2ICYA 1TW5A 1GWWA 1HJJA 2XWNA 1EZIA 2D0JA 5I1FA 4Q7CA 1FR8A 5L6VA 3USRA 1FWYA 1ON8A 1SS9A 2UX8A 4Y7GA 4B5BA 5CMJA 2ZU7A 3CKOA 2O1GA 2W0VA 1ZI4A 2AECA 4NAIA 4CJ8A 2QKXA 2RIYA 2JCJA 1VZXA 2FYBA 3U0XA 3OH0A 2GGQA 4G3QA 2YC3A 1NF5B 1FXJA 2AGDA 3V0PA 1ZCTA 4C2SA 1IINA 1FGXA 3ZLKA 2P73A 3I0KA 2A8WA 2J0BA 3NGWA 2JCLA 3I0HA 1INIA 2E8BA 4AYJA 2ICXA 1VZTA 1NKHB 2I5KA 2XMEA 3JUJA 1HV9A 1G1LA 1VH3A 1TVYA 4M2AA 4Y62A 4D0ZA 1ZDFA 2YQJA 1LZ7A 1VICA 1LZIA 4JD0A 2PGYA 5DDVA 2VS4A 1WT3A 1S4PA 2Z87A 5IDTA 2AE7A 1LZJA 3GUEA 5FU0A 1R80A 1H5SD 1VGTA 3TQDA 4P02A 1W77A 1G23A 1JV3A 1W55A 5D92A 1GQCA 4M4KA 5C3BA 2AM5A 3OH2A 3Q4SA 2E3DA 5CMHA 2OEFA 2WAWA 3E26A 1ZJPA 4E1KA 1MP4A 4FROA 4HO8A 2O1HA 3EE5A 1JYLA 4IRPA 3SXEA 1S4OA 1ZCUA 2RJ6A 3RMWA 5FTVA 1G0RA 5C47A 3RMVA 2DPWA 1S4NA 3SXBA 3OAMA 3V0LA 4AYLA 4NANA 1H3MA 1H7GA 4KXOA 1ON6A 1FR9A 2VK9A 5J49A 4ZDQA 1HM8A 3U2XA 1TW1A 1H4EA 1FZWA 1ZJ2A 4JISA 1TZFA 1H7FA 5FUHA 4MIXA 3F1YA 5C1HA 4FRMA 1ZJ3A 3OKRA 1FGGA 3IOJA 4HO4A 4BMAA 2V0JA 2JCOA 4G87A 3USQA 4ASJA 3DK5A 2Z86A 4HOCA 2PGVA 3CKQA 4ECMA 2YQSA 3U2VA 2FFUA 2Y4MA 4D0TA 5FU8A 5L6SA 2QH5A 3U2TA 2X5SA 2BO7A 4O6NA 4J18A 4EE3A 2VD4A 1JVDA 1PZTA 4FRHA 4MYBA 4FIXA 1ZI5A 1R7XA 1H7HA 4HO9A 3I0JA 2QGIA 5DDTA 2RIXA 1V82A 1GWVA 1IIMA 4D11A 4HG6A 1QGSA 1VZUA 2W0WA 3E25A 2O1FA 3SXGA 4FRQA 3OGZA 5AJNA 2AH9A 1W57A 2WVKA 1NQIB 4ARWA 1ZCYA 1FOAA 1R82A 2FFVA 1QGQA 2OEGA 5HS2A 1ZI1A 1H4CA 1I52A 2Y6PA 3OC9A 4FRLA 1V84A 1YROB 4G3PA 4YS8A 4BQHA 3OH4A 1VM8A 3ZGFA 4B42A 1KWSA 1WT0A 4Y9XA 5C1GA 3V0QA 3I0GA 2YC5A 3FWWA 3I0DA 5C4DA 2VSHA 4Y7VA 1VH1A 4FRPA 4Y6UA 5FV9A 4M28A 3T7MA 2AM4A 2RIZA 5AJPA 1H4DA 1FG5N 2FYAA 1H5TA 4KQLA 1YP3A 1O7OA 1H7EA 4IRQA 4HO5A 1WT1A 2RJ4A 3Q7UA 4EEAA 3U2UA 4FQWA 1LL2A 4Y63A 3KIAA 1H5TB 3O3PA 3SXAA 3ZGGA 1R81A 3BRKX 4CJCA 1HM0A 1O7QA 4B2WA 5CQMX 1LL0A 1JYKA 3F1CA 4FREA 2RITA 5C3AA 3R2WA 4B2XA 4HCQA 1HJLA 2WVLA 3V8ZA 2FY7A 5IDSA 2VSIA 4Y6NA 2RJ5A 1INJA 3SX5A 4UEGA 2Q4JA 5FTSA 2GGOA 5C38A 4EE5A 4DECA 3D5NA 2P72A 2YCMA 1ZCVA 3K8EA 1H5SC 2OI6A 4EEMA 4KC2A 1NWGB 4AC3A 1ZJOA 2FYDB 3PKPA 1MC3A 4HO3A 5C4FA 1GQ9A 3OH3A
chains in the Genus database with same CATH topology
1XHBA 1FRWA 1WT2A 2ZU8A 3CKVA 2MZBA 2OI7A 3CU0A 2Y7AA 3SXDA 1H7TA 1LVWA 1EYRA 2P6WA 3CKNA 4FRDA 5CQOA 2YESA 5CQLX 2V0IA 3SXCA 2VS5A 3RSBA 3I0FA 1R7UA 4Y7TA 2V0KA 1MP3A 2A8UA 2XWMA 4HO0A 3V0OA 3HL3A 3ZF8A 4KC1A 5CQNX 4KNRA 3U2WA 5CMFX 3JTJA 3N9WA 3IOIA 3SX8A 5C3DA 2RJ7A 1ZIZA 4EEOA 2RJ9A 4DE7A 4XWIA 5D91A 3I0LA 1NHEB 4EVWA 4EE4A 2WGZA 2NXVA 3K8DA 1H5SA 2PA4A 4CVHA 3R3IA 2RJ8A 3DJ4A 4B4GA 1ZI3A 1H5SB 3V91A 5C36A 1VPAA 3FOQA 2APCA 1H7LA 1GA8A 4O6MA 5EJZA 2AESA 4NAKA 3I0IX 4CJBA 1G9RA 4FCEA 3V0MA 1VGZA 4KPXA 2X5ZA 1O0RA 4LW6A 4AAWA 4MNDA 5C48A 5EIYA 3SX3A 1JV1A 3PNNA 4HO6A 2XWLA 4DDZA 2I5EA 3U0YA 4B3UA 2WEEA 1JVGA 