3SXGA

Crystal structure of aaaa+udp+gal with mpd as the cryoprotectant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
293
structure length
291
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 291
sequence length 293
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sxgA00
2W0WA 1MP3A 2OI5A 4M4KA 4BQHA 1VZTA 3CKJA 5CMHA 2AM5A 1PZTA 1GQCA 5C1HA 3GUEA 2OI7A 3U2VA 3PKQA 3CKNA 3V8YA 4KXOA 1WT1A 3QVBA 4G3QA 4FREA 4CJBA 2RIXA 1R81A 2W0VA 4NAIA 2RJ5A 3V0OA 3IOIA 2APCA 3SXCA 1G3LA 4FRHA 4D0TA 4Y63A 2YC5A 1JYKA 1PZYB 3R3IA 4Y9XA 3ZF8A 1R80A 2GGOA 5CMIA 4B42A 1FXOA 1H3MA 1NWGB 1ZI4A 2UX8A 3ZGGA 2MZBA 1G2VA 3CKOA 4G3PA 1LZ0A 3BRKX 2BO7A 3OH1A 2YC3A 2AM4A 3SPTA 5AJNA 1FR8A 1VZXA 2Y4JA 4FCUA 2V0KA 2Z87A 2FY7A 5C47A 2RIYA 2XWMA 1NQIB 1ZCTA 2XWLA 1KWSA 1YP2A 5FU0A 4MNDA 1JVGA 3U2WA 4HO2A 3I0JA 4KT7A 2YQJA 4KNRA 3V90A 5JQQA 4Y6NA 2YQHA 3JUJA 4D0ZA 4M2AA 4EEOA 5FU8A 2VS4A 4B4MA 1H5RB 3OAMA 5FTVA 2O1GA 5C3AA 2I5KA 4NAKA 3SXEA 5EIYA 1FO9A 2P73A 3TZTA 1O7OA 4CJ8A 2WE9A 1FWYA 1S4PA 1GQ9A 2P6WA 1H7GA 4B4BA 2WAWA 2XWNA 2BO6A 4DECA 4CVHA 5IFYA 3E25A 4G3SA 4KRVA 3I0EA 2AESA 4EE4A 2OI6A 1WT2A 1G93A 5C49A 2BO4A 3I0CA 4AYJA 4XWIA 1IIMA 3R2WA 1H4DA 2YESA 1H7LA 1FGGA 5IDTA 3RMVA 1GWVA 1GA8A 1YROB 1H4CA 4M28A 3Q4SA 3I0LA 4B3UA 5C8RA 1ZJ1A 2RITA 3HL3A 2FYCB 5CMJA 4Y62A 5CQNX 1VPAA 5DDTA 2OEFA 1LL3A 1ZJOA 5FYEA 3SXAA 1VGZA 4Y7GA 5CMGX 3K8DA 5C38A 1SS9A 1MP5A 4HO6A 1FGXA 3RMWA 2ZU8A 5FV9A 4ASYA 2RJ0A 3D5NA 3RSBA 3JTJA 5C1LA 1FO8A 5J49A 1NF5B 1R7VA 2RIZA 3I0IX 4E1KA 1R7TA 1LL2A 1VICA 3D8VA 2NXVA 5C3BA 4KPZA 3SX8A 1HM9A 3OGZA 4AAWA 2VFZA 1ZJ2A 2V0IA 1TZFA 1FOAA 3E26A 5C48A 1GX4A 3SXBA 1LZ7A 5C4BA 1ZI5A 4Y7FA 4R7PA 2Y4KA 4EE3A 5C4CA 2Y6PA 1H5TB 3IOJA 4LW3A 4GBPA 1VGUA 2WEEA 2WVLA 4D11C 3TQDA 3U0YA 3D98A 3CKQA 4FRPA 1S4OA 3SX5A 3V8ZA 1JVDA 1R7UA 3V0LA 1NHEB 1ZHJA 3OH2A 2WGZA 2D0JA 1S4NA 1H7HA 4AYLA 2PX7A 3PNNA 5L6VA 2V0HA 3I0DA 2I5EA 5AJOA 4D48A 1G8OA 1ZJ0A 1VM8A 3JUKA 3DJ4A 1R7XA 1FXJA 1WT0A 2PA4A 4HO4A 4FQWA 4M2BA 4Y7UA 1MC3A 5CQOA 4HCQA 1NKHB 3F1YA 4DDZA 4ZDQA 1EYRA 3IOHA 4UEGA 1ZDGA 2AH9A 1JV3A 5FUHA 1TW1A 4HO9A 1HM0A 2E3DA 1QG8A 1OMXA 1WVCA 1ZDFA 4G87A 4AC3A 1O23B 1W77A 1OQMB 1LVWA 3I0HA 1QGSA 3U2TA 1LL0A 5FTSA 2OEGA 3DK5A 2AM3A 2E8BA 5IDSA 1LZJA 5AJPA 1R7YA 1H5SA 3Q80A 2JCKA 4KC2A 3OC9A 2VXLA 5I1FA 5CQMX 4FRDA 2ZU9A 4KNXA 3SX7A 4CJCA 1YP3A 1ZCYA 2O1HA 2X5ZA 1ZJ3A 4HO0A 1FZWA 2V0LA 1V84A 4EEAA 2Z86A 4JD0A 4K6RA 2O1FA 3T7NA 2AECA 1ZI1A 5CQPA 1H5SD 1G0RA 1O7QA 5C36A 3F1CA 2ICYA 3SXDA 3USQA 3ZGFA 3DUVA 4KC1A 3V0MA 4YS8A 3U2UA 2RJ9A 4C2SA 4ECMA 1JYLA 3OH3A 2D7RA 2AE7A 1NMMB 3V91A 3OKRA 4JISA 4Y6UA 1H5SB 1G97A 3LW6A 4FRLA 1R82A 2X5SA 3V0NA 4B2WA 1FR9A 3PKPA 3KIAA 1GWWA 1VGTA 1VZUA 2VXMA 3I0FA 4FRAA 5DDVA 5BXCA 2VS3A 3SXGA 1VGWA 2RJ7A 4FROA 1ZJPA 3K8EA 2AGDA 2ICXA 2Y4MA 1VH1A 1G9RA 3NGWA 1ZI3A 1ZCUA 2FYAA 1Z90A 5C4DA 4HO8A 1I52A 4DE7A 2RJ1A 4EVWA 2JCJA 2RJ4A 1ON6A 4NALA 2A8UA 2VS5A 4Y7VA 4EE5A 1W57A 1FRWA 3O3PA 5C4EA 3Q7UA 3CU0A 4EEMA 2BO8A 2JCLA 3BCVA 3EE5A 1ON8A 1HM8A 2CU2A 2WVMA 4HOCA 2VD4A 4MYBA 1WSZA 3T7MA 1K4VA 5C1GA 4ARWA 5HS2A 3FWWA 4NANA 1W55A 1G95A 1H5RA 2XMEA 2RJ8A 3CKVA 3ZLKA 2QKXA 3N9WA 5C3DA 2VSHA 1H7QA 4FRMA 2PGVA 1INJA 1XHBA 1EZIA 1MP4A 1OMZA 3POLA 2V0JA 2A8WA 4D11A 3USRA 1H4EA 4P02A 4FRBA 5EJZA 2WVKA 2D7IA 3T7OA 1HV9A 1V82A 1G23A 2QH5A 4KPXA 1H5SC 4L41C 2DPWA 4Y7TA 2VSIA 3ZLLA 3V0QA 4KC4A 1H7EA 1XZ6A 2YQCA 4EEGA 1GX0A 1QWJA 2YQSA 2FYBA 1ZIZA 2PGYA 3V0PA 2XMHA 3ST8A 1V83A 1VH3A 4B2XA 2P72A 1TVYA 2JCOA 1G1LA 3U0XA 4IRPA 5CQLX 3OH0A 5EJ1A 2FFUA 3SX3A 4IRQA 4HO5A 4Y64A 1YP4A 4LW6A 2Y7AA 4P00A 4B4GA 2RJ6A 1O0RA 1WT3A 4ASJA 2Y4LA 5L6SA 2QGIA 1H7TA 4BMAA 4KQLA 4HO3A 4HG6A 3OH4A 4FCEA 3I0KA 2FYDB 2ZU7A 1HJLA 1QGQA 2FFVA 1TW5A 1INIA 2X65A 3CGXA 2I7BA 1E5KA 1IINA 5C4FA 1FG5N 3I0GA 1H7FA 4J18A 2GGQA 2YCMA 4B5BA 3U2XA 1JV1A 1ZCVA 2X60A 1HJJA 2Q4JA 4FRQA 3FOQA 1H5TA 1LZIA 5CMFX
