5D92A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
340
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
molecule keywords AF2299 protein,Phosphatidylinositol synthase
total genus 107
structure length 340
sequence length 342
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d92A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d92A01
4O6MA 4O6NA 5D91A 5D92A 4Q7CA 4MNDA
chains in the Genus database with same CATH superfamily
5JT4A 2ZPAA 2EPMX 4DDZA 2FAPB 5AGFA 3K1HA 1H7TA 1G2VA 3NMIA 1O23B 4CSAA 1H7FA 1BR4A 2YLGA 4BJ6A 4BQHA 3IQCA 4FIYA 2OEXA 2FFHA 1XZPA 3EFOA 4AL0A 3ABKC 1H5SD 3K7DA 3I0KA 2YQSA 1ST6A 4O6NA 2ZXPA 1NMMB 3R2WA 3U8VA 3E26A 3U3FA 3GANA 2V0IA 3TJ6A 1LL3A 5A6AA 5DS4A 2AU5A 3LLIA 1ZW2A 4Q5SF 4BJ6C 3OA1A 1INJA 1OQMB 3W8IA 4XLNF 3JUJA 4P6IC 4BPMA 4CBEA 1RKEB 3U2LA 1NZEA 1OKKD 2VS3A 2HKVA 4ASJA 1FR9A 3ZC4A 4J7TA 3K1IC 2QY9A 2PA4A 3O10A 2CYDA 3AG1C 5JVEA 2LFFA 3FVYA 3KPHA 2R7XA 3S28A 4CJBA 4DOZA 2OI5A 2JCJA 4O6MA 1M2VB 2YC5A 4AE4B 3N0TA 4DRIB 5EIYA 2A1DD 2Y4JA 4LLEA 1QGSA 1QPUA 5BUOA 3GEIA 2NUTA 3D98A 3DK5A 2AM5A 2RJ7A 4AX2A 2YLDA 4MVMA 1VZTA 4MNDA 3S27A 2M4EA 4P9FA 1MP4A 1O0RA 1ZI5A 2Q3TA 1ZCTA 3MLGA 1MQVA 4KPXA 2Q4JA 3JZ0A 3JCUQ 2A0UA 3OH2A 2WL8A 4U5EE 3U3BA 4NTFA 4EHPA 3EFOB 1JV1A 3S84A 4ER9A 5L3VA 1CGOA 3L34A 1YA7O 3TULA 4O7GA 4XLPF 3FAPB 5IDSA 2JCLA 2APCA 2OEVA 2XS8A 4MVRA 3EQLF 3V0MA 1SYQA 3GWNA 1W55A 1R80A 3U0CA 1R81A 3HNJA 1ZHXA 4NTBA 2YZSA 5JS5A 5F5FA 5JQQA 1TR2A 2YESA 3V91A 4HE8D 5L6VA 5HSWA 4ECMA 5A6BA 3NMKA 1YARO 4EEMA 5BQIA 1LS1A 1S4NA 3FMSA 3AJMA 2F22A 1VGWA 2EIJC 2NXVA 3ZTZA 2ASRA 1Z90A 4R7PA 2J8WA 3EE5A 2ZXRA 2L6GA 3KH2A 1PV3A 4DVYP 1D0XA 4K1OA 2VASA 4Z9HA 5E33A 2B0JA 3SX5A 1M6TA 4Y7GA 4ZLCA 2RSEB 3M79A 2H7VC 4M63A 4RBNA 4OIOF 3L8IA 4NAIA 4Y7FA 1M57C 2AVKA 1T6QA 3V0PA 3RF3A 1GWWA 1ZHTA 1WTYA 4XPYA 5CMGX 4E1KA 2LD6A 2HSQA 2QKXA 3GUEA 5FV9A 4HO0A 2XL4A 4HOCA 1S4OA 4EBKA 2O1FA 5E2QA 2PP4A 4JW1A 4MW8A 4OIRF 3TOMA 2YL7A 1WATA 1OR2A 1RKCA 4FESA 1W77A 3HKKA 3IOJA 1VTMP 1PZTA 3S9OA 4PR9A 2J0XA 4CS9A 3PHF2 4CJCA 5DS5A 3AG2C 3MYIA 4E0HA 2WVMA 3LNMB 2D7IA 3POLA 3MBGA 1ZJ2A 4KPZA 2HZ8A 3T7NA 3AG3C 3FHDA 3WG7C 1LZ0A 5DVWA 4Z9JA 4G3PA 3RQEA 1VGUA 4E18A 2DPWA 4EE5A 1LL0A 5FTVA 1OW7A 2FFVA 1NWGB 4DRHB 5DQTA 1R7VA 1Q0MA 3ZGFA 2LK4A 4D11A 2ZXWC 2XXAA 4U5DE 1QKRA 5FTSA 4LDRA 5E3AA 1YP2A 1HW2A 4LLCA 2YC3A 1LVWA 4C3BA 3LS0A 1SMYF 1H5TA 5D92A 4D4XA 4B5BA 3I5PA 2QH5A 5C8RA 1ZJPA 2FFUA 1YDIA 1BDJB 1OCRC 3G4XA 2Y3DA 4ZDQA 5C49A 5FCLA 3V0NA 2GWWA 5JSLA 4J30B 4CSAC 5C48A 2P7VA 2WVOA 5BXCA 4U5CE 1VB5A 1XHBA 2NUPB 4KBLA 1MNEA 3BEHA 3AGUA 3JT1A 4J7YA 2XM4A 4JCHA 3PNNA 4I44A 1E85A 1G93A 3KIAA 1YJGA 3OWTA 2IXMA 1NFNA 1LS4A 1WT2A 5KYWA 1WT1A 1H4DA 3ST8A 3SXDA 4XEVA 3I4UA 1GX0A 3V0LA 3LEOA 3TZTA 2WAWA 5CI8A 2J0AA 3V5XA 1E2XA 2NUTB 4MVUA 3DI5A 4L6RA 2BO4A 3DMDA 2XM0A 3QVZA 5AJPA 4C7OA 2M64A 1LE2A 1H7GA 4Y62A 3OAMA 4KI2A 4HO6A 3D5NA 2OKUA 2XSEA 3U2XA 4MTOA 2PGYA 1OMXA 4OINF 2CNWD 3C7JA 5CQPA 3KYIA 3ZVRA 3M15A 1G4WR 3MYFA 3LUTB 4U5BE 4O79A 1APCA 1HW1A 4FAPB 1NU9C 1LVKA 3GEHA 3KKBA 5F28E 4DE7A 1A7VA 3VYWA 3X2QC 2HJMA 4EIYA 2I5KA 1FTSA 2J9BA 3GM1A 3EG9A 3FOQA 5L6SA 1VH1A 4WGYA 1VLTA 4A4AA 2DI3A 3DE8A 2E8BA 2OI6A 2RITA 3RH3A 1I4YA 4PFOA 2Y7AA 5CQOA 1QVXA 1R7XA 5CQNX 4GEHA 2FYAA 3SX3A 2YQJA 4CIHA 1UFBA 3U2WA 1XZ6A 4PJJA 3GEEA 2VXLA 2E3DA 4C3EA 3ABLC 1E86A 1ZCYA 4IGGA 1ZJOA 2A0BA 2YKZA 2ZU9A 2ICWG 4Y63A 3TK0A 3HNLA 2VCAA 2XLDA 2YRFA 2J45A 5HS2A 3C8GD 1YAUO 1VOMA 5L0JA 1H7EA 3G4ZA 4MQ9F 4DRJB 3U0XA 2TMVP 1L7CA 2EINC 3B71A 3EH1A 3S90A 3DJNB 1ON6A 1ZU5A 1Q0FA 1NBBA 1RXQA 1TW1A 1B68A 5D91A 2Z86A 2OQMA 4K6RA 2X65A 2C0NA 3VM6A 2KJGA 4AC3A 1DOVA 3CKNA 2WVKA 2NSFA 4QI0A 2HMQA 1YP3A 1A7EA 4IB4A 1LZJA 3SX7A 1FG5N 3X1OA 5AJOA 2EPLX 1D0ZA 1N1CA 3CKJA 2I5EA 2P72A 3T6JA 2BL2A 2L81A 1ZHYA 3PCVA 4IARA 4IRQA 5J49A 4XEKA 2XMHA 1CPQA 2J0WA 5KYXB 3Q80A 5FU8A 2YEVA 3CKOA 3V0OA 2R7TA 2PF4E 4MVZA 3H2UA 4WABA 1JVDA 2OCCC 2UX8A 1G4US 3O39A 2P1AA 1HJJA 4DBRA 3SXYA 4E7SA 4NQFA 3DD7A 2HUJA 5AC5A 4AAWA 2Y3BA 2OU6A 1TFOB 5KYUB 1ZHZA 2P6VA 3B9QA 4MYBA 2YWAA 4J32B 3D8VA 3GM2A 2WVQA 3LW6A 3ASOC 2FY7A 1HY5A 4KT7A 2L7AA 1TVYA 3I0JA 4LW3A 4M28A 2J7PD 4NANA 5L0GA 3ASNC 3JTJA 1ZI1A 1W2WA 3Q7GA 4HG6A 4KNVA 5COGA 1ZDGA 1K4VA 2MZBA 1Z63A 2NUPA 2XLWA 1IW7F 2XLMA 1VICA 2ZXOA 5DQZA 2KW3C 1JYKA 3I0FA 1NF5B 1U0BB 2HMZA 5CI9A 1ZJ3A 3ZGGA 2R7UA 2G3VA 2J9UA 1ORSC 2OOCA 5L0HA 3WHNA 3W2WA 1ZYRF 1OXKA 1TKNA 3HNIA 2C03A 3V0QA 3AGTA 1HM9A 4F4BA 2IOQA 2NSGA 5DLJA 3UGOA 4B4GA 4D11C 5B3IA 2FYDB 2A6EF 2IXOA 4P02A 4BJ1A 4JJGA 3PKQA 3NYJA 4CJOA 4JEBA 4FRAA 5KYUA 1AEPA 1JPJA 2PFDA 3AG4C 4U9EA 4CS7A 4PJMA 3EH2A 1SZIA 1OKKA 1MP5A 