3OH1A 2AM3A 4LW3A 1QWJA 1O23B 3ZLLA 2WVMA 5FYEA 1FO9A 3LW6A 3PKQA 3CKJA 2VXMA 2YQHA 2V0HA 3V8YA 4KPZA 4P00A 5IFYA 1LZ0A 1GX0A 1R7YA 3I0EA 1XZ6A 1R7TA 5C1LA 2ZU9A 2CU2A 4GBPA 4D48A 1G95A 1NMMB 1H5RA 2BO4A 1G2VA 2Y4KA 2I7BA 2X60A 1H7QA 3V90A 4EEGA 5C49A 2RJ1A 1MP5A 4ASYA 2PX7A 2D7IA 5EJ1A 1ZJ1A 1OQMB 1H5RB 1WVCA 5C4EA 2YQCA 5JQQA 1K4VA 3ST8A 1Z90A 4FCUA 4KRVA 3IOHA 1HM9A 5C8RA 3DUVA 3SPTA 2XMHA 5AJOA 5CMIA 2Y4JA 2Y4LA 1YP4A 3TZTA 3V0NA 1YP2A 3Q80A 2JCKA 4NALA 2J0AA 2VFZA 1VGWA 3SX7A 1R7VA 4Y7FA 1OMXA 4M2BA 5CMGX 5C4CA 2BO8A 1QG8A 4KC4A 1ZDGA 3QVBA 1PZYB 1LL3A 3T7NA 3D98A 2FYCB 1ZHJA 2V0LA 4HO2A 4D11C 1V83A 4Y64A 1G93A 4FIYA 4FRAA 4K6RA 3POLA 5C4BA 1E5KA 4KNXA 4B4MA 3D8VA 1G3LA 4KT7A 1FO8A 4Y7UA 3T7OA 2C0NA 3I0CA 2WE9A 2RJ0A 5BXCA 3BCVA 5CQPA 3CGXA 3JUKA 2BO6A 1OMZA 1VGUA 4FRBA 4L41C 2X65A 4R7PA 2VS3A 1G8OA 4B4BA 2D7RA 1WSZA 1FXOA 2OI5A 2VXLA 1ZJ0A 1G97A 4G3SA 1GX4A 2ICYA 1TW5A 1GWWA 1HJJA 2XWNA 1EZIA 2D0JA 5I1FA 4Q7CA 1FR8A 5L6VA 3USRA 1FWYA 1ON8A 1SS9A 2UX8A 4Y7GA 4B5BA 5CMJA 2ZU7A 3CKOA 2O1GA 2W0VA 1ZI4A 2AECA 4NAIA 4CJ8A 2QKXA 2RIYA 2JCJA 1VZXA 2FYBA 3U0XA 3OH0A 2GGQA 4G3QA 2YC3A 1NF5B 1FXJA 2AGDA 3V0PA 1ZCTA 4C2SA 1IINA 1FGXA 3ZLKA 2P73A 3I0KA 2A8WA 2J0BA 3NGWA 2JCLA 3I0HA 1INIA 2E8BA 4AYJA 2ICXA 1VZTA 1NKHB 2I5KA 2XMEA 3JUJA 1HV9A 1G1LA 1VH3A 1TVYA 4M2AA 4Y62A 4D0ZA 1ZDFA 2YQJA 1LZ7A 1VICA 1LZIA 4JD0A 2PGYA 5DDVA 2VS4A 1WT3A 1S4PA 2Z87A 5IDTA 2AE7A 1LZJA 3GUEA 5FU0A 1R80A 1H5SD 1VGTA 3TQDA 4P02A 1W77A 1G23A 1JV3A 1W55A 5D92A 1GQCA 4M4KA 5C3BA 2AM5A 3OH2A 3Q4SA 2E3DA 5CMHA 2OEFA 2WAWA 3E26A 1ZJPA 4E1KA 1MP4A 4FROA 4HO8A 2O1HA 3EE5A 1JYLA 4IRPA 3SXEA 1S4OA 1ZCUA 2RJ6A 3RMWA 5FTVA 1G0RA 5C47A 3RMVA 2DPWA 1S4NA 3SXBA 3OAMA 3V0LA 4AYLA 4NANA 1H3MA 1H7GA 4KXOA 1ON6A 1FR9A 2VK9A 5J49A 4ZDQA 1HM8A 3U2XA 1TW1A 1H4EA 1FZWA 1ZJ2A 4JISA 1TZFA 1H7FA 5FUHA 4MIXA 3F1YA 5C1HA 4FRMA 1ZJ3A 3OKRA 1FGGA 3IOJA 4HO4A 4BMAA 2V0JA 2JCOA 4G87A 3USQA 4ASJA 3DK5A 2Z86A 4HOCA 2PGVA 3CKQA 4ECMA 2YQSA 3U2VA 2FFUA 2Y4MA 4D0TA 5FU8A 5L6SA 2QH5A 3U2TA 2X5SA 2BO7A 4O6NA 4J18A 4EE3A 2VD4A 1JVDA 1PZTA 4FRHA 4MYBA 4FIXA 1ZI5A 1R7XA 1H7HA 4HO9A 3I0JA 2QGIA 5DDTA 2RIXA 1V82A 1GWVA 1IIMA 4D11A 4HG6A 1QGSA 1VZUA 2W0WA 3E25A 2O1FA 3SXGA 4FRQA 3OGZA 5AJNA 2AH9A 1W57A 2WVKA 1NQIB 4ARWA 1ZCYA 1FOAA 1R82A 2FFVA 1QGQA 2OEGA 5HS2A 1ZI1A 1H4CA 1I52A 2Y6PA 3OC9A 4FRLA 1V84A 1YROB 4G3PA 4YS8A 4BQHA 3OH4A 1VM8A 3ZGFA 4B42A 1KWSA 1WT0A 4Y9XA 5C1GA 3V0QA 3I0GA 2YC5A 3FWWA 3I0DA 5C4DA 2VSHA 4Y7VA 1VH1A 4FRPA 4Y6UA 5FV9A 4M28A 3T7MA 2AM4A 2RIZA 5AJPA 1H4DA 1FG5N 2FYAA 1H5TA 4KQLA 1YP3A 1O7OA 1H7EA 4IRQA 4HO5A 1WT1A 2RJ4A 3Q7UA 4EEAA 3U2UA 4FQWA 1LL2A 4Y63A 3KIAA 1H5TB 3O3PA 3SXAA 3ZGGA 1R81A 3BRKX 4CJCA 1HM0A 1O7QA 4B2WA 5CQMX 1LL0A 1JYKA 3F1CA 4FREA 2RITA 5C3AA 3R2WA 4B2XA 4HCQA 1HJLA 