chains in the Genus database with same CATH superfamily
2W0WA 1MP3A 2OI5A 4M4KA 4BQHA 1VZTA 3CKJA 5CMHA 2AM5A 4O6MA 1PZTA 1GQCA 5C1HA 3GUEA 2OI7A 3U2VA 3PKQA 3CKNA 3V8YA 4KXOA 1WT1A 3QVBA 4G3QA 4FREA 4CJBA 5D92A 2RIXA 1R81A 2W0VA 4NAIA 2RJ5A 3V0OA 3IOIA 2APCA 3SXCA 1G3LA 4FRHA 4D0TA 4Y63A 2YC5A 1JYKA 1PZYB 3R3IA 4Y9XA 3ZF8A 1R80A 2GGOA 5CMIA 4B42A 1FXOA 1H3MA 1NWGB 1ZI4A 2UX8A 3ZGGA 2MZBA 1G2VA 3CKOA 4G3PA 4MIXA 1LZ0A 3BRKX 2BO7A 3OH1A 2YC3A 2AM4A 3SPTA 5AJNA 1FR8A 1VZXA 2Y4JA 4FCUA 2V0KA 2Z87A 2FY7A 5C47A 2RIYA 2XWMA 1NQIB 1ZCTA 2XWLA 1KWSA 1YP2A 5FU0A 4MNDA 1JVGA 3U2WA 4HO2A 3I0JA 4KT7A 2YQJA 4KNRA 4FIXA 4Q7CA 3V90A 5JQQA 4Y6NA 2YQHA 3JUJA 4D0ZA 4M2AA 4EEOA 5FU8A 2VS4A 4B4MA 1H5RB 3OAMA 5FTVA 2O1GA 5C3AA 2I5KA 4NAKA 3SXEA 5EIYA 1FO9A 2P73A 3TZTA 1O7OA 4CJ8A 2WE9A 1FWYA 1S4PA 1GQ9A 5D91A 2P6WA 1H7GA 4B4BA 2WAWA 2XWNA 2BO6A 4DECA 4CVHA 5IFYA 3E25A 4G3SA 4KRVA 3I0EA 2AESA 4EE4A 2OI6A 1WT2A 1G93A 5C49A 2BO4A 3I0CA 4AYJA 4XWIA 1IIMA 3R2WA 1H4DA 2YESA 1H7LA 1FGGA 5IDTA 3RMVA 1GWVA 1GA8A 1YROB 1H4CA 4M28A 3Q4SA 3I0LA 4B3UA 5C8RA 1ZJ1A 2RITA 3HL3A 2FYCB 5CMJA 4Y62A 5CQNX 1VPAA 5DDTA 2OEFA 1LL3A 1ZJOA 5FYEA 3SXAA 1VGZA 4Y7GA 5CMGX 3K8DA 5C38A 1SS9A 1MP5A 4HO6A 1FGXA 3RMWA 2ZU8A 5FV9A 4ASYA 2RJ0A 3D5NA 3RSBA 3JTJA 5C1LA 1FO8A 5J49A 1NF5B 1R7VA 2RIZA 3I0IX 4E1KA 1R7TA 1LL2A 1VICA 3D8VA 2NXVA 5C3BA 4KPZA 3SX8A 1HM9A 3OGZA 4AAWA 2VFZA 1ZJ2A 2V0IA 1TZFA 1FOAA 3E26A 5C48A 1GX4A 3SXBA 1LZ7A 5C4BA 1ZI5A 4Y7FA 4R7PA 2Y4KA 4EE3A 5C4CA 2Y6PA 1H5TB 3IOJA 4LW3A 4GBPA 1VGUA 2WEEA 2WVLA 4D11C 3TQDA 3U0YA 3D98A 3CKQA 4FRPA 1S4OA 3SX5A 3V8ZA 1JVDA 1R7UA 3V0LA 1NHEB 1ZHJA 3OH2A 2WGZA 2D0JA 1S4NA 1H7HA 4AYLA 2PX7A 3PNNA 5L6VA 2V0HA 3I0DA 2I5EA 5AJOA 4D48A 1G8OA 1ZJ0A 1VM8A 3JUKA 3DJ4A 1R7XA 1FXJA 1WT0A 2PA4A 4HO4A 4FQWA 4M2BA 4Y7UA 1MC3A 5CQOA 4HCQA 1NKHB 3F1YA 4DDZA 4ZDQA 1EYRA 2VK9A 3IOHA 4UEGA 1ZDGA 2AH9A 1JV3A 5FUHA 1TW1A 4HO9A 1HM0A 2E3DA 1QG8A 1OMXA 1WVCA 1ZDFA 4G87A 4AC3A 1O23B 1W77A 1OQMB 1LVWA 3I0HA 1QGSA 3U2TA 1LL0A 5FTSA 2OEGA 3DK5A 2AM3A 2E8BA 5IDSA 1LZJA 5AJPA 1R7YA 1H5SA 3Q80A 2JCKA 4KC2A 3OC9A 2VXLA 5I1FA 5CQMX 2C0NA 4FRDA 2ZU9A 4KNXA 3SX7A 4CJCA 1YP3A 1ZCYA 2O1HA 2X5ZA 1ZJ3A 4HO0A 1FZWA 2V0LA 1V84A 4EEAA 2Z86A 4JD0A 4K6RA 2O1FA 3T7NA 2AECA 1ZI1A 5CQPA 1H5SD 1G0RA 2J0AA 2J0BA 1O7QA 5C36A 3F1CA 2ICYA 3SXDA 3USQA 3ZGFA 3DUVA 4KC1A 3V0MA 4YS8A 3U2UA 2RJ9A 4C2SA 4ECMA 1JYLA 3OH3A 2D7RA 2AE7A 1NMMB 3V91A 3OKRA 4JISA 4Y6UA 1H5SB 1G97A 3LW6A 4FRLA 1R82A 2X5SA 3V0NA 4B2WA 1FR9A 3PKPA 3KIAA 1GWWA 1VGTA 1VZUA 2VXMA 3I0FA 4FRAA 5DDVA 5BXCA 2VS3A 3SXGA 1VGWA 2RJ7A 4FROA 1ZJPA 3K8EA 2AGDA 2ICXA 2Y4MA 1VH1A 1G9RA 3NGWA 1ZI3A 1ZCUA 2FYAA 1Z90A 5C4DA 4HO8A 1I52A 4DE7A 2RJ1A 4EVWA 2JCJA 2RJ4A 1ON6A 4NALA 2A8UA 2VS5A 4Y7VA 4EE5A 1W57A 1FRWA 3O3PA 5C4EA 3Q7UA 3CU0A 4EEMA 2BO8A 2JCLA 3BCVA 3EE5A 1ON8A 1HM8A 2CU2A 2WVMA 4HOCA 2VD4A 4MYBA 1WSZA 3T7MA 1K4VA 5C1GA 4ARWA 5HS2A 3FWWA 4NANA 1W55A 1G95A 1H5RA 2XMEA 2RJ8A 3CKVA 3ZLKA 2QKXA 3N9WA 5C3DA 2VSHA 1H7QA 4FRMA 2PGVA 1INJA 1XHBA 1EZIA 1MP4A 1OMZA 3POLA 2V0JA 2A8WA 4D11A 3USRA 1H4EA 4P02A 