2IXNA 2Y4LA 2YHSA 2VCBA 5EHHA 4MTFA 1E5KA 1OCOC 3K8EA 3IHUA 4FRLA 3EZIA 1U6HA 2HS5A 1A0BA 5BQHA 1OXBA 3FXHA 3NDBB 1ZU4A 1J8YF 3IQTA 2AP3A 4QDLA 2Z87A 4FRBA 2BE5F 2XLHA 2ZD9A 5B3SC 4FRQA 3ATPA 1VPAA 2VSHA 2V26A 4G3SA 4M4KA 3W4YA 4BG0A 3G50A 1R7YA 5L0DA 3DWWA 4HO8A 1JAFA 2RIXA 1H5SA 2E87A 2WGZA 3Q4SA 3LEVA 3DAGA 1ZHJA 4AYJA 1FOAA 4G3QA 3SXGA 2EPOA 1KTMA 2AH9A 3VF0A 3CU0A 3I0EA 2R03A 2ZU8A 5FU0A 4YL0A 4JZAA 2OI7A 1ZIZA 4XWIA 2W0WA 4HO9A 1O7OA 3RFYA 3TOLA 2R05A 5COMA 1XWJA 1MP3A 2IYLD 3EGDA 1V82A 2CGEA 2YL0A 1G9RA 4Y7VA 3ZTMA 1G5ZA 3SP1A 5CMIA 1QGQA 4Q7CA 3OH1A 4KC4A 4D48A 1FR0A 4HO5A 4DECA 3LNRA 3KL4A 1YROB 4Y64A 1PZYB 1QSPA 2HV6A 4N6HA 4J18A 5DDTA 2BO7A 3HNKA 1ZVZA 3LLKA 1L3PA 2V0LA 1YZAA 1ZCUA 3L8JA 3OH4A 1NU7D 1G3LA 1R5ID 4YT5A 3CEXA 2XRHA 2WVNA 1ZI3A 1H6GA 4E17A 4K0DA 2L6HA 1WT0A 1E84A 4U5FE 1H4CA 5EJZA 4CS8A 3T4RA 4EBBA 1FO9A 3SNHA 1G95A 4YS8A 4UEGA 1QG8A 2DB4A 5C4CA 4ZLDA 2X51A 3FAJA 4JIOA 3B0UX 1JPNA 3U2TA 2WVLA 2RD9A 4YWQA 2RJ9A 2LIGA 2R7VA 2FYBA 2PX3A 2CW0F 1HMDA 4Y7UA 3DM5A 2ICYA 1JR8A 4MVSA 1Q0DA 5DDVA 3K6BA 4B6IA 2R7SA 3BRJA 2LFDA 1PD0A 5C3DA 1TWHA 5A6JA 2W0VA 5C38A 1D1CA 2EIKC 1G97A 4KC9A 4H54A 2Z15A 5CMJA 4U5GA 2BO6A 2Y4KA 1ZZPA 3T7MA 4MVQA 4MIXA 2QE9A 4YT2A 3SEOA 3I0HA 4ULVA 3I0DA 1Z6AA 3IOIA 2IBFA 1C03A 4K7BA 3FOOA 2LSEA 2RJ5A 1JMWA 1FWYA 1GS9A 2WB7A 4OD4A 4UDVA 4DVZA 5BQGA 1JOGA 3I0CA 3EZHA 1LIHA 4GBPA 4HO3A 4HO4A 3RMWA 1BZ4A 3SXKA 3ITFA 3EGXB 4JEAA 4JISA 1NLXA 4CS8C 4G87A 4LW6A 2OG2A 3SXAA 3A11A 3OKRA 3I0LA 1GQCA 4PJNA 2I15A 4FX5A 1HE1A 3T9OA 1A7DA 3WODF 4B2XA 1V54C 2Y39A 2X60A 4MVOA 3Q7UA 1V83A 3QTHA 1MNDA 2A68F 1BBHA 2QUPA 3T6GB 2W45A 1T9KA 1GM5A 2XWNA 3O55A 3NGWA 2LQGA 4JD0A 3TQDA 3U8PA 1FFHA 1LI7A 2W4MA 5B1AC 1VYIA 3B0PA 2AM4A 5FYEA 1G0RA 4IAOA 3FWWA 1FO8A 2J9WA 5IY5C 4G7HF 2IM8A 3MFNA 1FXOA 3N24A 5F5HA 1H5TB 2GGOA 1H9GA 4XEFA 4EE3A 2I8BA 4LACB 3LJBA 1EYRA 2VD4A 3CKQA 3F1YA 5B1BC 4D0ZA 3DM9B 4G78A 4DBQA 1H9TA 3JYYA 3Q7LA 1GA8A 2V0JA 4BJ5A 1LKXA 4R32A 1G1LA 2OJQA 1T6IA 5JLIA 4PJLA 3F47A 4NALA 1OCZC 2J46A 1BR1A 1VM8A 2Y6PA 2AWYA 1VYKA 2YL1A 1S4PA 4ANJA 5EGYA 1H5SC 3V90A 1TWCA 3SZRA 2NPUA 4DXWA 4AK9A 3IQ5A 1KWSA 5COFA 4KNWA 1K40A 3DJ4A 3EJNA 1AUEA 1RMVA 2VH3A 4FCEA 5KYWB 4B42A 2A8WA 2Q9CA 3EPVA 1ZCVA 5L0CA 3UGPA 3TD7A 256BA 1O87A 3FOPA 5C3AA 2YQYA 3NYLA 4RDAA 2VCCA 1UG7A 3RQGA 4AE4A 2R7WA 3U2VA 3VRCA 3I0GA 3R2PA 2D4UA 3UMKA 3S29A 1GQAA 3I0IX 1ZHWA 3VAYA 4YL3A 4FCUA 1HV9A 1GWVA 3BCVA 4CDVA 1FZWA 3JRMO 4JURI 3POVA 2XMEA 3SXEA 1G23A 4BJTA 3DE9A 4C3DA 1S7ZA 3U5SA 3CQZA 2EIMC 4P00A 2XXAB 4G0HA 3M1CB 1R7UA 4MTGA 3MX3A 3RYLA 1DOWA 4JE9A 2R25A 5C1HA 2VSIA 3OC9A 2KNHA 1HM8A 1NHEB 1FMVA 4LDKA 3A9CA 2RJ6A 1VLSA 3DZAA 4AL1A 1YA9A 2G62A 3CSKA 1WASA 1H7LA 3NKEA 1U89A 2VXMA 3PDMP 3B29A 1T01A 3ZQVA 4NC3A 3M4CA 4YJWA 1I5NA 1WGWA 3RVYA 4B4BA 4EVWA 3T6BA 3EGDB 1ZJ0A 3OEOA 1FGXA 2XLOA 5C36A 1Q0GA 3ZF8A 2H7OA 4JC7A 3RKOF 2AECA 1O7QA 4FQWA 2Q9AA 1H3MA 3OGZA 2PNOA 4M2BA 3HJCA 3SX8A 3O3PA 1SF8A 2JCKA 3E70C 2R7RA 3ECSA 2PBEA 2CCYA 5IFYA 2LP4A 1LI5A 4CIPA 3QW0A 2V0HA 2B0HA 2HJ3A 2XWLA 3U9JA 1WVCA 1TWAA 2WZLA 4FROA 2KK1A 3B0VC 1PD1A 2YVKA 1E83A 4L41C 4CJGA 1WN0A 4YL1A 3W2VA 1ZW3A 2AM3A 2Q00A 5JUAA 3J06A 3C63A 1V74B 2A6HF 4CDYA 4QI2A 2P61A 3JSZA 1EQ1A 1M2VA 2RIZA 4EKWA 3BRKX 2Y69C 3CZ6A 1R4TA 3ZLKA 1ORYA 3PMRA 1INIA 5AC4A 4E7ZA 1LM3B 2YQHA 1EI7A 1I4ZA 3HTKC 1H7IA 2G3KA 5T1DB 4NAKA 2UUIA 3DKAA 5AJNA 3DUVA 5E3CA 2IXPA 4EEOA 4IAQA 4E0IA 4JKVA 2BC5A 4M2AA 3KYJA 3Q6MA 3E25A 2MWQA 2X5SA 2KGOA 3SXMA 3LESA 4FREA 1H7QA 1RJ9B 3IPMO 2JX0A 5TJ5E 2JCOA 1C17M 4FRHA 1PCXA 1SS9A 3SYNA 2OJED 4FIXA 3S0XA 2Y3HA 2MHRA 1I52A 2QLAA 3ABMC 4G7ZF 1FGGA 5HV9A 4KNRA 4HO2A 4ASYA 3NKDA 2V3CC 1F1MA 1Z3IX 2JD3A 3HLZA 4Z9IA 2AE7A 1IIMA 2AESA 2XLEA 1MMDA 5T3WA 5FUHA 1GGQA 1IZMA 4HFFB 4EUKB 2XLVA 2AWCA 4CDAA 3LS1A 3TQOA 2GAQA 2P73A 1MMAA 2GA0A 3DXJF 1OCCC 3V5YA 3RIPA 5EK0A 3RW0A 2YL3A 4DJ9A 4JVSA 3RVZA 1ZDFA 1H5RB 4GQHA 1GX4A 1V4AA 4OIPF 3U2UA 4LERA 5K0IA 1QWJA 3IOHA 1SR2A 4Q4ZF 2XL8A 1G8XA 4I1OB 3JRTA 1LZIA 3DJUB 2QGIA 2XL6A 1TFKB 3UNGC 2I7BA 1IINA 1M2OA 2H8AA 3OH0A 3NMJA 5EJ1A 5CQLX 1G8OA 4N4WA 1Q0KA 3KMIA 4I1MA 1TWGA 1VGZA 4H4KC 3ZIBA 2Q4FA 5GPGB 2UUHA 5DS6A 3K1IA 3EHNA 1O3UA 2GFHA 3UR3C 1ZI4A 2ETSA 4C2SA 1HJLA 3QZCA 3ZQYA 3QMKA 1T5OA 1OQCA 4KNXA 4HFKB 3GORA 1R7TA 1QLEC 4XWJA 1VH3A 2Q9BA 2D0JA 4KC2A 3U2MA 3U0YA 4XTKA 5KYYA 5FZTA 5I1FA 2QNLA 1HM0A 4CVHA 2PX0A 1RJ9A 1ZJ1A 3RMVA 2QTVA 3L0IA 4HEAJ 2V0KA 2KYHA 4OIQF 4CX9A 2KQ9A 1NG1A 2KSFA 4Y7TA 3JTLO 4B4MA 4N6CA 3JYHA 5C1LA 3K33A 2MYSA 4ONSA 1K05A 4ULWA 1EKYA 3US6A 1O5HA 1VZXA 3F1CA 5T3TA 4G7OF 2EPKX 4XPXA 2YQCA 5C4BA 3Q6NA 1QQ3A 2OEGA 2A8UA 4B3UA 1OR3A 2D5RB 3SXCA 