2WVLA 3V8ZA 2FY7A 5IDSA 2VSIA 4Y6NA 2RJ5A 1INJA 3SX5A 4UEGA 2Q4JA 5FTSA 2GGOA 5C38A 4EE5A 4DECA 3D5NA 2P72A 2YCMA 1ZCVA 3K8EA 1H5SC 2OI6A 4EEMA 4KC2A 1NWGB 4AC3A 1ZJOA 2FYDB 3PKPA 1MC3A 4HO3A 5C4FA 1GQ9A 3OH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHB A;  1FRW A;  1WT2 A;  2ZU8 A;  3CKV A;  2MZB A;  2OI7 A;  3CU0 A;  2Y7A A;  3SXD A;  1H7T A;  1LVW A;  1EYR A;  2P6W A;  3CKN A;  4FRD A;  5CQO A;  2YES A;  5CQL X;  2V0I A;  3SXC A;  2VS5 A;  3RSB A;  3I0F A;  1R7U A;  4Y7T A;  2V0K A;  1MP3 A;  2A8U A;  2XWM A;  4HO0 A;  3V0O A;  3HL3 A;  3ZF8 A;  4KC1 A;  5CQN X;  4KNR A;  3U2W A;  5CMF X;  3JTJ A;  3N9W A;  3IOI A;  3SX8 A;  5C3D A;  2RJ7 A;  1ZIZ A;  4EEO A;  2RJ9 A;  4DE7 A;  4XWI A;  3I0L A;  1NHE B;  4EVW A;  4EE4 A;  2WGZ A;  2NXV A;  3K8D A;  1H5S A;  2PA4 A;  4CVH A;  3R3I A;  2RJ8 A;  3DJ4 A;  4B4G A;  1ZI3 A;  1H5S B;  3V91 A;  5C36 A;  1VPA A;  3FOQ A;  2APC A;  1H7L A;  1GA8 A;  5EJZ A;  2AES A;  4NAK A;  3I0I X;  4CJB A;  1G9R A;  4FCE A;  3V0M A;  1VGZ A;  4KPX A;  2X5Z A;  1O0R A;  4LW6 A;  4AAW A;  4MND A;  5C48 A;  5EIY A;  3SX3 A;  1JV1 A;  3PNN A;  4HO6 A;  2XWL A;  4DDZ A;  2I5E A;  3U0Y A;  4B3U A;  2WEE A;  1JVG A;  3OH1 A;  2AM3 A;  4LW3 A;  1QWJ A;  1O23 B;  3ZLL A;  2WVM A;  5FYE A;  1FO9 A;  3LW6 A;  3PKQ A;  3CKJ A;  2VXM A;  2YQH A;  2V0H A;  3V8Y A;  4KPZ A;  4P00 A;  5IFY A;  1LZ0 A;  1GX0 A;  1R7Y A;  3I0E A;  1XZ6 A;  1R7T A;  5C1L A;  2ZU9 A;  2CU2 A;  4GBP A;  4D48 A;  1G95 A;  1NMM B;  1H5R A;  2BO4 A;  1G2V A;  2Y4K A;  2I7B A;  2X60 A;  1H7Q A;  3V90 A;  4EEG A;  5C49 A;  2RJ1 A;  1MP5 A;  4ASY A;  2PX7 A;  2D7I A;  5EJ1 A;  1ZJ1 A;  1OQM B;  1H5R B;  1WVC A;  5C4E A;  2YQC A;  5JQQ A;  1K4V A;  3ST8 A;  1Z90 A;  4FCU A;  4KRV A;  3IOH A;  1HM9 A;  5C8R A;  3DUV A;  3SPT A;  2XMH A;  5AJO A;  5CMI A;  2Y4J A;  2Y4L A;  1YP4 A;  3TZT A;  3V0N A;  1YP2 A;  3Q80 A;  2JCK A;  4NAL A;  2VFZ A;  1VGW A;  3SX7 A;  1R7V A;  4Y7F A;  1OMX A;  4M2B A;  5CMG X;  5C4C A;  2BO8 A;  1QG8 A;  4KC4 A;  1ZDG A;  3QVB A;  1PZY B;  1LL3 A;  3T7N A;  3D98 A;  2FYC B;  1ZHJ A;  2V0L A;  4HO2 A;  4D11 C;  1V83 A;  4Y64 A;  1G93 A;  4K6R A;  4FRA A;  3POL A;  5C4B A;  1E5K A;  4KNX A;  4B4M A;  3D8V A;  1G3L A;  4KT7 A;  1FO8 A;  4Y7U A;  3T7O A;  3I0C A;  2WE9 A;  2RJ0 A;  5BXC A;  3BCV A;  5CQP A;  3CGX A;  3JUK A;  2BO6 A;  1OMZ A;  1VGU A;  4FRB A;  4L41 C;  2X65 A;  4R7P A;  2VS3 A;  1G8O A;  4B4B A;  2D7R A;  1WSZ A;  1FXO A;  2OI5 A;  2VXL A;  1ZJ0 A;  1G97 A;  4G3S A;  1GX4 A;  2ICY A;  1TW5 A;  1GWW A;  1HJJ A;  2XWN A;  1EZI A;  2D0J A;  5I1F A;  1FR8 A;  5L6V A;  3USR A;  1FWY A;  1ON8 A;  1SS9 A;  2UX8 A;  4Y7G A;  4B5B A;  5CMJ A;  2ZU7 A;  3CKO A;  2O1G A;  2W0V A;  1ZI4 A;  2AEC A;  4NAI A;  4CJ8 