4FRBA 5EJZA 2WVKA 2D7IA 3T7OA 4O6NA 1HV9A 1V82A 1G23A 2QH5A 4KPXA 1H5SC 4L41C 2DPWA 4Y7TA 2VSIA 3ZLLA 3V0QA 4KC4A 1H7EA 1XZ6A 2YQCA 4EEGA 1GX0A 1QWJA 2YQSA 2FYBA 1ZIZA 2PGYA 3V0PA 2XMHA 3ST8A 1V83A 1VH3A 4B2XA 2P72A 1TVYA 2JCOA 1G1LA 3U0XA 4IRPA 5CQLX 3OH0A 5EJ1A 2FFUA 3SX3A 4IRQA 4HO5A 4Y64A 1YP4A 4LW6A 2Y7AA 4P00A 4B4GA 2RJ6A 4FIYA 1O0RA 1WT3A 4ASJA 2Y4LA 5L6SA 2QGIA 1H7TA 4BMAA 4KQLA 4HO3A 4HG6A 3OH4A 4FCEA 3I0KA 2FYDB 2ZU7A 1HJLA 1QGQA 2FFVA 1TW5A 1INIA 2X65A 3CGXA 2I7BA 1E5KA 1IINA 5C4FA 1FG5N 3I0GA 1H7FA 4J18A 2GGQA 2YCMA 4B5BA 3U2XA 1JV1A 1ZCVA 2X60A 1HJJA 2Q4JA 4FRQA 3FOQA 1H5TA 1LZIA 5CMFX
chains in the Genus database with same CATH topology
2W0WA 1MP3A 2OI5A 4M4KA 4BQHA 1VZTA 3CKJA 5CMHA 2AM5A 4O6MA 1PZTA 1GQCA 5C1HA 3GUEA 2OI7A 3U2VA 3PKQA 3CKNA 3V8YA 4KXOA 1WT1A 3QVBA 4G3QA 4FREA 4CJBA 5D92A 2RIXA 1R81A 2W0VA 4NAIA 2RJ5A 3V0OA 3IOIA 2APCA 3SXCA 1G3LA 4FRHA 4D0TA 4Y63A 2YC5A 1JYKA 1PZYB 3R3IA 4Y9XA 3ZF8A 1R80A 2GGOA 5CMIA 4B42A 1FXOA 1H3MA 1NWGB 1ZI4A 2UX8A 3ZGGA 2MZBA 1G2VA 3CKOA 4G3PA 4MIXA 1LZ0A 3BRKX 2BO7A 3OH1A 2YC3A 2AM4A 3SPTA 5AJNA 1FR8A 1VZXA 2Y4JA 4FCUA 2V0KA 2Z87A 2FY7A 5C47A 2RIYA 2XWMA 1NQIB 1ZCTA 2XWLA 1KWSA 1YP2A 5FU0A 4MNDA 1JVGA 3U2WA 4HO2A 3I0JA 4KT7A 2YQJA 4KNRA 4FIXA 4Q7CA 3V90A 5JQQA 4Y6NA 2YQHA 3JUJA 4D0ZA 4M2AA 4EEOA 5FU8A 2VS4A 4B4MA 1H5RB 3OAMA 5FTVA 2O1GA 5C3AA 2I5KA 4NAKA 3SXEA 5EIYA 1FO9A 2P73A 3TZTA 1O7OA 4CJ8A 2WE9A 1FWYA 1S4PA 1GQ9A 5D91A 2P6WA 1H7GA 4B4BA 2WAWA 2XWNA 2BO6A 4DECA 4CVHA 5IFYA 3E25A 4G3SA 4KRVA 3I0EA 2AESA 4EE4A 2OI6A 1WT2A 1G93A 5C49A 2BO4A 3I0CA 4AYJA 4XWIA 1IIMA 3R2WA 1H4DA 2YESA 1H7LA 1FGGA 5IDTA 3RMVA 1GWVA 1GA8A 1YROB 1H4CA 4M28A 3Q4SA 3I0LA 4B3UA 5C8RA 1ZJ1A 2RITA 3HL3A 2FYCB 5CMJA 4Y62A 5CQNX 1VPAA 5DDTA 2OEFA 1LL3A 1ZJOA 5FYEA 3SXAA 1VGZA 4Y7GA 5CMGX 3K8DA 5C38A 1SS9A 1MP5A 4HO6A 1FGXA 3RMWA 2ZU8A 5FV9A 4ASYA 2RJ0A 3D5NA 3RSBA 3JTJA 5C1LA 1FO8A 5J49A 1NF5B 1R7VA 2RIZA 3I0IX 4E1KA 1R7TA 1LL2A 1VICA 3D8VA 2NXVA 5C3BA 4KPZA 3SX8A 1HM9A 3OGZA 4AAWA 2VFZA 1ZJ2A 2V0IA 1TZFA 1FOAA 3E26A 5C48A 1GX4A 3SXBA 1LZ7A 5C4BA 1ZI5A 4Y7FA 4R7PA 2Y4KA 4EE3A 5C4CA 2Y6PA 1H5TB 3IOJA 4LW3A 4GBPA 1VGUA 2WEEA 2WVLA 4D11C 3TQDA 3U0YA 3D98A 3CKQA 4FRPA 1S4OA 3SX5A 3V8ZA 1JVDA 1R7UA 3V0LA 1NHEB 1ZHJA 3OH2A 2WGZA 2D0JA 1S4NA 1H7HA 4AYLA 2PX7A 3PNNA 5L6VA 2V0HA 3I0DA 2I5EA 5AJOA 4D48A 1G8OA 1ZJ0A 1VM8A 3JUKA 3DJ4A 1R7XA 1FXJA 1WT0A 2PA4A 4HO4A 4FQWA 4M2BA 4Y7UA 1MC3A 5CQOA 4HCQA 1NKHB 3F1YA 4DDZA 4ZDQA 1EYRA 2VK9A 3IOHA 4UEGA 1ZDGA 2AH9A 1JV3A 5FUHA 1TW1A 4HO9A 1HM0A 2E3DA 1QG8A 1OMXA 1WVCA 1ZDFA 4G87A 4AC3A 1O23B 1W77A 1OQMB 1LVWA 3I0HA 1QGSA 3U2TA 1LL0A 5FTSA 2OEGA 3DK5A 2AM3A 2E8BA 5IDSA 1LZJA 5AJPA 1R7YA 1H5SA 3Q80A 2JCKA 4KC2A 3OC9A 2VXLA 5I1FA 5CQMX 2C0NA 4FRDA 2ZU9A 4KNXA 3SX7A 4CJCA 1YP3A 1ZCYA 2O1HA 2X5ZA 1ZJ3A 4HO0A 1FZWA 2V0LA 1V84A 4EEAA 2Z86A 4JD0A 4K6RA 2O1FA 3T7NA 2AECA 1ZI1A 5CQPA 1H5SD 1G0RA 2J0AA 2J0BA 1O7QA 5C36A 3F1CA 2ICYA 3SXDA 3USQA 3ZGFA 3DUVA 4KC1A 3V0MA 4YS8A 3U2UA 2RJ9A 4C2SA 4ECMA 1JYLA 3OH3A 2D7RA 2AE7A 1NMMB 3V91A 3OKRA 4JISA 4Y6UA 1H5SB 1G97A 3LW6A 4FRLA 1R82A 2X5SA 3V0NA 4B2WA 1FR9A 3PKPA 3KIAA 1GWWA 1VGTA 1VZUA 2VXMA 3I0FA 4FRAA 5DDVA 5BXCA 2VS3A 3SXGA 1VGWA 2RJ7A 4FROA 1ZJPA 3K8EA 2AGDA 2ICXA 2Y4MA 1VH1A 1G9RA 3NGWA 1ZI3A 1ZCUA 2FYAA 1Z90A 5C4DA 4HO8A 1I52A 4DE7A 2RJ1A 4EVWA 2JCJA 2RJ4A 1ON6A 4NALA 2A8UA 2VS5A 4Y7VA 4EE5A 1W57A 1FRWA 3O3PA 5C4EA 3Q7UA 3CU0A 4EEMA 2BO8A 2JCLA 3BCVA 3EE5A 1ON8A 1HM8A 2CU2A 2WVMA 4HOCA 