3V5ZA 1YYJA 5L0IA 2VK9A 3OH3A 2DGJA 3C8GB 1NSGB 4JRZA 1FR8A 3U9MA 4Y9XA 3SXBA 2D7RA 4YT8A 5C3BA 3GWLA 2AGDA 1CPRA 2Y3GA 4EEGA 3H65A 4MS2A 4JJFA 1WWPA 2X0CA 1EZIA 2RJ1A 2RJ4A 4PACA 3I5QA 1FXJA 3JUKA 3LAYA 1LPEA 3C18A 3V7OA 3ZDLA 1H5RA 1EA8A 2W9YA 3R7CA 2FYCB 2VFZA 4FRPA 4D0TA 1H7HA 5KYYB 2GDCA 1Z5ZA 1VGTA 1Y4CA 3NRHA 2Q7RA 4JCZA 1ORJA 1Z7Qc 3T7OA 5CMHA 2WE9A 4C7OB 1WT3A 3WAQA 1FFTC 2XS1A 2BO8A 1HMOA 4ARWA 3EGXA 5JP7A 3ZG1A 1GQ9A 4PK4A 3QW1A 4D4NA 3K8DA 1TZFA 3L1MA 4W8PA 3V8ZA 4LDQA 1YZCA 1D0YA 2VS5A 1AVOB 3RQFA 2CDQA 1WSZA 1V84A 1TQGA 4X0RA 4XQ1A 2RJ0A 3HL3A 4NCQA 3ZLLA 3N9WA 4FRDA 5JRAA 3W8HA 2R9RB 3USRA 3C8ZA 4MW3A 2DYSC 4EWCA 1KU2A 1XZQA 3M4BA 1M56C 2WZGA 4EE4A 5KYNA 1C02A 3UMIA 4P9TA 2C04A 3EG9B 3O6XA 1NFOA 3ZWIA 1FMWA 2VC9A 3H2VA 3PKPA 1Y6DA 2JPUA 4A2NB 3C8GA 1HE9A 3ZSUA 1TW5A 2HFIA 4WGZA 2H7BA 5A6KA 3GM3A 1JVGA 3NYMA 2NG1A 3AQBA 3AOUA 4IRPA 4NTAA 3QVYA 4BEJA 5C4EA 2A69F 2RIYA 2J9VA 4HCQA 1OW6A 4U9DA 4EEAA 2ZU7A 1D1AA 5C4DA 2YCMA 3QVBA 1RKEA 5L0FA 4YN0B 4JTCB 3SXZA 1V55C 2ICXA 3NG1A 4B2WA 3N2ZB 5C47A 1KNYA 2GGQA 2J7PA 1NKHB 3GODA 3JSEO 1OW8A 1Z23A 5IDTA 2LCHA 1LL2A 2RJ8A 4KRVA 1H4EA 1MC3A 2PX7A 4AYLA 5CIVA 4JTAB 5CMFX 1A41A 1J8MF 1VK5A 1WOLA 2PGVA 3AQCA 2X5ZA 3K66A 1BR2A 5CQMX 5A69A 4OD5A 4NY3A 4IRUA 1MMNA 2R7QA 1S05A 2WZFA 2OEFA 2O1HA 2CNWA 3FDQA 1MMGA 1R82A 1YVIA 2L6FA 2KC3A 2O9XA 1CGME 2EPNA 4U5HA 3UMHA 4BJ5C 2R02A 1YYXA 2CU2A 3EHMA 1QZXA 2P6WA 4CJ8A 3USQA 2EILC 2W4BA 1ON8A 4I3MA 2R7OA 5C1GA 3IQ6A 2VS4A 1CGNA 2HV7A 4EBJA 1W57A 2L9JA 4FRMA 4O6YA 4GYTA 4W8KA 4KQLA 4CS9C 5A6BD 2FGYA 4Y6UA 1RCPA 4RD9A 4WJ0A 1JYLA 1VMAA 1FRWA 1LE4A 1D1BA 5C4FA 2VB6A 4KC1A 3SPTA 3V8YA 4JTDB 4KXOA 2P0NA 4XPWA 1NQIB 4IWBA 1FAPB 3IEEA 5L3QA 3E9VA 2XWMA 3CKVA 1FNTc 4Y6NA 1H5SB 4N06A 3R3IA 1OMZA 3RSBA 3F46A 2DYRC 4IJJA 2O1GA 4BMAA 4FWVA 1LZ7A 3C62A 2J0BA 4BEMJ 2YLIA 3DAFA 3TJ5A 4YT4A 1YP4A 4YK5A 1K04A 1T6UA 3CAXA 2WEEA 2Y4MA 1JV3A 1VZUA 5KYXA 2HSBA 1JRAA 3CGXA 1YLMA 4PFPA
chains in the Genus database with same CATH topology
1GX4A 1FTSA 1PD0A 5C3DA 4OIPF 3U2UA 1TWHA 2W0VA 4LERA 1D1CA 5C38A 2ZPAA 2EIKC 1QWJA 3IOHA 4Q4ZF 1G97A 4KC9A 1G8XA 3EG9A 4DDZA 2Z15A 3FOQA 5CMJA 5L6SA 4U5GA 2BO6A 2Y4KA 3K1HA 1H7TA 1VH1A 4I1OB 1G2VA 3JRTA 1O23B 2E8BA 3T7MA 1LZIA 3DJUB 4CSAA 1H7FA 2QGIA 3UNGC 2OI6A 2I7BA 2RITA 1IINA 1BR4A 1M2OA 3RH3A 4PFOA 2Y7AA 3OH0A 5CQOA 4BJ6A 4MIXA 5EJ1A 4BQHA 5CQLX 1G8OA 1R7XA 5CQNX 4GEHA 4YT2A 2FYAA 4FIYA 3SX3A 3KMIA 2YQJA 4I1MA 4CIHA 2FFHA 3SEOA 3EFOA 1TWGA 3ABKC 1H5SD 1VGZA 3I0HA 4H4KC 3K7DA 3ZIBA 1XZ6A 3I0KA 2YQSA 3I0DA 1Z6AA 3IOIA 3U2WA 1ST6A 4PJJA 5DS6A 2VXLA 5CMIA 4O6NA 2ZXPA 3EHNA 4K7BA 1NMMB 2GFHA 3UR3C 2E3DA 3R2WA 1ZI4A 4C3EA 3ABLC 1ZCYA 3E26A 4C2SA 3GANA 1HJLA 1ZJOA 2V0IA 1LL3A 2LSEA 3QZCA 2RJ5A 3QMKA 5DS4A 1FWYA 2ZU9A 2WB7A 4OD4A 4DVZA 4Y63A 3LLIA 4KNXA 4HFKB 3I0CA 1R7TA 4Q5SF 4BJ6C 1QLEC 3EZHA 4XWJA 3OA1A 1VH3A 2J45A 2Q9BA 5HS2A 1INJA 1OQMB 2D0JA 4KC2A 4GBPA 4HO3A 4HO4A 3U0YA 3RMWA 3W8IA 4XTKA 1VOMA 4XLNF 3JUJA 1H7EA 5KYYA 3ITFA 4MQ9F 3EGXB 3U0XA 4JISA 4P6IC 5I1FA 4CS8C 2EINC 1HM0A 4G87A 4LW6A 3EH1A 4CVHA 3DJNB 1ON6A 2OG2A 1ZU5A 3SXAA 2PX0A 1RJ9A 4CBEA 1TW1A 3OKRA 1ZJ1A 3I0LA 2QTVA 5D91A 3L0IA 1GQCA 4HEAJ 1NZEA 4PJNA 2V0KA 1OKKD 2VS3A 4ASJA 4FX5A 3WODF 1FR9A 2Z86A 4B2XA 3ZC4A 1V54C 4K6RA 2X65A 2Y39A 3K1IC 2C0NA 2X60A 4OIQF 1V83A 3Q7UA 1MNDA 2QY9A 2A68F 2PA4A 3AG1C 2KJGA 2KQ9A 4AC3A 3CKNA 1NG1A 3FVYA 4Y7TA 2WVKA 4B4MA 2R7XA 3S28A 4QI0A 4CJBA 4DOZA 2W45A 3JYHA 2OI5A 2JCJA 2XWNA 4O6MA 3NGWA 1M2VB 1YP3A 5C1LA 2YC5A 4JD0A 3TQDA 3K33A 2MYSA 1FFHA 1LZJA 3SX7A 2W4MA 5B1AC 4AE4B 3N0TA 1FG5N 4ULWA 3X1OA 1VYIA 3B0PA 2AM4A 5AJOA 5FYEA 5EIYA 2A1DD 1G0RA 4LLEA 1O5HA 1QGSA 2Y4JA 4IAOA 1D0ZA 1N1CA 5BUOA 3CKJA 1FO8A 2J9WA 3FWWA 5IY5C 2NUTA 4G7HF 1VZXA 3D98A 5T3TA 4G7OF 3F1CA 2I5EA 3DK5A 1FXOA 2P72A 2YQCA 5C4BA 3Q6NA 3N24A 3T6JA 2AM5A 5F5HA 2L81A 4AX2A 1H5TB 2RJ7A 2GGOA 2OEGA 2A8UA 1ZHYA 4B3UA 4IRQA 1VZTA 2D5RB 4MNDA 3S27A 3SXCA 2M4EA 5J49A 1MP4A 2XMHA 4EE3A 1O0RA 2J0WA 1ZI5A 2I8BA 2Q3TA 1ZCTA 3MLGA 4LACB 2VK9A 5KYXB 3LJBA 1EYRA 2VD4A 3CKQA 3F1YA 2Q4JA 3Q80A 4KPXA 5FU8A 2YEVA 3JCUQ 5B1BC 4D0ZA 3DM9B 3CKOA 3OH3A 2DGJA 4DBQA 3V0OA 2R7TA 2PF4E 3OH2A 1FR8A 2WL8A 4U5EE 4Y9XA 3SXBA 2D7RA 3Q7LA 4YT8A 1GA8A 5C3BA 2AGDA 2Y3GA 1JVDA 2OCCC 4EEGA 3H65A 2UX8A 3EFOB 1JV1A 2V0JA 4JJFA 4BJ5A 1LKXA 3O39A 5L3VA 1EZIA 1HJJA 4DBRA 2RJ1A 1G1LA 4E7SA 3L34A 2RJ4A 3DD7A 3I5QA 4O7GA 1FXJA 4PJLA 3F47A 3JUKA 4XLPF 5IDSA 4NALA 1OCZC 2J46A 3LAYA 2JCLA 2APCA 1BR1A 1VM8A 3EQLF 2Y6PA 3V0MA 1VYKA 3V7OA 1S4PA 2Y3BA 4ANJA 1W55A 1H5RA 4AAWA 5EGYA 1H5SC 3V90A 2W9YA 5KYUB 1R80A 1TWCA 1ZHZA 2P6VA 1R81A 2FYCB 2VFZA 3SZRA 4FRPA 