A;  2QKX A;  2RIY A;  2JCJ A;  1VZX A;  2FYB A;  3U0X A;  3OH0 A;  2GGQ A;  4G3Q A;  2YC3 A;  1NF5 B;  1FXJ A;  2AGD A;  3V0P A;  1ZCT A;  4C2S A;  1IIN A;  1FGX A;  3ZLK A;  2P73 A;  3I0K A;  2A8W A;  3NGW A;  2JCL A;  3I0H A;  1INI A;  2E8B A;  4AYJ A;  2ICX A;  1VZT A;  1NKH B;  2I5K A;  2XME A;  3JUJ A;  1HV9 A;  1G1L A;  1VH3 A;  1TVY A;  4M2A A;  4Y62 A;  4D0Z A;  1ZDF A;  2YQJ A;  1LZ7 A;  1VIC A;  1LZI A;  4JD0 A;  2PGY A;  5DDV A;  2VS4 A;  1WT3 A;  1S4P A;  2Z87 A;  5IDT A;  2AE7 A;  1LZJ A;  3GUE A;  5FU0 A;  1R80 A;  1H5S D;  1VGT A;  3TQD A;  4P02 A;  1W77 A;  1G23 A;  1JV3 A;  1W55 A;  1GQC A;  4M4K A;  5C3B A;  2AM5 A;  3OH2 A;  3Q4S A;  2E3D A;  5CMH A;  2OEF A;  2WAW A;  3E26 A;  1ZJP A;  4E1K A;  1MP4 A;  4FRO A;  4HO8 A;  2O1H A;  3EE5 A;  1JYL A;  4IRP A;  3SXE A;  1S4O A;  1ZCU A;  2RJ6 A;  3RMW A;  5FTV A;  1G0R A;  5C47 A;  3RMV A;  2DPW A;  1S4N A;  3SXB A;  3OAM A;  3V0L A;  4AYL A;  4NAN A;  1H3M A;  1H7G A;  4KXO A;  1ON6 A;  1FR9 A;  5J49 A;  4ZDQ A;  1HM8 A;  3U2X A;  1TW1 A;  1H4E A;  1FZW A;  1ZJ2 A;  4JIS A;  1TZF A;  1H7F A;  5FUH A;  3F1Y A;  5C1H A;  4FRM A;  1ZJ3 A;  3OKR A;  1FGG A;  3IOJ A;  4HO4 A;  4BMA A;  2V0J A;  2JCO A;  4G87 A;  3USQ A;  4ASJ A;  3DK5 A;  2Z86 A;  4HOC A;  2PGV A;  3CKQ A;  4ECM A;  2YQS A;  3U2V A;  2FFU A;  2Y4M A;  4D0T A;  5FU8 A;  5L6S A;  2QH5 A;  3U2T A;  2X5S A;  2BO7 A;  4J18 A;  4EE3 A;  2VD4 A;  1JVD A;  1PZT A;  4FRH A;  4MYB A;  1ZI5 A;  1R7X A;  1H7H A;  4HO9 A;  3I0J A;  2QGI A;  5DDT A;  2RIX A;  1V82 A;  1GWV A;  1IIM A;  4D11 A;  4HG6 A;  1QGS A;  1VZU A;  2W0W A;  3E25 A;  2O1F A;  3SXG A;  4FRQ A;  3OGZ A;  5AJN A;  2AH9 A;  1W57 A;  2WVK A;  1NQI B;  4ARW A;  1ZCY A;  1FOA A;  1R82 A;  2FFV A;  1QGQ A;  2OEG A;  5HS2 A;  1ZI1 A;  1H4C A;  1I52 A;  2Y6P A;  3OC9 A;  4FRL A;  1V84 A;  1YRO B;  4G3P A;  4YS8 A;  4BQH A;  3OH4 A;  1VM8 A;  3ZGF A;  4B42 A;  1KWS A;  1WT0 A;  4Y9X A;  5C1G A;  3V0Q A;  3I0G A;  2YC5 A;  3FWW A;  3I0D A;  5C4D A;  2VSH A;  4Y7V A;  1VH1 A;  4FRP A;  4Y6U A;  5FV9 A;  4M28 A;  3T7M A;  2AM4 A;  2RIZ A;  5AJP A;  1H4D A;  1FG5 N;  2FYA A;  1H5T A;  4KQL A;  1YP3 A;  1O7O A;  1H7E A;  4IRQ A;  4HO5 A;  1WT1 A;  2RJ4 A;  3Q7U A;  4EEA A;  3U2U A;  4FQW A;  1LL2 A;  4Y63 A;  3KIA A;  1H5T B;  3O3P A;  3SXA A;  3ZGG A;  1R81 A;  3BRK X;  4CJC A;  1HM0 A;  1O7Q A;  4B2W A;  5CQM X;  1LL0 A;  1JYK A;  3F1C A;  4FRE A;  2RIT A;  5C3A A;  3R2W A;  4B2X A;  4HCQ A;  1HJL A;  2WVL A;  3V8Z A;  2FY7 A;  5IDS A;  2VSI A;  4Y6N A;  2RJ5 A;  1INJ A;  3SX5 A;  4UEG A;  2Q4J A;  5FTS A;  2GGO A;  5C38 A;  4EE5 A;  4DEC A;  3D5N A;  2P72 A;  2YCM A;  1ZCV A;  3K8E A;  1H5S C;  2OI6 A;  4EEM A;  4KC2 A;  1NWG B;  4AC3 A;  1ZJO A;  2FYD B;  3PKP A;  1MC3 A;  4HO3 A;  5C4F A;  1GQ9 A;  3OH3 A; 