2VD4A 4MYBA 1WSZA 3T7MA 1K4VA 5C1GA 4ARWA 5HS2A 3FWWA 4NANA 1W55A 1G95A 1H5RA 2XMEA 2RJ8A 3CKVA 3ZLKA 2QKXA 3N9WA 5C3DA 2VSHA 1H7QA 4FRMA 2PGVA 1INJA 1XHBA 1EZIA 1MP4A 1OMZA 3POLA 2V0JA 2A8WA 4D11A 3USRA 1H4EA 4P02A 4FRBA 5EJZA 2WVKA 2D7IA 3T7OA 4O6NA 1HV9A 1V82A 1G23A 2QH5A 4KPXA 1H5SC 4L41C 2DPWA 4Y7TA 2VSIA 3ZLLA 3V0QA 4KC4A 1H7EA 1XZ6A 2YQCA 4EEGA 1GX0A 1QWJA 2YQSA 2FYBA 1ZIZA 2PGYA 3V0PA 2XMHA 3ST8A 1V83A 1VH3A 4B2XA 2P72A 1TVYA 2JCOA 1G1LA 3U0XA 4IRPA 5CQLX 3OH0A 5EJ1A 2FFUA 3SX3A 4IRQA 4HO5A 4Y64A 1YP4A 4LW6A 2Y7AA 4P00A 4B4GA 2RJ6A 4FIYA 1O0RA 1WT3A 4ASJA 2Y4LA 5L6SA 2QGIA 1H7TA 4BMAA 4KQLA 4HO3A 4HG6A 3OH4A 4FCEA 3I0KA 2FYDB 2ZU7A 1HJLA 1QGQA 2FFVA 1TW5A 1INIA 2X65A 3CGXA 2I7BA 1E5KA 1IINA 5C4FA 1FG5N 3I0GA 1H7FA 4J18A 2GGQA 2YCMA 4B5BA 3U2XA 1JV1A 1ZCVA 2X60A 1HJJA 2Q4JA 4FRQA 3FOQA 1H5TA 1LZIA 5CMFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0W A;  1MP3 A;  2OI5 A;  4M4K A;  4BQH A;  1VZT A;  3CKJ A;  5CMH A;  2AM5 A;  1PZT A;  1GQC A;  5C1H A;  3GUE A;  2OI7 A;  3U2V A;  3PKQ A;  3CKN A;  3V8Y A;  4KXO A;  1WT1 A;  3QVB A;  4G3Q A;  4FRE A;  4CJB A;  2RIX A;  1R81 A;  2W0V A;  4NAI A;  2RJ5 A;  3V0O A;  3IOI A;  2APC A;  3SXC A;  1G3L A;  4FRH A;  4D0T A;  4Y63 A;  2YC5 A;  1JYK A;  1PZY B;  3R3I A;  4Y9X A;  3ZF8 A;  1R80 A;  2GGO A;  5CMI A;  4B42 A;  1FXO A;  1H3M A;  1NWG B;  1ZI4 A;  2UX8 A;  3ZGG A;  2MZB A;  1G2V A;  3CKO A;  4G3P A;  1LZ0 A;  3BRK X;  2BO7 A;  3OH1 A;  2YC3 A;  2AM4 A;  3SPT A;  5AJN A;  1FR8 A;  1VZX A;  2Y4J A;  4FCU A;  2V0K A;  2Z87 A;  2FY7 A;  5C47 A;  2RIY A;  2XWM A;  1NQI B;  1ZCT A;  2XWL A;  1KWS A;  1YP2 A;  5FU0 A;  4MND A;  1JVG A;  3U2W A;  4HO2 A;  3I0J A;  4KT7 A;  2YQJ A;  4KNR A;  3V90 A;  5JQQ A;  4Y6N A;  2YQH A;  3JUJ A;  4D0Z A;  4M2A A;  4EEO A;  5FU8 A;  2VS4 A;  4B4M A;  1H5R B;  3OAM A;  5FTV A;  2O1G A;  5C3A A;  2I5K A;  4NAK A;  3SXE A;  5EIY A;  1FO9 A;  2P73 A;  3TZT A;  1O7O A;  4CJ8 A;  2WE9 A;  1FWY A;  1S4P A;  1GQ9 A;  2P6W A;  1H7G A;  4B4B A;  2WAW A;  2XWN A;  2BO6 A;  4DEC A;  4CVH A;  5IFY A;  3E25 A;  4G3S A;  4KRV A;  3I0E A;  2AES A;  4EE4 A;  2OI6 A;  1WT2 A;  1G93 A;  5C49 A;  2BO4 A;  3I0C A;  4AYJ A;  4XWI A;  1IIM A;  3R2W A;  1H4D A;  2YES A;  1H7L A;  1FGG A;  5IDT A;  3RMV A;  1GWV A;  1GA8 A;  1YRO B;  1H4C A;  4M28 A;  3Q4S A;  3I0L A;  4B3U A;  5C8R A;  1ZJ1 A;  2RIT A;  3HL3 A;  2FYC B;  5CMJ A;  4Y62 A;  5CQN X;  1VPA A;  5DDT A;  2OEF A;  1LL3 A;  1ZJO A;  5FYE A;  3SXA A;  1VGZ A;  4Y7G A;  5CMG X;  3K8D A;  5C38 A;  1SS9 A;  1MP5 A;  4HO6 A;  1FGX A;  3RMW A;  2ZU8 A;  5FV9 A;  4ASY A;  2RJ0 A;  3D5N A;  3RSB A;  3JTJ A;  5C1L A;  1FO8 A;  5J49 A;  1NF5 B;  1R7V A;  2RIZ A;  3I0I X;  4E1K A;  1R7T A;  1LL2 A;  1VIC A;  3D8V A;  2NXV A;  5C3B A;  4KPZ A;  3SX8 A;  1HM9 A;  3OGZ A;  4AAW A;  2VFZ A;  1ZJ2 A;  2V0I A;  1TZF A;  1FOA A;  3E26 A;  5C48 A;  1GX4 A;  3SXB A;  1LZ7 A;  5C4B A;  1ZI5 A;  4Y7F A;  4R7P A;  2Y4K A;  4EE3 A;  5C4C A;  2Y6P A;  1H5T B;  3IOJ A;  4LW3 A;  4GBP A;  1VGU A;  2WEE A;  2WVL A;  4D11 C;  3TQD A;  3U0Y A;  3D98 A;  3CKQ A;  4FRP A;  1S4O A;  3SX5 A;  3V8Z A;  1JVD A;  1R7U A;  3V0L A;  1NHE B;  1ZHJ A;  3OH2 A;  2WGZ A;  2D0J A;  1S4N A;  1H7H A;  4AYL A;  2PX7 A;  3PNN A;  5L6V A;  2V0H A;  3I0D A;  2I5E A;  5AJO A;  4D48 A;  1G8O A;  1ZJ0 A;  1VM8 A;  3JUK A;  3DJ4 A;  1R7X A;  1FXJ A;  1WT0 A;  2PA4 A;  4HO4 A;  4FQW A;  4M2B A;  4Y7U A;  1MC3 