4D0TA 4AK9A 1KWSA 3B9QA 1H7HA 5KYYB 1ZHXA 4MYBA 4KNWA 2YZSA 5F5FA 3DJ4A 3EJNA 1Z5ZA 1VGTA 5JQQA 3NRHA 4J32B 1TR2A 2VH3A 4FCEA 2YESA 3D8VA 4HE8D 3V91A 5L6VA 3T7OA 5KYWB 5HSWA 4ECMA 5CMHA 4B42A 2WE9A 4C7OB 2WVQA 3LW6A 2A8WA 2Q9CA 3EPVA 1WT3A 1ZCVA 3ASOC 2FY7A 5C1GA 4EEMA 4KT7A 1LS1A 3UGPA 1S4NA 3TD7A 1TVYA 3I0JA 4LW3A 1O87A 1VGWA 2EIJC 4M28A 2NXVA 3NYLA 5C3AA 4RDAA 2J7PD 1Z90A 1FFTC 4R7PA 4NANA 4AE4A 2R7WA 2ZXRA 3ASNC 3EE5A 2BO8A 3JTJA 3KH2A 1ZI1A 4ARWA 1W2WA 3Q7GA 3U2VA 3EGXA 4DVYP 3I0GA 4HG6A 4KNVA 1D0XA 3ZG1A 1GQ9A 4PK4A 1ZDGA 3K8DA 3UMKA 1K4VA 2MZBA 1Z63A 1TZFA 2NUPA 3S29A 2VASA 3I0IX 5E33A 2B0JA 1ZHWA 3SX5A 3V8ZA 3VAYA 3SXEA 4FCUA 1IW7F 4Y7GA 1HV9A 1GWVA 1D0YA 4ZLCA 1VICA 2VS5A 3BCVA 2ZXOA 5DQZA 1FZWA 2H7VC 2KW3C 4JURI 2CDQA 4M63A 4RBNA 3POVA 1JYKA 2XMEA 3I0FA 1G23A 4BJTA 4OIOF 1WSZA 4NAIA 1V84A 4Y7FA 1M57C 4C3DA 1S7ZA 1NF5B 3V0PA 3CQZA 2EIMC 4P00A 4X0RA 2RJ0A 3HL3A 2XXAB 4G0HA 5CI9A 1GWWA 1ZJ3A 3M1CB 1R7UA 3RYLA 3MX3A 1ZHTA 3ZGGA 3ZLLA 2R7UA 2G3VA 2J9UA 3N9WA 5CMGX 4FRDA 5C1HA 2VSIA 4E1KA 3OC9A 3W8HA 3USRA 2KNHA 1HM8A 1NHEB 2QKXA 3W2WA 1ZYRF 4EWCA 2DYSC 3GUEA 5FV9A 1KU2A 1FMVA 1TKNA 1M56C 2C03A 4HO0A 2XL4A 4HOCA 1S4OA 2RJ6A 3V0QA 2WZGA 4EE4A 1HM9A 3DZAA 2O1FA 4F4BA 5E2QA 2G62A 2IOQA 5KYNA 2PP4A 5DLJA 3CSKA 4JW1A 3UGOA 1H7LA 4B4GA 3UMIA 3NKEA 4OIRF 2C04A 3EG9B 2FYDB 4D11C 2A6EF 3O6XA 2IXOA 4P02A 2VXMA 1FMWA 4FESA 1W77A 4BJ1A 4JJGA 3PKPA 3IOJA 1PZTA 4A2NB 3PKQA 4YJWA 3ZSUA 3NYJA 1TW5A 2J0XA 1WGWA 2H7BA 4CS9A 4B4BA 3PHF2 5KYUA 4FRAA 4CJCA 1JVGA 1JPJA 3NYMA 4EVWA 2NG1A 3AQBA 5DS5A 3AG2C 3T6BA 4IRPA 3EGDB 1ZJ0A 2PFDA 3OEOA 2WVMA 3AG4C 1FGXA 4CS7A 2D7IA 3POLA 5C36A 4BEJA 1ZJ2A 4PJMA 3EH2A 2H7OA 4KPZA 1SZIA 3ZF8A 5C4EA 3T7NA 1OKKA 3AG3C 2A69F 3RKOF 3FHDA 1MP5A 2RIYA 2IXNA 2J9VA 4HCQA 2Y4LA 2YHSA 3WG7C 4EEAA 1LZ0A 2ZU7A 1D1AA 5DVWA 4G3PA 5C4DA 5EHHA 2AECA 2YCMA 1O7QA 4FQWA 1VGUA 3QVBA 1E5KA 1OCOC 2Q9AA 1H3MA 3K8EA 3OGZA 4M2BA 3HJCA 4YN0B 4FRLA 3EZIA 1V55C 2DPWA 2ICXA 3O3PA 3SX8A 4EE5A 3NG1A 1LL0A 3N2ZB 5FTVA 5C47A 4B2WA 1SF8A 2JCKA 3E70C 2GGQA 2J7PA 2R7RA 3ECSA 1NKHB 3NDBB 3GODA 1NWGB 2FFVA 5IFYA 1ZU4A 1J8YF 1Z23A 5IDTA 4QDLA 2Z87A 5DQTA 1LL2A 4FRBA 2RJ8A 2V0HA 1R7VA 4KRVA 1H4EA 2BE5F 1MC3A 2PX7A 5B3SC 4FRQA 2XWLA 3ZGFA 4D11A 1WVCA 4AYLA 1TWAA 2ZXWC 1J8MF 1VK5A 1VPAA 2VSHA 2WZLA 2V26A 2XXAA 5CMFX 4FROA 4G3SA 4U5DE 4M4KA 4BG0A 1PD1A 3B0VC 5FTSA 1R7YA 2PGVA 3AQCA 2X5ZA 4L41C 5E3AA 3K66A 1YP2A 4HO8A 1BR2A 5CQMX 2RIXA 1H5SA 4OD5A 4LLCA 4NY3A 3W2VA 2YC3A 1LVWA 4C3BA 2E87A 3LS0A 1SMYF 4IRUA 2AM3A 2WGZA 3Q4SA 1MMNA 2A6HF 4QI2A 2R7QA 3LEVA 3DAGA 1H5TA 5D92A 2WZFA 1ZHJA 4AYJA 3JSZA 3I5PA 2QH5A 4B5BA 1FOAA 4G3QA 5C8RA 3SXGA 1ZJPA 2OEFA 1M2VA 2O1HA 2FFUA 2RIZA 3BRKX 2Y69C 2CNWA 1OCRC 2Y3DA 4ZDQA 3CZ6A 3FDQA 2AH9A 5C49A 3ZLKA 5FCLA 3V0NA 3CU0A 3PMRA 3I0EA 1INIA 2ZU8A 1MMGA 1R82A 5FU0A 4E7ZA 4J30B 3RMVA 4JZAA 2YQHA 4CSAC 1ZIZA 2OI7A 2O9XA 3HTKC 4U5HA 3UMHA 4XWIA 2G3KA 5C48A 2P7VA 4BJ5C 2W0WA 2WVOA 5BXCA 4HO9A 5T1DB 4U5CE 1O7OA 1XHBA 4NAKA 2CU2A 3RFYA 3DUVA 5AJNA 3EHMA 1QZXA 2P6WA 4CJ8A 1MP3A 2IYLD 2NUPB 5E3CA 4KBLA 3EGDA 1MNEA 1V82A 2CGEA 2IXPA 3JT1A 1G9RA 3USQA 2EILC 2W4BA 4EEOA 1ON8A 4Y7VA 4M2AA 4I3MA 2R7OA 3Q6MA 3SP1A 4JCHA 3E25A 2MWQA 2VS4A 4I44A 2X5SA 3PNNA 2HV7A 1G93A 1QGQA 3KIAA 3OWTA 2IXMA 4Q7CA 1W57A 2L9JA 1WT2A 2KGOA 4O6YA 5KYWA 1WT1A 4GYTA 3LESA 1H4DA 3OH1A 4FRMA 4KC4A 3ST8A 3SXDA 4D48A 4FREA 4HO5A 4DECA 1H7QA 3LNRA 3KL4A 4W8KA 1RJ9B 3I4UA 1YROB 4CS9C 4KQLA 4Y64A 1PZYB 2FGYA 2HV6A 1GX0A 4Y6UA 3V0LA 4J18A 4RD9A 4WJ0A 5DDTA 1JYLA 2BO7A 2JCOA 1VMAA 1FRWA 3TZTA 2WAWA 5CI8A 3LLKA 4FRHA 2J0AA 1PCXA 1D1BA 5C4FA 2VB6A 1SS9A 2NUTB 4KC1A 2V0LA 3SYNA 3SPTA 1ZCUA 4FIXA 3S0XA 2Y3HA 1I52A 1NU7D 3ABMC 3OH4A 4G7ZF 1FGGA 1G3LA 2BO4A 3V8YA 4KNRA 3DMDA 4YT5A 4HO2A 4KXOA 5AJPA 4ASYA 3NKDA 2XRHA 2WVNA 2V3CC 4C7OA 1ZI3A 4IWBA 1NQIB 1Z3IX 2JD3A 1H7GA 4Y62A 3OAMA 3HLZA 4K0DA 3IEEA 4KI2A 5L3QA 4HO6A 3D5NA 3E9VA 2XWMA 2XSEA 1WT0A 3CKVA 4Y6NA 1H5SB 3U2XA 2AE7A 1IIMA 4N06A 4U5FE 1H4CA 3R3IA 4CS8A 5EJZA 1OMZA 2PGYA 3T4RA 3RSBA 2AESA 3F46A 4EBBA 1FO9A 3SNHA 1MMDA 2DYRC 4IJJA 1G95A 5T3WA 4FWVA 1OMXA 2O1GA 4YS8A 5FUHA 4BMAA 1LZ7A 4UEGA 4HFFB 1IZMA 4OINF 1QG8A 5C4CA 2J0BA 4ZLDA 3FAJA 2X51A 2CNWD 3B0UX 1JPNA 3LS1A 3U2TA 2WVLA 5CQPA 3DAFA 4YT4A 1YP4A 2P73A 3ZVRA 1MMAA 4YWQA 2RJ9A 2R7VA 2FYBA 3DXJF 2WEEA 2PX3A 4U5BE 1JV3A 1OCCC 4O79A 1VZUA 2Y4MA 5KYXA 2CW0F 3RIPA 1NU9C 1LVKA 4JVSA 4Y7UA 3DM5A 2ICYA 3KKBA 3CGXA 4DE7A 5DDVA 3VYWA 1ZDFA 3K6BA 3X2QC 4B6IA 1H5RB 2R7SA 4PFPA 2I5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6M A;  4O6N A;  5D91 A;  5D92 A;  4Q7C A;  4MND A; 
#chains in the Genus database with same CATH topology