#chains in the Genus database with same CATH topology
 1XHB A;  1FRW A;  1WT2 A;  2ZU8 A;  3CKV A;  2MZB A;  2OI7 A;  3CU0 A;  2Y7A A;  3SXD A;  1H7T A;  1LVW A;  1EYR A;  2P6W A;  3CKN A;  4FRD A;  5CQO A;  2YES A;  5CQL X;  2V0I A;  3SXC A;  2VS5 A;  3RSB A;  3I0F A;  1R7U A;  4Y7T A;  2V0K A;  1MP3 A;  2A8U A;  2XWM A;  4HO0 A;  3V0O A;  3HL3 A;  3ZF8 A;  4KC1 A;  5CQN X;  4KNR A;  3U2W A;  5CMF X;  3JTJ A;  3N9W A;  3IOI A;  3SX8 A;  5C3D A;  2RJ7 A;  1ZIZ A;  4EEO A;  2RJ9 A;  4DE7 A;  4XWI A;  5D91 A;  3I0L A;  1NHE B;  4EVW A;  4EE4 A;  2WGZ A;  2NXV A;  3K8D A;  1H5S A;  2PA4 A;  4CVH A;  3R3I A;  2RJ8 A;  3DJ4 A;  4B4G A;  1ZI3 A;  1H5S B;  3V91 A;  5C36 A;  1VPA A;  3FOQ A;  2APC A;  1H7L A;  1GA8 A;  4O6M A;  5EJZ A;  2AES A;  4NAK A;  3I0I X;  4CJB A;  1G9R A;  4FCE A;  3V0M A;  1VGZ A;  4KPX A;  2X5Z A;  1O0R A;  4LW6 A;  4AAW A;  4MND A;  5C48 A;  5EIY A;  3SX3 A;  1JV1 A;  3PNN A;  4HO6 A;  2XWL A;  4DDZ A;  2I5E A;  3U0Y A;  4B3U A;  2WEE A;  1JVG A;  3OH1 A;  2AM3 A;  4LW3 A;  1QWJ A;  1O23 B;  3ZLL A;  2WVM A;  5FYE A;  1FO9 A;  3LW6 A;  3PKQ A;  3CKJ A;  2VXM A;  2YQH A;  2V0H A;  3V8Y A;  4KPZ A;  4P00 A;  5IFY A;  1LZ0 A;  1GX0 A;  1R7Y A;  3I0E A;  1XZ6 A;  1R7T A;  5C1L A;  2ZU9 A;  2CU2 A;  4GBP A;  4D48 A;  1G95 A;  1NMM B;  1H5R A;  2BO4 A;  1G2V A;  2Y4K A;  2I7B A;  2X60 A;  1H7Q A;  3V90 A;  4EEG A;  5C49 A;  2RJ1 A;  1MP5 A;  4ASY A;  2PX7 A;  2D7I A;  5EJ1 A;  1ZJ1 A;  1OQM B;  1H5R B;  1WVC A;  5C4E A;  2YQC A;  5JQQ A;  1K4V A;  3ST8 A;  1Z90 A;  4FCU A;  4KRV A;  3IOH A;  1HM9 A;  5C8R A;  3DUV A;  3SPT A;  2XMH A;  5AJO A;  5CMI A;  2Y4J A;  2Y4L A;  1YP4 A;  3TZT A;  3V0N A;  1YP2 A;  3Q80 A;  2JCK A;  4NAL A;  2J0A A;  2VFZ A;  1VGW A;  3SX7 A;  1R7V A;  4Y7F A;  1OMX A;  4M2B A;  5CMG X;  5C4C A;  2BO8 A;  1QG8 A;  4KC4 A;  1ZDG A;  3QVB A;  1PZY B;  1LL3 A;  3T7N A;  3D98 A;  2FYC B;  1ZHJ A;  2V0L A;  4HO2 A;  4D11 C;  1V83 A;  4Y64 A;  1G93 A;  4FIY A;  4FRA A;  4K6R A;  3POL A;  5C4B A;  1E5K A;  4KNX A;  4B4M A;  3D8V A;  1G3L A;  4KT7 A;  1FO8 A;  4Y7U A;  3T7O A;  2C0N A;  3I0C A;  2WE9 A;  2RJ0 A;  5BXC A;  3BCV A;  5CQP A;  3CGX A;  3JUK A;  2BO6 A;  1OMZ A;  1VGU A;  4FRB A;  4L41 C;  2X65 A;  4R7P A;  2VS3 A;  1G8O A;  4B4B A;  2D7R A;  1WSZ A;  1FXO A;  2OI5 A;  2VXL A;  1ZJ0 A;  1G97 A;  4G3S A;  1GX4 A;  2ICY A;  1TW5 A;  1GWW A;  1HJJ A;  2XWN A;  1EZI A;  2D0J A;  5I1F A;  4Q7C A;  1FR8 A;  5L6V A;  3USR A;  1FWY A;  1ON8 A;  1SS9 A;  2UX8 A;  4Y7G A;  4B5B A;  5CMJ A;  2ZU7 A;  3CKO A;  2O1G A;  2W0V A;  1ZI4 A;  2AEC A;  4NAI A;  4CJ8 A;  2QKX A;  2RIY A;  2JCJ A;  1VZX A;  2FYB A;  3U0X A;  3OH0 A;  2GGQ A;  4G3Q A;  2YC3 A;  1NF5 B;  