A;  5CQO A;  4HCQ A;  1NKH B;  3F1Y A;  4DDZ A;  4ZDQ A;  1EYR A;  3IOH A;  4UEG A;  1ZDG A;  2AH9 A;  1JV3 A;  5FUH A;  1TW1 A;  4HO9 A;  1HM0 A;  2E3D A;  1QG8 A;  1OMX A;  1WVC A;  1ZDF A;  4G87 A;  4AC3 A;  1O23 B;  1W77 A;  1OQM B;  1LVW A;  3I0H A;  1QGS A;  3U2T A;  1LL0 A;  5FTS A;  2OEG A;  3DK5 A;  2AM3 A;  2E8B A;  5IDS A;  1LZJ A;  5AJP A;  1R7Y A;  1H5S A;  3Q80 A;  2JCK A;  4KC2 A;  3OC9 A;  2VXL A;  5I1F A;  5CQM X;  4FRD A;  2ZU9 A;  4KNX A;  3SX7 A;  4CJC A;  1YP3 A;  1ZCY A;  2O1H A;  2X5Z A;  1ZJ3 A;  4HO0 A;  1FZW A;  2V0L A;  1V84 A;  4EEA A;  2Z86 A;  4JD0 A;  4K6R A;  2O1F A;  3T7N A;  2AEC A;  1ZI1 A;  5CQP A;  1H5S D;  1G0R A;  1O7Q A;  5C36 A;  3F1C A;  2ICY A;  3SXD A;  3USQ A;  3ZGF A;  3DUV A;  4KC1 A;  3V0M A;  4YS8 A;  3U2U A;  2RJ9 A;  4C2S A;  4ECM A;  1JYL A;  3OH3 A;  2D7R A;  2AE7 A;  1NMM B;  3V91 A;  3OKR A;  4JIS A;  4Y6U A;  1H5S B;  1G97 A;  3LW6 A;  4FRL A;  1R82 A;  2X5S A;  3V0N A;  4B2W A;  1FR9 A;  3PKP A;  3KIA A;  1GWW A;  1VGT A;  1VZU A;  2VXM A;  3I0F A;  4FRA A;  5DDV A;  5BXC A;  2VS3 A;  3SXG A;  1VGW A;  2RJ7 A;  4FRO A;  1ZJP A;  3K8E A;  2AGD A;  2ICX A;  2Y4M A;  1VH1 A;  1G9R A;  3NGW A;  1ZI3 A;  1ZCU A;  2FYA A;  1Z90 A;  5C4D A;  4HO8 A;  1I52 A;  4DE7 A;  2RJ1 A;  4EVW A;  2JCJ A;  2RJ4 A;  1ON6 A;  4NAL A;  2A8U A;  2VS5 A;  4Y7V A;  4EE5 A;  1W57 A;  1FRW A;  3O3P A;  5C4E A;  3Q7U A;  3CU0 A;  4EEM A;  2BO8 A;  2JCL A;  3BCV A;  3EE5 A;  1ON8 A;  1HM8 A;  2CU2 A;  2WVM A;  4HOC A;  2VD4 A;  4MYB A;  1WSZ A;  3T7M A;  1K4V A;  5C1G A;  4ARW A;  5HS2 A;  3FWW A;  4NAN A;  1W55 A;  1G95 A;  1H5R A;  2XME A;  2RJ8 A;  3CKV A;  3ZLK A;  2QKX A;  3N9W A;  5C3D A;  2VSH A;  1H7Q A;  4FRM A;  2PGV A;  1INJ A;  1XHB A;  1EZI A;  1MP4 A;  1OMZ A;  3POL A;  2V0J A;  2A8W A;  4D11 A;  3USR A;  1H4E A;  4P02 A;  4FRB A;  5EJZ A;  2WVK A;  2D7I A;  3T7O A;  1HV9 A;  1V82 A;  1G23 A;  2QH5 A;  4KPX A;  1H5S C;  4L41 C;  2DPW A;  4Y7T A;  2VSI A;  3ZLL A;  3V0Q A;  4KC4 A;  1H7E A;  1XZ6 A;  2YQC A;  4EEG A;  1GX0 A;  1QWJ A;  2YQS A;  2FYB A;  1ZIZ A;  2PGY A;  3V0P A;  2XMH A;  3ST8 A;  1V83 A;  1VH3 A;  4B2X A;  2P72 A;  1TVY A;  2JCO A;  1G1L A;  3U0X A;  4IRP A;  5CQL X;  3OH0 A;  5EJ1 A;  2FFU A;  3SX3 A;  4IRQ A;  4HO5 A;  4Y64 A;  1YP4 A;  4LW6 A;  2Y7A A;  4P00 A;  4B4G A;  2RJ6 A;  1O0R A;  1WT3 A;  4ASJ A;  2Y4L A;  5L6S A;  2QGI A;  1H7T A;  4BMA A;  4KQL A;  4HO3 A;  4HG6 A;  3OH4 A;  4FCE A;  3I0K A;  2FYD B;  2ZU7 A;  1HJL A;  1QGQ A;  2FFV A;  1TW5 A;  1INI A;  2X65 A;  3CGX A;  2I7B A;  1E5K A;  1IIN A;  5C4F A;  1FG5 N;  3I0G A;  1H7F A;  4J18 A;  2GGQ A;  2YCM A;  4B5B A;  3U2X A;  1JV1 A;  1ZCV A;  2X60 A;  1HJJ A;  2Q4J A;  4FRQ A;  3FOQ A;  1H5T A;  1LZI A;  5CMF X; 
#chains in the Genus database with same CATH topology
 2W0W A;  1MP3 A;  2OI5 A;  4M4K A;  4BQH A;  1VZT A;  3CKJ A;  5CMH A;  2AM5 A;  4O6M A;  1PZT A;  1GQC A;  5C1H A;  3GUE A;  2OI7 A;  3U2V A;  3PKQ A;  3CKN A;  3V8Y A;  4KXO A;  1WT1 A;  3QVB A;  4G3Q A;  4FRE A;  4CJB A;  5D92 A;  2RIX A;  1R81 A;  2W0V A;  4NAI A;  2RJ5 A;  3V0O A;  3IOI A;  2APC A;  3SXC A;  1G3L A;  4FRH A;  4D0T A;  4Y63 A;  2YC5 A;  1JYK A;  1PZY B;  3R3I A;  4Y9X A;  3ZF8 A;  1R80 A;  2GGO A;  5CMI A;  4B42 A;  1FXO A;  1H3M A;  1NWG B;  1ZI4 A;  2UX8 A;  3ZGG A;  2MZB A;  1G2V A;  3CKO A;  4G3P A;  4MIX A;  1LZ0 A;  3BRK X;  2BO7 A;  3OH1 A;  2YC3 A;  2AM4 A;  3SPT A;  