 5JT4 A;  2ZPA A;  2EPM X;  4DDZ A;  2FAP B;  5AGF A;  3K1H A;  1H7T A;  1G2V A;  3NMI A;  1O23 B;  4CSA A;  1H7F A;  1BR4 A;  2YLG A;  4BJ6 A;  4BQH A;  3IQC A;  4FIY A;  2OEX A;  2FFH A;  1XZP A;  3EFO A;  4AL0 A;  3ABK C;  1H5S D;  3K7D A;  3I0K A;  2YQS A;  1ST6 A;  4O6N A;  2ZXP A;  1NMM B;  3R2W A;  3U8V A;  3E26 A;  3U3F A;  3GAN A;  2V0I A;  3TJ6 A;  1LL3 A;  5A6A A;  5DS4 A;  2AU5 A;  3LLI A;  1ZW2 A;  4Q5S F;  4BJ6 C;  3OA1 A;  1INJ A;  1OQM B;  3W8I A;  4XLN F;  3JUJ A;  4P6I C;  4BPM A;  4CBE A;  1RKE B;  3U2L A;  1NZE A;  1OKK D;  2VS3 A;  2HKV A;  4ASJ A;  1FR9 A;  3ZC4 A;  4J7T A;  3K1I C;  2QY9 A;  2PA4 A;  3O10 A;  2CYD A;  3AG1 C;  5JVE A;  2LFF A;  3FVY A;  3KPH A;  2R7X A;  3S28 A;  4CJB A;  4DOZ A;  2OI5 A;  2JCJ A;  4O6M A;  1M2V B;  2YC5 A;  4AE4 B;  3N0T A;  4DRI B;  5EIY A;  2A1D D;  2Y4J A;  4LLE A;  1QGS A;  1QPU A;  5BUO A;  3GEI A;  2NUT A;  3D98 A;  3DK5 A;  2AM5 A;  2RJ7 A;  4AX2 A;  2YLD A;  4MVM A;  1VZT A;  4MND A;  3S27 A;  2M4E A;  4P9F A;  1MP4 A;  1O0R A;  1ZI5 A;  2Q3T A;  1ZCT A;  3MLG A;  1MQV A;  4KPX A;  2Q4J A;  3JZ0 A;  3JCU Q;  2A0U A;  3OH2 A;  2WL8 A;  4U5E E;  3U3B A;  4NTF A;  4EHP A;  3EFO B;  1JV1 A;  3S84 A;  4ER9 A;  5L3V A;  1CGO A;  3L34 A;  1YA7 O;  3TUL A;  4O7G A;  4XLP F;  3FAP B;  5IDS A;  2JCL A;  2APC A;  2OEV A;  2XS8 A;  4MVR A;  3EQL F;  3V0M A;  1SYQ A;  3GWN A;  1W55 A;  1R80 A;  3U0C A;  1R81 A;  3HNJ A;  1ZHX A;  4NTB A;  2YZS A;  5JS5 A;  5F5F A;  5JQQ A;  1TR2 A;  2YES A;  3V91 A;  4HE8 D;  5L6V A;  5HSW A;  4ECM A;  5A6B A;  3NMK A;  1YAR O;  4EEM A;  5BQI A;  1LS1 A;  1S4N A;  3FMS A;  3AJM A;  2F22 A;  1VGW A;  2EIJ C;  2NXV A;  3ZTZ A;  2ASR A;  1Z90 A;  4R7P A;  2J8W A;  3EE5 A;  2ZXR A;  2L6G A;  3KH2 A;  1PV3 A;  4DVY P;  1D0X A;  4K1O A;  2VAS A;  4Z9H A;  5E33 A;  2B0J A;  3SX5 A;  1M6T A;  4Y7G A;  4ZLC A;  2RSE B;  3M79 A;  2H7V C;  4M63 A;  4RBN A;  4OIO F;  3L8I A;  4NAI A;  4Y7F A;  1M57 C;  2AVK A;  1T6Q A;  3V0P A;  3RF3 A;  1GWW A;  1ZHT A;  1WTY A;  4XPY A;  5CMG X;  4E1K A;  2LD6 A;  2HSQ A;  2QKX A;  3GUE A;  5FV9 A;  4HO0 A;  2XL4 A;  4HOC A;  1S4O A;  4EBK A;  2O1F A;  5E2Q A;  2PP4 A;  4JW1 A;  4MW8 A;  4OIR F;  3TOM A;  2YL7 A;  1WAT A;  1OR2 A;  1RKC A;  4FES A;  1W77 A;  3HKK A;  3IOJ A;  1VTM P;  1PZT A;  3S9O A;  4PR9 A;  2J0X A;  4CS9 A;  3PHF 2;  4CJC A;  5DS5 A;  3AG2 C;  3MYI A;  4E0H A;  2WVM A;  3LNM B;  2D7I A;  3POL A;  3MBG A;  1ZJ2 A;  4KPZ A;  2HZ8 A;  3T7N A;  3AG3 C;  3FHD A;  3WG7 C;  1LZ0 A;  5DVW A;  4Z9J A;  4G3P A;  3RQE A;  1VGU A;  4E18 A;  2DPW A;  4EE5 A;  1LL0 A;  5FTV A;  1OW7 A;  2FFV A;  1NWG B;  4DRH B;  5DQT A;  1R7V A;  1Q0M A;  3ZGF A;  2LK4 A;  4D11 A;  2ZXW C;  2XXA A;  4U5D E;  1QKR A;  5FTS A;  4LDR A;  5E3A A;  1YP2 A;  1HW2 A;  4LLC A;  2YC3 A;  1LVW A;  4C3B A;  3LS0 A;  1SMY F;  1H5T A;  5D92 A;  4D4X A;  4B5B A;  3I5P A;  2QH5 A;  5C8R A;  1ZJP A;  2FFU A;  1YDI A;  1BDJ B;  1OCR C;  3G4X A;  2Y3D A;  4ZDQ A;  5C49 A;  5FCL A;  3V0N A;  2GWW A;  5JSL A;  4J30 B;  4CSA C;  5C48 A;  2P7V A;  2WVO A;  5BXC A;  4U5C E;  1VB5 A;  1XHB A;  2NUP B;  4KBL A;  1MNE A;  3BEH A;  3AGU A;  3JT1 A;  4J7Y A;  2XM4 A;  4JCH A;  3PNN A;  4I44 A;  1E85 A;  1G93 A;  3KIA A;  1YJG A;  3OWT A;  2IXM A;  1NFN A;  1LS4 A;  1WT2 A;  5KYW A;  1WT1 A;  1H4D A;  3ST8 A;  3SXD A;  4XEV A;  3I4U A;  1GX0 A;  3V0L A;  3LEO A;  3TZT A;  2WAW A;  5CI8 A;  2J0A A;  3V5X A;  1E2X A;  2NUT B;  4MVU A;  3DI5 A;  4L6R A;  2BO4 A;  3DMD A;  2XM0 A;  3QVZ A;  5AJP A;  4C7O A;  2M64 A;  1LE2 A;  1H7G A;  4Y62 A;  3OAM A;  4KI2 A;  4HO6 A;  3D5N A;  2OKU A;  2XSE A;  3U2X A;  4MTO A;  2PGY A;  1OMX A;  4OIN F;  2CNW D;  3C7J A;  5CQP A;  3KYI A;  3ZVR A;  3M15 A;  1G4W R;  3MYF A;  3LUT B;  4U5B E;  4O79 A;  1APC A;  1HW1 A;  4FAP B;  1NU9 C;  1LVK A;  3GEH A;  3KKB A;  5F28 E;  4DE7 A;  1A7V A;  3VYW A;  3X2Q C;  2HJM A;  4EIY A;  2I5K A;  1FTS A;  2J9B A;  3GM1 A;  3EG9 A;  3FOQ A;  5L6S A;  1VH1 A;  4WGY A;  1VLT A;  4A4A A;  2DI3 A;  3DE8 A;  2E8B A;  2OI6 A;  2RIT A;  3RH3 A;  1I4Y A;  4PFO A;  2Y7A A;  5CQO A;  1QVX A;  1R7X A;  5CQN X;  4GEH A;  2FYA A;  3SX3 A;  2YQJ A;  4CIH A;  1UFB A;  3U2W A;  1XZ6 A;  4PJJ A;  3GEE A;  2VXL A;  2E3D A;  4C3E A;  3ABL C;  1E86 A;  1ZCY A;  4IGG A;  1ZJO A;  2A0B A;  2YKZ A;  2ZU9 A;  2ICW G;  4Y63 A;  3TK0 A;  3HNL A;  2VCA A;  2XLD A;  2YRF A;  2J45 A;  5HS2 A;  3C8G D;  1YAU O;  1VOM A;  5L0J A;  1H7E A;  3G4Z A;  4MQ9 F;  4DRJ B;  3U0X A;  2TMV P;  1L7C A;  2EIN C;  3B71 A;  3EH1 A;  3S90 A;  3DJN B;  