1FXJ A;  2AGD A;  3V0P A;  1ZCT A;  4C2S A;  1IIN A;  1FGX A;  3ZLK A;  2P73 A;  3I0K A;  2A8W A;  2J0B A;  3NGW A;  2JCL A;  3I0H A;  1INI A;  2E8B A;  4AYJ A;  2ICX A;  1VZT A;  1NKH B;  2I5K A;  2XME A;  3JUJ A;  1HV9 A;  1G1L A;  1VH3 A;  1TVY A;  4M2A A;  4Y62 A;  4D0Z A;  1ZDF A;  2YQJ A;  1LZ7 A;  1VIC A;  1LZI A;  4JD0 A;  2PGY A;  5DDV A;  2VS4 A;  1WT3 A;  1S4P A;  2Z87 A;  5IDT A;  2AE7 A;  1LZJ A;  3GUE A;  5FU0 A;  1R80 A;  1H5S D;  1VGT A;  3TQD A;  4P02 A;  1W77 A;  1G23 A;  1JV3 A;  1W55 A;  5D92 A;  1GQC A;  4M4K A;  5C3B A;  2AM5 A;  3OH2 A;  3Q4S A;  2E3D A;  5CMH A;  2OEF A;  2WAW A;  3E26 A;  1ZJP A;  4E1K A;  1MP4 A;  4FRO A;  4HO8 A;  2O1H A;  3EE5 A;  1JYL A;  4IRP A;  3SXE A;  1S4O A;  1ZCU A;  2RJ6 A;  3RMW A;  5FTV A;  1G0R A;  5C47 A;  3RMV A;  2DPW A;  1S4N A;  3SXB A;  3OAM A;  3V0L A;  4AYL A;  4NAN A;  1H3M A;  1H7G A;  4KXO A;  1ON6 A;  1FR9 A;  2VK9 A;  5J49 A;  4ZDQ A;  1HM8 A;  3U2X A;  1TW1 A;  1H4E A;  1FZW A;  1ZJ2 A;  4JIS A;  1TZF A;  1H7F A;  5FUH A;  4MIX A;  3F1Y A;  5C1H A;  4FRM A;  1ZJ3 A;  3OKR A;  1FGG A;  3IOJ A;  4HO4 A;  4BMA A;  2V0J A;  2JCO A;  4G87 A;  3USQ A;  4ASJ A;  3DK5 A;  2Z86 A;  4HOC A;  2PGV A;  3CKQ A;  4ECM A;  2YQS A;  3U2V A;  2FFU A;  2Y4M A;  4D0T A;  5FU8 A;  5L6S A;  2QH5 A;  3U2T A;  2X5S A;  2BO7 A;  4O6N A;  4J18 A;  4EE3 A;  2VD4 A;  1JVD A;  1PZT A;  4FRH A;  4MYB A;  4FIX A;  1ZI5 A;  1R7X A;  1H7H A;  4HO9 A;  3I0J A;  2QGI A;  5DDT A;  2RIX A;  1V82 A;  1GWV A;  1IIM A;  4D11 A;  4HG6 A;  1QGS A;  1VZU A;  2W0W A;  3E25 A;  2O1F A;  3SXG A;  4FRQ A;  3OGZ A;  5AJN A;  2AH9 A;  1W57 A;  2WVK A;  1NQI B;  4ARW A;  1ZCY A;  1FOA A;  1R82 A;  2FFV A;  1QGQ A;  2OEG A;  5HS2 A;  1ZI1 A;  1H4C A;  1I52 A;  2Y6P A;  3OC9 A;  4FRL A;  1V84 A;  1YRO B;  4G3P A;  4YS8 A;  4BQH A;  3OH4 A;  1VM8 A;  3ZGF A;  4B42 A;  1KWS A;  1WT0 A;  4Y9X A;  5C1G A;  3V0Q A;  3I0G A;  2YC5 A;  3FWW A;  3I0D A;  5C4D A;  2VSH A;  4Y7V A;  1VH1 A;  4FRP A;  4Y6U A;  5FV9 A;  4M28 A;  3T7M A;  2AM4 A;  2RIZ A;  5AJP A;  1H4D A;  1FG5 N;  2FYA A;  1H5T A;  4KQL A;  1YP3 A;  1O7O A;  1H7E A;  4IRQ A;  4HO5 A;  1WT1 A;  2RJ4 A;  3Q7U A;  4EEA A;  3U2U A;  4FQW A;  1LL2 A;  4Y63 A;  3KIA A;  1H5T B;  3O3P A;  3SXA A;  3ZGG A;  1R81 A;  3BRK X;  4CJC A;  1HM0 A;  1O7Q A;  4B2W A;  5CQM X;  1LL0 A;  1JYK A;  3F1C A;  4FRE A;  2RIT A;  5C3A A;  3R2W A;  4B2X A;  4HCQ A;  1HJL A;  2WVL A;  3V8Z A;  2FY7 A;  5IDS A;  2VSI A;  4Y6N A;  2RJ5 A;  1INJ A;  3SX5 A;  4UEG A;  2Q4J A;  5FTS A;  2GGO A;  5C38 A;  4EE5 A;  4DEC A;  3D5N A;  2P72 A;  2YCM A;  1ZCV A;  3K8E A;  1H5S C;  2OI6 A;  4EEM A;  4KC2 A;  1NWG B;  4AC3 A;  1ZJO A;  2FYD B;  3PKP A;  1MC3 A;  4HO3 A;  5C4F A;  1GQ9 A;  3OH3 A; 