5AJN A;  1FR8 A;  1VZX A;  2Y4J A;  4FCU A;  2V0K A;  2Z87 A;  2FY7 A;  5C47 A;  2RIY A;  2XWM A;  1NQI B;  1ZCT A;  2XWL A;  1KWS A;  1YP2 A;  5FU0 A;  4MND A;  1JVG A;  3U2W A;  4HO2 A;  3I0J A;  4KT7 A;  2YQJ A;  4KNR A;  4FIX A;  4Q7C A;  3V90 A;  5JQQ A;  4Y6N A;  2YQH A;  3JUJ A;  4D0Z A;  4M2A A;  4EEO A;  5FU8 A;  2VS4 A;  4B4M A;  1H5R B;  3OAM A;  5FTV A;  2O1G A;  5C3A A;  2I5K A;  4NAK A;  3SXE A;  5EIY A;  1FO9 A;  2P73 A;  3TZT A;  1O7O A;  4CJ8 A;  2WE9 A;  1FWY A;  1S4P A;  1GQ9 A;  5D91 A;  2P6W A;  1H7G A;  4B4B A;  2WAW A;  2XWN A;  2BO6 A;  4DEC A;  4CVH A;  5IFY A;  3E25 A;  4G3S A;  4KRV A;  3I0E A;  2AES A;  4EE4 A;  2OI6 A;  1WT2 A;  1G93 A;  5C49 A;  2BO4 A;  3I0C A;  4AYJ A;  4XWI A;  1IIM A;  3R2W A;  1H4D A;  2YES A;  1H7L A;  1FGG A;  5IDT A;  3RMV A;  1GWV A;  1GA8 A;  1YRO B;  1H4C A;  4M28 A;  3Q4S A;  3I0L A;  4B3U A;  5C8R A;  1ZJ1 A;  2RIT A;  3HL3 A;  2FYC B;  5CMJ A;  4Y62 A;  5CQN X;  1VPA A;  5DDT A;  2OEF A;  1LL3 A;  1ZJO A;  5FYE A;  3SXA A;  1VGZ A;  4Y7G A;  5CMG X;  3K8D A;  5C38 A;  1SS9 A;  1MP5 A;  4HO6 A;  1FGX A;  3RMW A;  2ZU8 A;  5FV9 A;  4ASY A;  2RJ0 A;  3D5N A;  3RSB A;  3JTJ A;  5C1L A;  1FO8 A;  5J49 A;  1NF5 B;  1R7V A;  2RIZ A;  3I0I X;  4E1K A;  1R7T A;  1LL2 A;  1VIC A;  3D8V A;  2NXV A;  5C3B A;  4KPZ A;  3SX8 A;  1HM9 A;  3OGZ A;  4AAW A;  2VFZ A;  1ZJ2 A;  2V0I A;  1TZF A;  1FOA A;  3E26 A;  5C48 A;  1GX4 A;  3SXB A;  1LZ7 A;  5C4B A;  1ZI5 A;  4Y7F A;  4R7P A;  2Y4K A;  4EE3 A;  5C4C A;  2Y6P A;  1H5T B;  3IOJ A;  4LW3 A;  4GBP A;  1VGU A;  2WEE A;  2WVL A;  4D11 C;  3TQD A;  3U0Y A;  3D98 A;  3CKQ A;  4FRP A;  1S4O A;  3SX5 A;  3V8Z A;  1JVD A;  1R7U A;  3V0L A;  1NHE B;  1ZHJ A;  3OH2 A;  2WGZ A;  2D0J A;  1S4N A;  1H7H A;  4AYL A;  2PX7 A;  3PNN A;  5L6V A;  2V0H A;  3I0D A;  2I5E A;  5AJO A;  4D48 A;  1G8O A;  1ZJ0 A;  1VM8 A;  3JUK A;  3DJ4 A;  1R7X A;  1FXJ A;  1WT0 A;  2PA4 A;  4HO4 A;  4FQW A;  4M2B A;  4Y7U A;  1MC3 A;  5CQO A;  4HCQ A;  1NKH B;  3F1Y A;  4DDZ A;  4ZDQ A;  1EYR A;  2VK9 A;  3IOH A;  4UEG A;  1ZDG A;  2AH9 A;  1JV3 A;  5FUH A;  1TW1 A;  4HO9 A;  1HM0 A;  2E3D A;  1QG8 A;  1OMX A;  1WVC A;  1ZDF A;  4G87 A;  4AC3 A;  1O23 B;  1W77 A;  1OQM B;  1LVW A;  3I0H A;  1QGS A;  3U2T A;  1LL0 A;  5FTS A;  2OEG A;  3DK5 A;  2AM3 A;  2E8B A;  5IDS A;  1LZJ A;  5AJP A;  1R7Y A;  1H5S A;  3Q80 A;  2JCK A;  4KC2 A;  3OC9 A;  2VXL A;  5I1F A;  5CQM X;  2C0N A;  4FRD A;  2ZU9 A;  4KNX A;  3SX7 A;  4CJC A;  1YP3 A;  1ZCY A;  2O1H A;  2X5Z A;  1ZJ3 A;  4HO0 A;  1FZW A;  2V0L A;  1V84 A;  4EEA A;  2Z86 A;  4JD0 A;  4K6R A;  2O1F A;  3T7N A;  2AEC A;  1ZI1 A;  5CQP A;  1H5S D;  1G0R A;  2J0A A;  2J0B A;  1O7Q A;  5C36 A;  3F1C A;  2ICY A;  3SXD A;  3USQ A;  3ZGF A;  3DUV A;  4KC1 A;  3V0M A;  4YS8 A;  3U2U A;  2RJ9 A;  4C2S A;  4ECM A;  1JYL A;  3OH3 A;  2D7R A;  2AE7 A;  1NMM B;  3V91 A;  3OKR A;  4JIS A;  4Y6U A;  1H5S B;  1G97 A;  3LW6 A;  4FRL A;  1R82 A;  2X5S A;  3V0N A;  4B2W A;  1FR9 A;  3PKP A;  3KIA A;  1GWW A;  1VGT A;  1VZU A;  2VXM A;  3I0F A;  4FRA A;  5DDV A;  5BXC A;  2VS3 A;  3SXG A;  1VGW A;  2RJ7 A;  4FRO A;  1ZJP A;  3K8E A;  2AGD A;  2ICX A;  2Y4M A;  1VH1 A;  1G9R A;  3NGW A;  1ZI3 A;  1ZCU A;  2FYA A;  1Z90 A;  5C4D A;  4HO8 A;  1I52 A;  4DE7 A;  2RJ1 A;  4EVW A;  2JCJ A;  2RJ4 A;  1ON6 A;  4NAL A;  2A8U A;  2VS5 A;  4Y7V A;  4EE5 A;  1W57 A;  1FRW A;  3O3P A;  5C4E A;  3Q7U A;  3CU0 A;  4EEM