1ON6 A;  1ZU5 A;  1Q0F A;  1NBB A;  1RXQ A;  1TW1 A;  1B68 A;  5D91 A;  2Z86 A;  2OQM A;  4K6R A;  2X65 A;  2C0N A;  3VM6 A;  2KJG A;  4AC3 A;  1DOV A;  3CKN A;  2WVK A;  2NSF A;  4QI0 A;  2HMQ A;  1YP3 A;  1A7E A;  4IB4 A;  1LZJ A;  3SX7 A;  1FG5 N;  3X1O A;  5AJO A;  2EPL X;  1D0Z A;  1N1C A;  3CKJ A;  2I5E A;  2P72 A;  3T6J A;  2BL2 A;  2L81 A;  1ZHY A;  3PCV A;  4IAR A;  4IRQ A;  5J49 A;  4XEK A;  2XMH A;  1CPQ A;  2J0W A;  5KYX B;  3Q80 A;  5FU8 A;  2YEV A;  3CKO A;  3V0O A;  2R7T A;  2PF4 E;  4MVZ A;  3H2U A;  4WAB A;  1JVD A;  2OCC C;  2UX8 A;  1G4U S;  3O39 A;  2P1A A;  1HJJ A;  4DBR A;  3SXY A;  4E7S A;  4NQF A;  3DD7 A;  2HUJ A;  5AC5 A;  4AAW A;  2Y3B A;  2OU6 A;  1TFO B;  5KYU B;  1ZHZ A;  2P6V A;  3B9Q A;  4MYB A;  2YWA A;  4J32 B;  3D8V A;  3GM2 A;  2WVQ A;  3LW6 A;  3ASO C;  2FY7 A;  1HY5 A;  4KT7 A;  2L7A A;  1TVY A;  3I0J A;  4LW3 A;  4M28 A;  2J7P D;  4NAN A;  5L0G A;  3ASN C;  3JTJ A;  1ZI1 A;  1W2W A;  3Q7G A;  4HG6 A;  4KNV A;  5COG A;  1ZDG A;  1K4V A;  2MZB A;  1Z63 A;  2NUP A;  2XLW A;  1IW7 F;  2XLM A;  1VIC A;  2ZXO A;  5DQZ A;  2KW3 C;  1JYK A;  3I0F A;  1NF5 B;  1U0B B;  2HMZ A;  5CI9 A;  1ZJ3 A;  3ZGG A;  2R7U A;  2G3V A;  2J9U A;  1ORS C;  2OOC A;  5L0H A;  3WHN A;  3W2W A;  1ZYR F;  1OXK A;  1TKN A;  3HNI A;  2C03 A;  3V0Q A;  3AGT A;  1HM9 A;  4F4B A;  2IOQ A;  2NSG A;  5DLJ A;  3UGO A;  4B4G A;  4D11 C;  5B3I A;  2FYD B;  2A6E F;  2IXO A;  4P02 A;  4BJ1 A;  4JJG A;  3PKQ A;  3NYJ A;  4CJO A;  4JEB A;  4FRA A;  5KYU A;  1AEP A;  1JPJ A;  2PFD A;  3AG4 C;  4U9E A;  4CS7 A;  4PJM A;  3EH2 A;  1SZI A;  1OKK A;  1MP5 A;  2IXN A;  2Y4L A;  2YHS A;  2VCB A;  5EHH A;  4MTF A;  1E5K A;  1OCO C;  3K8E A;  3IHU A;  4FRL A;  3EZI A;  1U6H A;  2HS5 A;  1A0B A;  5BQH A;  1OXB A;  3FXH A;  3NDB B;  1ZU4 A;  1J8Y F;  3IQT A;  2AP3 A;  4QDL A;  2Z87 A;  4FRB A;  2BE5 F;  2XLH A;  2ZD9 A;  5B3S C;  4FRQ A;  3ATP A;  1VPA A;  2VSH A;  2V26 A;  4G3S A;  4M4K A;  3W4Y A;  4BG0 A;  3G50 A;  1R7Y A;  5L0D A;  3DWW A;  4HO8 A;  1JAF A;  2RIX A;  1H5S A;  2E87 A;  2WGZ A;  3Q4S A;  3LEV A;  3DAG A;  1ZHJ A;  4AYJ A;  1FOA A;  4G3Q A;  3SXG A;  2EPO A;  1KTM A;  2AH9 A;  3VF0 A;  3CU0 A;  3I0E A;  2R03 A;  2ZU8 A;  5FU0 A;  4YL0 A;  4JZA A;  2OI7 A;  1ZIZ A;  4XWI A;  2W0W A;  4HO9 A;  1O7O A;  3RFY A;  3TOL A;  2R05 A;  5COM A;  1XWJ A;  1MP3 A;  2IYL D;  3EGD A;  1V82 A;  2CGE A;  2YL0 A;  1G9R A;  4Y7V A;  3ZTM A;  1G5Z A;  3SP1 A;  5CMI A;  1QGQ A;  4Q7C A;  3OH1 A;  4KC4 A;  4D48 A;  1FR0 A;  4HO5 A;  4DEC A;  3LNR A;  3KL4 A;  1YRO B;  4Y64 A;  1PZY B;  1QSP A;  2HV6 A;  4N6H A;  4J18 A;  5DDT A;  2BO7 A;  3HNK A;  1ZVZ A;  3LLK A;  1L3P A;  2V0L A;  1YZA A;  1ZCU A;  3L8J A;  3OH4 A;  1NU7 D;  1G3L A;  1R5I D;  4YT5 A;  3CEX A;  2XRH A;  2WVN A;  1ZI3 A;  1H6G A;  4E17 A;  4K0D A;  2L6H A;  1WT0 A;  1E84 A;  4U5F E;  1H4C A;  5EJZ A;  4CS8 A;  3T4R A;  4EBB A;  1FO9 A;  3SNH A;  1G95 A;  4YS8 A;  4UEG A;  1QG8 A;  2DB4 A;  5C4C A;  4ZLD A;  2X51 A;  3FAJ A;  4JIO A;  3B0U X;  1JPN A;  3U2T A;  2WVL A;  2RD9 A;  4YWQ A;  2RJ9 A;  2LIG A;  2R7V A;  2FYB A;  2PX3 A;  2CW0 F;  1HMD A;  4Y7U A;  3DM5 A;  2ICY A;  1JR8 A;  4MVS A;  1Q0D A;  5DDV A;  3K6B A;  4B6I A;  2R7S A;  3BRJ A;  2LFD A;  1PD0 A;  5C3D A;  1TWH A;  5A6J A;  2W0V A;  5C38 A;  1D1C A;  2EIK C;  1G97 A;  4KC9 A;  4H54 A;  2Z15 A;  5CMJ A;  4U5G A;  2BO6 A;  2Y4K A;  1ZZP A;  3T7M A;  4MVQ A;  4MIX A;  2QE9 A;  4YT2 A;  3SEO A;  3I0H A;  4ULV A;  3I0D A;  1Z6A A;  3IOI A;  2IBF A;  1C03 A;  4K7B A;  3FOO A;  2LSE A;  2RJ5 A;  1JMW A;  1FWY A;  1GS9 A;  2WB7 A;  4OD4 A;  4UDV A;  4DVZ A;  5BQG A;  1JOG A;  3I0C A;  3EZH A;  1LIH A;  4GBP A;  4HO3 A;  4HO4 A;  3RMW A;  1BZ4 A;  3SXK A;  3ITF A;  3EGX B;  4JEA A;  4JIS A;  1NLX A;  4CS8 C;  4G87 A;  4LW6 A;  2OG2 A;  3SXA A;  3A11 A;  3OKR A;  3I0L A;  1GQC A;  4PJN A;  2I15 A;  4FX5 A;  1HE1 A;  3T9O A;  1A7D A;  3WOD F;  4B2X A;  1V54 C;  2Y39 A;  2X60 A;  4MVO A;  3Q7U A;  1V83 A;  3QTH A;  1MND A;  2A68 F;  1BBH A;  2QUP A;  3T6G B;  2W45 A;  1T9K A;  1GM5 A;  2XWN A;  3O55 A;  3NGW A;  2LQG A;  4JD0 A;  3TQD A;  3U8P A;  1FFH A;  1LI7 A;  2W4M A;  5B1A C;  1VYI A;  3B0P A;  2AM4 A;  5FYE A;  1G0R A;  4IAO A;  3FWW A;  1FO8 A;  2J9W A;  5IY5 C;  4G7H F;  2IM8 A;  3MFN A;  1FXO A;  3N24 A;  5F5H A;  1H5T B;  2GGO A;  1H9G A;  4XEF A;  4EE3 A;  2I8B A;  4LAC B;  3LJB A;  1EYR A;  2VD4 A;  3CKQ A;  3F1Y A;  5B1B C;  4D0Z A;  3DM9 B;  4G78 A;  4DBQ A;  1H9T A;  3JYY A;  3Q7L A;  1GA8 A;  2V0J A;  4BJ5 A;  1LKX A;  4R32 A;  1G1L A;  2OJQ A;  1T6I