#chains in the Genus database with same CATH homology
 1XHB A;  1FRW A;  1WT2 A;  2ZU8 A;  3CKV A;  2MZB A;  2OI7 A;  3CU0 A;  2Y7A A;  3SXD A;  1H7T A;  1LVW A;  1EYR A;  2P6W A;  3CKN A;  4FRD A;  5CQO A;  2YES A;  5CQL X;  2V0I A;  3SXC A;  2VS5 A;  3RSB A;  3I0F A;  1R7U A;  4Y7T A;  2V0K A;  1MP3 A;  2A8U A;  2XWM A;  4HO0 A;  3V0O A;  3HL3 A;  3ZF8 A;  4KC1 A;  5CQN X;  4KNR A;  3U2W A;  5CMF X;  3JTJ A;  3N9W A;  3IOI A;  3SX8 A;  5C3D A;  2RJ7 A;  1ZIZ A;  4EEO A;  2RJ9 A;  4DE7 A;  4XWI A;  5D91 A;  3I0L A;  1NHE B;  4EVW A;  4EE4 A;  2WGZ A;  2NXV A;  3K8D A;  1H5S A;  2PA4 A;  4CVH A;  3R3I A;  2RJ8 A;  3DJ4 A;  4B4G A;  1ZI3 A;  1H5S B;  3V91 A;  5C36 A;  1VPA A;  3FOQ A;  2APC A;  1H7L A;  1GA8 A;  4O6M A;  5EJZ A;  2AES A;  4NAK A;  3I0I X;  4CJB A;  1G9R A;  4FCE A;  3V0M A;  1VGZ A;  4KPX A;  2X5Z A;  1O0R A;  4LW6 A;  4AAW A;  4MND A;  5C48 A;  5EIY A;  3SX3 A;  1JV1 A;  3PNN A;  4HO6 A;  2XWL A;  4DDZ A;  2I5E A;  3U0Y A;  4B3U A;  2WEE A;  1JVG A;  3OH1 A;  2AM3 A;  4LW3 A;  1QWJ A;  1O23 B;  3ZLL A;  2WVM A;  5FYE A;  1FO9 A;  3LW6 A;  3PKQ A;  3CKJ A;  2VXM A;  2YQH A;  2V0H A;  3V8Y A;  4KPZ A;  4P00 A;  5IFY A;  1LZ0 A;  1GX0 A;  1R7Y A;  3I0E A;  1XZ6 A;  1R7T A;  5C1L A;  2ZU9 A;  2CU2 A;  4GBP A;  4D48 A;  1G95 A;  1NMM B;  1H5R A;  2BO4 A;  1G2V A;  2Y4K A;  2I7B A;  2X60 A;  1H7Q A;  3V90 A;  4EEG A;  5C49 A;  2RJ1 A;  1MP5 A;  4ASY A;  2PX7 A;  2D7I A;  5EJ1 A;  1ZJ1 A;  1OQM B;  1H5R B;  1WVC A;  5C4E A;  2YQC A;  5JQQ A;  1K4V A;  3ST8 A;  1Z90 A;  4FCU A;  4KRV A;  3IOH A;  1HM9 A;  5C8R A;  3DUV A;  3SPT A;  2XMH A;  5AJO A;  5CMI A;  2Y4J A;  2Y4L A;  1YP4 A;  3TZT A;  3V0N A;  1YP2 A;  3Q80 A;  2JCK A;  4NAL A;  2J0A A;  2VFZ A;  1VGW A;  3SX7 A;  1R7V A;  4Y7F A;  1OMX A;  4M2B A;  5CMG X;  5C4C A;  2BO8 A;  1QG8 A;  4KC4 A;  1ZDG A;  3QVB A;  1PZY B;  1LL3 A;  3T7N A;  3D98 A;  2FYC B;  1ZHJ A;  2V0L A;  4HO2 A;  4D11 C;  1V83 A;  4Y64 A;  1G93 A;  4FIY A;  4FRA A;  4K6R A;  3POL A;  5C4B A;  1E5K A;  4KNX A;  4B4M A;  3D8V A;  1G3L A;  4KT7 A;  1FO8 A;  4Y7U A;  3T7O A;  2C0N A;  3I0C A;  2WE9 A;  2RJ0 A;  5BXC A;  3BCV A;  5CQP A;  3CGX A;  3JUK A;  2BO6 A;  1OMZ A;  1VGU A;  4FRB A;  4L41 C;  2X65 A;  4R7P A;  2VS3 A;  1G8O A;  4B4B A;  2D7R A;  1WSZ A;  1FXO A;  2OI5 A;  2VXL A;  1ZJ0 A;  1G97 A;  4G3S A;  1GX4 A;  2ICY A;  1TW5 A;  1GWW A;  1HJJ A;  2XWN A;  1EZI A;  2D0J A;  5I1F A;  4Q7C A;  1FR8 A;  5L6V A;  3USR A;  1FWY A;  1ON8 A;  1SS9 A;  2UX8 A;  4Y7G A;  4B5B A;  5CMJ A;  2ZU7 A;  3CKO A;  2O1G A;  2W0V A;  1ZI4 A;  2AEC A;  4NAI A;  4CJ8 A;  2QKX A;  2RIY A;  2JCJ A;  1VZX A;  2FYB A;  3U0X A;  3OH0 A;  2GGQ A;  4G3Q A;  2YC3 A;  1NF5 B;  1FXJ A;  2AGD A;  3V0P A;  1ZCT A;  4C2S A;  1IIN