A;  2BO8 A;  2JCL A;  3BCV A;  3EE5 A;  1ON8 A;  1HM8 A;  2CU2 A;  2WVM A;  4HOC A;  2VD4 A;  4MYB A;  1WSZ A;  3T7M A;  1K4V A;  5C1G A;  4ARW A;  5HS2 A;  3FWW A;  4NAN A;  1W55 A;  1G95 A;  1H5R A;  2XME A;  2RJ8 A;  3CKV A;  3ZLK A;  2QKX A;  3N9W A;  5C3D A;  2VSH A;  1H7Q A;  4FRM A;  2PGV A;  1INJ A;  1XHB A;  1EZI A;  1MP4 A;  1OMZ A;  3POL A;  2V0J A;  2A8W A;  4D11 A;  3USR A;  1H4E A;  4P02 A;  4FRB A;  5EJZ A;  2WVK A;  2D7I A;  3T7O A;  4O6N A;  1HV9 A;  1V82 A;  1G23 A;  2QH5 A;  4KPX A;  1H5S C;  4L41 C;  2DPW A;  4Y7T A;  2VSI A;  3ZLL A;  3V0Q A;  4KC4 A;  1H7E A;  1XZ6 A;  2YQC A;  4EEG A;  1GX0 A;  1QWJ A;  2YQS A;  2FYB A;  1ZIZ A;  2PGY A;  3V0P A;  2XMH A;  3ST8 A;  1V83 A;  1VH3 A;  4B2X A;  2P72 A;  1TVY A;  2JCO A;  1G1L A;  3U0X A;  4IRP A;  5CQL X;  3OH0 A;  5EJ1 A;  2FFU A;  3SX3 A;  4IRQ A;  4HO5 A;  4Y64 A;  1YP4 A;  4LW6 A;  2Y7A A;  4P00 A;  4B4G A;  2RJ6 A;  4FIY A;  1O0R A;  1WT3 A;  4ASJ A;  2Y4L A;  5L6S A;  2QGI A;  1H7T A;  4BMA A;  4KQL A;  4HO3 A;  4HG6 A;  3OH4 A;  4FCE A;  3I0K A;  2FYD B;  2ZU7 A;  1HJL A;  1QGQ A;  2FFV A;  1TW5 A;  1INI A;  2X65 A;  3CGX A;  2I7B A;  1E5K A;  1IIN A;  5C4F A;  1FG5 N;  3I0G A;  1H7F A;  4J18 A;  2GGQ A;  2YCM A;  4B5B A;  3U2X A;  1JV1 A;  1ZCV A;  2X60 A;  1HJJ A;  2Q4J A;  4FRQ A;  3FOQ A;  1H5T A;  1LZI A;  5CMF X; 
#chains in the Genus database with same CATH homology
 2W0W A;  1MP3 A;  2OI5 A;  4M4K A;  4BQH A;  1VZT A;  3CKJ A;  5CMH A;  2AM5 A;  4O6M A;  1PZT A;  1GQC A;  5C1H A;  3GUE A;  2OI7 A;  3U2V A;  3PKQ A;  3CKN A;  3V8Y A;  4KXO A;  1WT1 A;  3QVB A;  4G3Q A;  4FRE A;  4CJB A;  5D92 A;  2RIX A;  1R81 A;  2W0V A;  4NAI A;  2RJ5 A;  3V0O A;  3IOI A;  2APC A;  3SXC A;  1G3L A;  4FRH A;  4D0T A;  4Y63 A;  2YC5 A;  1JYK A;  1PZY B;  3R3I A;  4Y9X A;  3ZF8 A;  1R80 A;  2GGO A;  5CMI A;  4B42 A;  1FXO A;  1H3M A;  1NWG B;  1ZI4 A;  2UX8 A;  3ZGG A;  2MZB A;  1G2V A;  3CKO A;  4G3P A;  4MIX A;  1LZ0 A;  3BRK X;  2BO7 A;  3OH1 A;  2YC3 A;  2AM4 A;  3SPT A;  5AJN A;  1FR8 A;  1VZX A;  2Y4J A;  4FCU A;  2V0K A;  2Z87 A;  2FY7 A;  5C47 A;  2RIY A;  2XWM A;  1NQI B;  1ZCT A;  2XWL A;  1KWS A;  1YP2 A;  5FU0 A;  4MND A;  1JVG A;  3U2W A;  4HO2 A;  3I0J A;  4KT7 A;  2YQJ A;  4KNR A;  4FIX A;  4Q7C A;  3V90 A;  5JQQ A;  4Y6N A;  2YQH A;  3JUJ A;  4D0Z A;  4M2A A;  4EEO A;  5FU8 A;  2VS4 A;  4B4M A;  1H5R B;  3OAM A;  5FTV A;  2O1G A;  5C3A A;  2I5K A;  4NAK A;  3SXE A;  5EIY A;  1FO9 A;  2P73 A;  3TZT A;  1O7O A;  4CJ8 A;  2WE9 A;  1FWY A;  1S4P A;  1GQ9 A;  5D91 A;  2P6W A;  1H7G A;  4B4B A;  2WAW A;  2XWN A;  2BO6 A;  4DEC A;  4CVH A;  5IFY A;  3E25 A;  4G3S A;  4KRV A;  3I0E A;  2AES A;  4EE4 A;  2OI6 A;  1WT2 A;  1G93 A;  5C49 A;  2BO4 A;  3I0C A;  4AYJ A;  4XWI A;  1IIM A;  3R2W A;  1H4D A;  2YES A;  1H7L A;  1FGG A;  5IDT A;  3RMV A;  1GWV A;  1GA8 A;  1YRO B;  1H4C A;  4M28 A;  3Q4S A;  3I0L A;  4B3U A;  5C8R A;  1ZJ1 A;  2RIT A;  3HL3 A;  2FYC B;  5CMJ A;  4Y62 A;  5CQN X;  1VPA A;  5DDT A;  2OEF A;  1LL3 A;  1ZJO A;  5FYE A;  3SXA A;  1VGZ A;  4Y7G A;  5CMG X;  3K8D A;  5C38 A;  1SS9 A;  1MP5 A;  4HO6 A;  1FGX A;  3RMW A;  2ZU8 A;  5FV9 A;  4ASY A;  2RJ0 A;  3D5N A;  3RSB A;  3JTJ A;  5C1L A;  1FO8 A;  5J49 A;  1NF5 B;  1R7V A;  2RIZ A;  3I0I X;  4E1K A;  1R7T A;  1LL2 A;  1VIC A;  3D8V A;  2NXV A;  5C3B A;  4KPZ A;  3SX8 A;  1HM9 A;  3OGZ A;  4AAW A;  2VFZ A;  1ZJ2 A;  2V0I A;  1TZF A;  1FOA A;  