A;  5JLI A;  4PJL A;  3F47 A;  4NAL A;  1OCZ C;  2J46 A;  1BR1 A;  1VM8 A;  2Y6P A;  2AWY A;  1VYK A;  2YL1 A;  1S4P A;  4ANJ A;  5EGY A;  1H5S C;  3V90 A;  1TWC A;  3SZR A;  2NPU A;  4DXW A;  4AK9 A;  3IQ5 A;  1KWS A;  5COF A;  4KNW A;  1K40 A;  3DJ4 A;  3EJN A;  1AUE A;  1RMV A;  2VH3 A;  4FCE A;  5KYW B;  4B42 A;  2A8W A;  2Q9C A;  3EPV A;  1ZCV A;  5L0C A;  3UGP A;  3TD7 A;  256B A;  1O87 A;  3FOP A;  5C3A A;  2YQY A;  3NYL A;  4RDA A;  2VCC A;  1UG7 A;  3RQG A;  4AE4 A;  2R7W A;  3U2V A;  3VRC A;  3I0G A;  3R2P A;  2D4U A;  3UMK A;  3S29 A;  1GQA A;  3I0I X;  1ZHW A;  3VAY A;  4YL3 A;  4FCU A;  1HV9 A;  1GWV A;  3BCV A;  4CDV A;  1FZW A;  3JRM O;  4JUR I;  3POV A;  2XME A;  3SXE A;  1G23 A;  4BJT A;  3DE9 A;  4C3D A;  1S7Z A;  3U5S A;  3CQZ A;  2EIM C;  4P00 A;  2XXA B;  4G0H A;  3M1C B;  1R7U A;  4MTG A;  3MX3 A;  3RYL A;  1DOW A;  4JE9 A;  2R25 A;  5C1H A;  2VSI A;  3OC9 A;  2KNH A;  1HM8 A;  1NHE B;  1FMV A;  4LDK A;  3A9C A;  2RJ6 A;  1VLS A;  3DZA A;  4AL1 A;  1YA9 A;  2G62 A;  3CSK A;  1WAS A;  1H7L A;  3NKE A;  1U89 A;  2VXM A;  3PDM P;  3B29 A;  1T01 A;  3ZQV A;  4NC3 A;  3M4C A;  4YJW A;  1I5N A;  1WGW A;  3RVY A;  4B4B A;  4EVW A;  3T6B A;  3EGD B;  1ZJ0 A;  3OEO A;  1FGX A;  2XLO A;  5C36 A;  1Q0G A;  3ZF8 A;  2H7O A;  4JC7 A;  3RKO F;  2AEC A;  1O7Q A;  4FQW A;  2Q9A A;  1H3M A;  3OGZ A;  2PNO A;  4M2B A;  3HJC A;  3SX8 A;  3O3P A;  1SF8 A;  2JCK A;  3E70 C;  2R7R A;  3ECS A;  2PBE A;  2CCY A;  5IFY A;  2LP4 A;  1LI5 A;  4CIP A;  3QW0 A;  2V0H A;  2B0H A;  2HJ3 A;  2XWL A;  3U9J A;  1WVC A;  1TWA A;  2WZL A;  4FRO A;  2KK1 A;  3B0V C;  1PD1 A;  2YVK A;  1E83 A;  4L41 C;  4CJG A;  1WN0 A;  4YL1 A;  3W2V A;  1ZW3 A;  2AM3 A;  2Q00 A;  5JUA A;  3J06 A;  3C63 A;  1V74 B;  2A6H F;  4CDY A;  4QI2 A;  2P61 A;  3JSZ A;  1EQ1 A;  1M2V A;  2RIZ A;  4EKW A;  3BRK X;  2Y69 C;  3CZ6 A;  1R4T A;  3ZLK A;  1ORY A;  3PMR A;  1INI A;  5AC4 A;  4E7Z A;  1LM3 B;  2YQH A;  1EI7 A;  1I4Z A;  3HTK C;  1H7I A;  2G3K A;  5T1D B;  4NAK A;  2UUI A;  3DKA A;  5AJN A;  3DUV A;  5E3C A;  2IXP A;  4EEO A;  4IAQ A;  4E0I A;  4JKV A;  2BC5 A;  4M2A A;  3KYJ A;  3Q6M A;  3E25 A;  2MWQ A;  2X5S A;  2KGO A;  3SXM A;  3LES A;  4FRE A;  1H7Q A;  1RJ9 B;  3IPM O;  2JX0 A;  5TJ5 E;  2JCO A;  1C17 M;  4FRH A;  1PCX A;  1SS9 A;  3SYN A;  2OJE D;  4FIX A;  3S0X A;  2Y3H A;  2MHR A;  1I52 A;  2QLA A;  3ABM C;  4G7Z F;  1FGG A;  5HV9 A;  4KNR A;  4HO2 A;  4ASY A;  3NKD A;  2V3C C;  1F1M A;  1Z3I X;  2JD3 A;  3HLZ A;  4Z9I A;  2AE7 A;  1IIM A;  2AES A;  2XLE A;  1MMD A;  5T3W A;  5FUH A;  1GGQ A;  1IZM A;  4HFF B;  4EUK B;  2XLV A;  2AWC A;  4CDA A;  3LS1 A;  3TQO A;  2GAQ A;  2P73 A;  1MMA A;  2GA0 A;  3DXJ F;  1OCC C;  3V5Y A;  3RIP A;  5EK0 A;  3RW0 A;  2YL3 A;  4DJ9 A;  4JVS A;  3RVZ A;  1ZDF A;  1H5R B;  4GQH A;  1GX4 A;  1V4A A;  4OIP F;  3U2U A;  4LER A;  5K0I A;  1QWJ A;  3IOH A;  1SR2 A;  4Q4Z F;  2XL8 A;  1G8X A;  4I1O B;  3JRT A;  1LZI A;  3DJU B;  2QGI A;  2XL6 A;  1TFK B;  3UNG C;  2I7B A;  1IIN A;  1M2O A;  2H8A A;  3OH0 A;  3NMJ A;  5EJ1 A;  5CQL X;  1G8O A;  4N4W A;  1Q0K A;  3KMI A;  4I1M A;  1TWG A;  1VGZ A;  4H4K C;  3ZIB A;  2Q4F A;  5GPG B;  2UUH A;  5DS6 A;  3K1I A;  3EHN A;  1O3U A;  2GFH A;  3UR3 C;  1ZI4 A;  2ETS A;  4C2S A;  1HJL A;  3QZC A;  3ZQY A;  3QMK A;  1T5O A;  1OQC A;  4KNX A;  4HFK B;  3GOR A;  1R7T A;  1QLE C;  4XWJ A;  1VH3 A;  2Q9B A;  2D0J A;  4KC2 A;  3U2M A;  3U0Y A;  4XTK A;  5KYY A;  5FZT A;  5I1F A;  2QNL A;  1HM0 A;  4CVH A;  2PX0 A;  1RJ9 A;  1ZJ1 A;  3RMV A;  2QTV A;  3L0I A;  4HEA J;  2V0K A;  2KYH A;  4OIQ F;  4CX9 A;  2KQ9 A;  1NG1 A;  2KSF A;  4Y7T A;  3JTL O;  4B4M A;  4N6C A;  3JYH A;  5C1L A;  3K33 A;  2MYS A;  4ONS A;  1K05 A;  4ULW A;  1EKY A;  3US6 A;  1O5H A;  1VZX A;  3F1C A;  5T3T A;  4G7O F;  2EPK X;  4XPX A;  2YQC A;  5C4B A;  3Q6N A;  1QQ3 A;  2OEG A;  2A8U A;  4B3U A;  1OR3 A;  2D5R B;  3SXC A;  3V5Z A;  1YYJ A;  5L0I A;  2VK9 A;  3OH3 A;  2DGJ A;  3C8G B;  1NSG B;  4JRZ A;  1FR8 A;  3U9M A;  4Y9X A;  3SXB A;  2D7R A;  4YT8 A;  5C3B A;  3GWL A;  2AGD A;  1CPR A;  2Y3G A;  4EEG A;  3H65 A;  4MS2 A;  4JJF A;  1WWP A;  2X0C A;  1EZI A;  2RJ1 A;  2RJ4 A;  4PAC A;  3I5Q A;  1FXJ A;  3JUK A;  3LAY A;  1LPE A;  3C18 A;  3V7O A;  3ZDL A;  1H5R A;  1EA8 A;  2W9Y A;  3R7C A;  2FYC B;  2VFZ A;  4FRP A;  4D0T A;  1H7H A;  5KYY B;  2GDC A;  1Z5Z A;  1VGT A;  1Y4C A;  3NRH A;  2Q7R A;  4JCZ A;  1ORJ A;  1Z7Q c;  3T7O A;  5CMH A;  2WE9 A;  4C7O B;  1WT3 A;  3WAQ A;  1FFT C;  2XS1 A;  2BO8 A;  1HMO A;  4ARW A;  3EGX A;  5JP7 A;  3ZG1 A;  1GQ9 A;  