A;  1FGX A;  3ZLK A;  2P73 A;  3I0K A;  2A8W A;  2J0B A;  3NGW A;  2JCL A;  3I0H A;  1INI A;  2E8B A;  4AYJ A;  2ICX A;  1VZT A;  1NKH B;  2I5K A;  2XME A;  3JUJ A;  1HV9 A;  1G1L A;  1VH3 A;  1TVY A;  4M2A A;  4Y62 A;  4D0Z A;  1ZDF A;  2YQJ A;  1LZ7 A;  1VIC A;  1LZI A;  4JD0 A;  2PGY A;  5DDV A;  2VS4 A;  1WT3 A;  1S4P A;  2Z87 A;  5IDT A;  2AE7 A;  1LZJ A;  3GUE A;  5FU0 A;  1R80 A;  1H5S D;  1VGT A;  3TQD A;  4P02 A;  1W77 A;  1G23 A;  1JV3 A;  1W55 A;  5D92 A;  1GQC A;  4M4K A;  5C3B A;  2AM5 A;  3OH2 A;  3Q4S A;  2E3D A;  5CMH A;  2OEF A;  2WAW A;  3E26 A;  1ZJP A;  4E1K A;  1MP4 A;  4FRO A;  4HO8 A;  2O1H A;  3EE5 A;  1JYL A;  4IRP A;  3SXE A;  1S4O A;  1ZCU A;  2RJ6 A;  3RMW A;  5FTV A;  1G0R A;  5C47 A;  3RMV A;  2DPW A;  1S4N A;  3SXB A;  3OAM A;  3V0L A;  4AYL A;  4NAN A;  1H3M A;  1H7G A;  4KXO A;  1ON6 A;  1FR9 A;  2VK9 A;  5J49 A;  4ZDQ A;  1HM8 A;  3U2X A;  1TW1 A;  1H4E A;  1FZW A;  1ZJ2 A;  4JIS A;  1TZF A;  1H7F A;  5FUH A;  4MIX A;  3F1Y A;  5C1H A;  4FRM A;  1ZJ3 A;  3OKR A;  1FGG A;  3IOJ A;  4HO4 A;  4BMA A;  2V0J A;  2JCO A;  4G87 A;  3USQ A;  4ASJ A;  3DK5 A;  2Z86 A;  4HOC A;  2PGV A;  3CKQ A;  4ECM A;  2YQS A;  3U2V A;  2FFU A;  2Y4M A;  4D0T A;  5FU8 A;  5L6S A;  2QH5 A;  3U2T A;  2X5S A;  2BO7 A;  4O6N A;  4J18 A;  4EE3 A;  2VD4 A;  1JVD A;  1PZT A;  4FRH A;  4MYB A;  4FIX A;  1ZI5 A;  1R7X A;  1H7H A;  4HO9 A;  3I0J A;  2QGI A;  5DDT A;  2RIX A;  1V82 A;  1GWV A;  1IIM A;  4D11 A;  4HG6 A;  1QGS A;  1VZU A;  2W0W A;  3E25 A;  2O1F A;  3SXG A;  4FRQ A;  3OGZ A;  5AJN A;  2AH9 A;  1W57 A;  2WVK A;  1NQI B;  4ARW A;  1ZCY A;  1FOA A;  1R82 A;  2FFV A;  1QGQ A;  2OEG A;  5HS2 A;  1ZI1 A;  1H4C A;  1I52 A;  2Y6P A;  3OC9 A;  4FRL A;  1V84 A;  1YRO B;  4G3P A;  4YS8 A;  4BQH A;  3OH4 A;  1VM8 A;  3ZGF A;  4B42 A;  1KWS A;  1WT0 A;  4Y9X A;  5C1G A;  3V0Q A;  3I0G A;  2YC5 A;  3FWW A;  3I0D A;  5C4D A;  2VSH A;  4Y7V A;  1VH1 A;  4FRP A;  4Y6U A;  5FV9 A;  4M28 A;  3T7M A;  2AM4 A;  2RIZ A;  5AJP A;  1H4D A;  1FG5 N;  2FYA A;  1H5T A;  4KQL A;  1YP3 A;  1O7O A;  1H7E A;  4IRQ A;  4HO5 A;  1WT1 A;  2RJ4 A;  3Q7U A;  4EEA A;  3U2U A;  4FQW A;  1LL2 A;  4Y63 A;  3KIA A;  1H5T B;  3O3P A;  3SXA A;  3ZGG A;  1R81 A;  3BRK X;  4CJC A;  1HM0 A;  1O7Q A;  4B2W A;  5CQM X;  1LL0 A;  1JYK A;  3F1C A;  4FRE A;  2RIT A;  5C3A A;  3R2W A;  4B2X A;  4HCQ A;  1HJL A;  2WVL A;  3V8Z A;  2FY7 A;  5IDS A;  2VSI A;  4Y6N A;  2RJ5 A;  1INJ A;  3SX5 A;  4UEG A;  2Q4J A;  5FTS A;  2GGO A;  5C38 A;  4EE5 A;  4DEC A;  3D5N A;  2P72 A;  2YCM A;  1ZCV A;  3K8E A;  1H5S C;  2OI6 A;  4EEM A;  4KC2 A;  1NWG B;  4AC3 A;  1ZJO A;  2FYD B;  3PKP A;  1MC3 A;  4HO3 A;  5C4F A;  1GQ9 A;  3OH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...