3E26 A;  5C48 A;  1GX4 A;  3SXB A;  1LZ7 A;  5C4B A;  1ZI5 A;  4Y7F A;  4R7P A;  2Y4K A;  4EE3 A;  5C4C A;  2Y6P A;  1H5T B;  3IOJ A;  4LW3 A;  4GBP A;  1VGU A;  2WEE A;  2WVL A;  4D11 C;  3TQD A;  3U0Y A;  3D98 A;  3CKQ A;  4FRP A;  1S4O A;  3SX5 A;  3V8Z A;  1JVD A;  1R7U A;  3V0L A;  1NHE B;  1ZHJ A;  3OH2 A;  2WGZ A;  2D0J A;  1S4N A;  1H7H A;  4AYL A;  2PX7 A;  3PNN A;  5L6V A;  2V0H A;  3I0D A;  2I5E A;  5AJO A;  4D48 A;  1G8O A;  1ZJ0 A;  1VM8 A;  3JUK A;  3DJ4 A;  1R7X A;  1FXJ A;  1WT0 A;  2PA4 A;  4HO4 A;  4FQW A;  4M2B A;  4Y7U A;  1MC3 A;  5CQO A;  4HCQ A;  1NKH B;  3F1Y A;  4DDZ A;  4ZDQ A;  1EYR A;  2VK9 A;  3IOH A;  4UEG A;  1ZDG A;  2AH9 A;  1JV3 A;  5FUH A;  1TW1 A;  4HO9 A;  1HM0 A;  2E3D A;  1QG8 A;  1OMX A;  1WVC A;  1ZDF A;  4G87 A;  4AC3 A;  1O23 B;  1W77 A;  1OQM B;  1LVW A;  3I0H A;  1QGS A;  3U2T A;  1LL0 A;  5FTS A;  2OEG A;  3DK5 A;  2AM3 A;  2E8B A;  5IDS A;  1LZJ A;  5AJP A;  1R7Y A;  1H5S A;  3Q80 A;  2JCK A;  4KC2 A;  3OC9 A;  2VXL A;  5I1F A;  5CQM X;  2C0N A;  4FRD A;  2ZU9 A;  4KNX A;  3SX7 A;  4CJC A;  1YP3 A;  1ZCY A;  2O1H A;  2X5Z A;  1ZJ3 A;  4HO0 A;  1FZW A;  2V0L A;  1V84 A;  4EEA A;  2Z86 A;  4JD0 A;  4K6R A;  2O1F A;  3T7N A;  2AEC A;  1ZI1 A;  5CQP A;  1H5S D;  1G0R A;  2J0A A;  2J0B A;  1O7Q A;  5C36 A;  3F1C A;  2ICY A;  3SXD A;  3USQ A;  3ZGF A;  3DUV A;  4KC1 A;  3V0M A;  4YS8 A;  3U2U A;  2RJ9 A;  4C2S A;  4ECM A;  1JYL A;  3OH3 A;  2D7R A;  2AE7 A;  1NMM B;  3V91 A;  3OKR A;  4JIS A;  4Y6U A;  1H5S B;  1G97 A;  3LW6 A;  4FRL A;  1R82 A;  2X5S A;  3V0N A;  4B2W A;  1FR9 A;  3PKP A;  3KIA A;  1GWW A;  1VGT A;  1VZU A;  2VXM A;  3I0F A;  4FRA A;  5DDV A;  5BXC A;  2VS3 A;  3SXG A;  1VGW A;  2RJ7 A;  4FRO A;  1ZJP A;  3K8E A;  2AGD A;  2ICX A;  2Y4M A;  1VH1 A;  1G9R A;  3NGW A;  1ZI3 A;  1ZCU A;  2FYA A;  1Z90 A;  5C4D A;  4HO8 A;  1I52 A;  4DE7 A;  2RJ1 A;  4EVW A;  2JCJ A;  2RJ4 A;  1ON6 A;  4NAL A;  2A8U A;  2VS5 A;  4Y7V A;  4EE5 A;  1W57 A;  1FRW A;  3O3P A;  5C4E A;  3Q7U A;  3CU0 A;  4EEM A;  2BO8 A;  2JCL A;  3BCV A;  3EE5 A;  1ON8 A;  1HM8 A;  2CU2 A;  2WVM A;  4HOC A;  2VD4 A;  4MYB A;  1WSZ A;  3T7M A;  1K4V A;  5C1G A;  4ARW A;  5HS2 A;  3FWW A;  4NAN A;  1W55 A;  1G95 A;  1H5R A;  2XME A;  2RJ8 A;  3CKV A;  3ZLK A;  2QKX A;  3N9W A;  5C3D A;  2VSH A;  1H7Q A;  4FRM A;  2PGV A;  1INJ A;  1XHB A;  1EZI A;  1MP4 A;  1OMZ A;  3POL A;  2V0J A;  2A8W A;  4D11 A;  3USR A;  1H4E A;  4P02 A;  4FRB A;  5EJZ A;  2WVK A;  2D7I A;  3T7O A;  4O6N A;  1HV9 A;  1V82 A;  1G23 A;  2QH5 A;  4KPX A;  1H5S C;  4L41 C;  2DPW A;  4Y7T A;  2VSI A;  3ZLL A;  3V0Q A;  4KC4 A;  1H7E A;  1XZ6 A;  2YQC A;  4EEG A;  1GX0 A;  1QWJ A;  2YQS A;  2FYB A;  1ZIZ A;  2PGY A;  3V0P A;  2XMH A;  3ST8 A;  1V83 A;  1VH3 A;  4B2X A;  2P72 A;  1TVY A;  2JCO A;  1G1L A;  3U0X A;  4IRP A;  5CQL X;  3OH0 A;  5EJ1 A;  2FFU A;  3SX3 A;  4IRQ A;  4HO5 A;  4Y64 A;  1YP4 A;  4LW6 A;  2Y7A A;  4P00 A;  4B4G A;  2RJ6 A;  4FIY A;  1O0R A;  1WT3 A;  4ASJ A;  2Y4L A;  5L6S A;  2QGI A;  1H7T A;  4BMA A;  4KQL A;  4HO3 A;  4HG6 A;  3OH4 A;  4FCE A;  3I0K A;  2FYD B;  2ZU7 A;  1HJL A;  1QGQ A;  2FFV A;  1TW5 A;  1INI A;  2X65 A;  3CGX A;  2I7B A;  1E5K A;  1IIN A;  5C4F A;  1FG5 N;  3I0G A;  1H7F A;  4J18 A;  2GGQ A;  2YCM A;  4B5B A;  3U2X A;  1JV1 A;  1ZCV A;  2X60 A;  1HJJ A;  2Q4J A;  4FRQ A;  3FOQ A;  1H5T A;  1LZI A;  5CMF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...