4PK4 A;  3QW1 A;  4D4N A;  3K8D A;  1TZF A;  3L1M A;  4W8P A;  3V8Z A;  4LDQ A;  1YZC A;  1D0Y A;  2VS5 A;  1AVO B;  3RQF A;  2CDQ A;  1WSZ A;  1V84 A;  1TQG A;  4X0R A;  4XQ1 A;  2RJ0 A;  3HL3 A;  4NCQ A;  3ZLL A;  3N9W A;  4FRD A;  5JRA A;  3W8H A;  2R9R B;  3USR A;  3C8Z A;  4MW3 A;  2DYS C;  4EWC A;  1KU2 A;  1XZQ A;  3M4B A;  1M56 C;  2WZG A;  4EE4 A;  5KYN A;  1C02 A;  3UMI A;  4P9T A;  2C04 A;  3EG9 B;  3O6X A;  1NFO A;  3ZWI A;  1FMW A;  2VC9 A;  3H2V A;  3PKP A;  1Y6D A;  2JPU A;  4A2N B;  3C8G A;  1HE9 A;  3ZSU A;  1TW5 A;  2HFI A;  4WGZ A;  2H7B A;  5A6K A;  3GM3 A;  1JVG A;  3NYM A;  2NG1 A;  3AQB A;  3AOU A;  4IRP A;  4NTA A;  3QVY A;  4BEJ A;  5C4E A;  2A69 F;  2RIY A;  2J9V A;  4HCQ A;  1OW6 A;  4U9D A;  4EEA A;  2ZU7 A;  1D1A A;  5C4D A;  2YCM A;  3QVB A;  1RKE A;  5L0F A;  4YN0 B;  4JTC B;  3SXZ A;  1V55 C;  2ICX A;  3NG1 A;  4B2W A;  3N2Z B;  5C47 A;  1KNY A;  2GGQ A;  2J7P A;  1NKH B;  3GOD A;  3JSE O;  1OW8 A;  1Z23 A;  5IDT A;  2LCH A;  1LL2 A;  2RJ8 A;  4KRV A;  1H4E A;  1MC3 A;  2PX7 A;  4AYL A;  5CIV A;  4JTA B;  5CMF X;  1A41 A;  1J8M F;  1VK5 A;  1WOL A;  2PGV A;  3AQC A;  2X5Z A;  3K66 A;  1BR2 A;  5CQM X;  5A69 A;  4OD5 A;  4NY3 A;  4IRU A;  1MMN A;  2R7Q A;  1S05 A;  2WZF A;  2OEF A;  2O1H A;  2CNW A;  3FDQ A;  1MMG A;  1R82 A;  1YVI A;  2L6F A;  2KC3 A;  2O9X A;  1CGM E;  2EPN A;  4U5H A;  3UMH A;  4BJ5 C;  2R02 A;  1YYX A;  2CU2 A;  3EHM A;  1QZX A;  2P6W A;  4CJ8 A;  3USQ A;  2EIL C;  2W4B A;  1ON8 A;  4I3M A;  2R7O A;  5C1G A;  3IQ6 A;  2VS4 A;  1CGN A;  2HV7 A;  4EBJ A;  1W57 A;  2L9J A;  4FRM A;  4O6Y A;  4GYT A;  4W8K A;  4KQL A;  4CS9 C;  5A6B D;  2FGY A;  4Y6U A;  1RCP A;  4RD9 A;  4WJ0 A;  1JYL A;  1VMA A;  1FRW A;  1LE4 A;  1D1B A;  5C4F A;  2VB6 A;  4KC1 A;  3SPT A;  3V8Y A;  4JTD B;  4KXO A;  2P0N A;  4XPW A;  1NQI B;  4IWB A;  1FAP B;  3IEE A;  5L3Q A;  3E9V A;  2XWM A;  3CKV A;  1FNT c;  4Y6N A;  1H5S B;  4N06 A;  3R3I A;  1OMZ A;  3RSB A;  3F46 A;  2DYR C;  4IJJ A;  2O1G A;  4BMA A;  4FWV A;  1LZ7 A;  3C62 A;  2J0B A;  4BEM J;  2YLI A;  3DAF A;  3TJ5 A;  4YT4 A;  1YP4 A;  4YK5 A;  1K04 A;  1T6U A;  3CAX A;  2WEE A;  2Y4M A;  1JV3 A;  1VZU A;  5KYX A;  2HSB A;  1JRA A;  3CGX A;  1YLM A;  4PFP A; 
#chains in the Genus database with same CATH homology
 1GX4 A;  1FTS A;  1PD0 A;  5C3D A;  4OIP F;  3U2U A;  1TWH A;  2W0V A;  4LER A;  1D1C A;  5C38 A;  2ZPA A;  2EIK C;  1QWJ A;  3IOH A;  4Q4Z F;  1G97 A;  4KC9 A;  1G8X A;  3EG9 A;  4DDZ A;  2Z15 A;  3FOQ A;  5CMJ A;  5L6S A;  4U5G A;  2BO6 A;  2Y4K A;  3K1H A;  1H7T A;  1VH1 A;  4I1O B;  1G2V A;  3JRT A;  1O23 B;  2E8B A;  3T7M A;  1LZI A;  3DJU B;  4CSA A;  1H7F A;  2QGI A;  3UNG C;  2OI6 A;  2I7B A;  2RIT A;  1IIN A;  1BR4 A;  1M2O A;  3RH3 A;  4PFO A;  2Y7A A;  3OH0 A;  5CQO A;  4BJ6 A;  4MIX A;  5EJ1 A;  4BQH A;  5CQL X;  1G8O A;  1R7X A;  5CQN X;  4GEH A;  4YT2 A;  2FYA A;  4FIY A;  3SX3 A;  3KMI A;  2YQJ A;  4I1M A;  4CIH A;  2FFH A;  3SEO A;  3EFO A;  1TWG A;  3ABK C;  1H5S D;  1VGZ A;  3I0H A;  4H4K C;  3K7D A;  3ZIB A;  1XZ6 A;  3I0K A;  2YQS A;  3I0D A;  1Z6A A;  3IOI A;  3U2W A;  1ST6 A;  4PJJ A;  5DS6 A;  2VXL A;  5CMI A;  4O6N A;  2ZXP A;  3EHN A;  4K7B A;  1NMM B;  2GFH A;  3UR3 C;  2E3D A;  3R2W A;  1ZI4 A;  4C3E A;  3ABL C;  1ZCY A;  3E26 A;  4C2S A;  3GAN A;  1HJL A;  1ZJO A;  2V0I A;  1LL3 A;  2LSE A;  3QZC A;  2RJ5 A;  3QMK A;  5DS4 A;  1FWY A;  2ZU9 A;  2WB7 A;  4OD4 A;  4DVZ A;  4Y63 A;  3LLI A;  4KNX A;  4HFK B;  3I0C A;  1R7T A;  4Q5S F;  4BJ6 C;  1QLE C;  3EZH A;  4XWJ A;  3OA1 A;  1VH3 A;  2J45 A;  2Q9B A;  5HS2 A;  1INJ A;  1OQM B;  2D0J A;  4KC2 A;  4GBP A;  4HO3 A;  4HO4 A;  3U0Y A;  3RMW A;  3W8I A;  4XTK A;  1VOM A;  4XLN F;  3JUJ A;  1H7E A;  5KYY A;  3ITF A;  4MQ9 F;  3EGX B;  3U0X A;  4JIS A;  4P6I C;  5I1F A;  4CS8 C;  2EIN C;  1HM0 A;  4G87 A;  4LW6 A;  3EH1 A;  4CVH A;  3DJN B;  1ON6 A;  2OG2 A;  1ZU5 A;  3SXA A;  2PX0 A;  1RJ9 A;  4CBE A;  1TW1 A;  3OKR A;  1ZJ1 A;  3I0L A;  2QTV A;  5D91 A;  3L0I A;  1GQC A;  4HEA J;  1NZE A;  4PJN A;  2V0K A;  1OKK D;  2VS3 A;  4ASJ A;  4FX5 A;  3WOD F;  1FR9 A;  2Z86 A;  4B2X A;  3ZC4 A;  1V54 C;  4K6R A;  2X65 A;  2Y39 A;  3K1I C;  2C0N A;  2X60 A;  4OIQ F;  1V83 A;  3Q7U A;  1MND A;  2QY9 A;  2A68 F;  2PA4 A;  3AG1 C;  2KJG A;  2KQ9 A;  4AC3 A;  3CKN A;  1NG1 A;  3FVY A;  4Y7T A;  2WVK A;  4B4M A;  2R7X A;  3S28 A;  4QI0 A;  4CJB A;  4DOZ A;  2W45 A;  3JYH A;  2OI5 A;  2JCJ A;  2XWN A;  4O6M A;  3NGW A;  1M2V B;  1YP3 A;  5C1L A;  2YC5 A;  4JD0 A;  3TQD A;  3K33 A;  2MYS A;  1FFH A;  1LZJ A;  3SX7 A;  2W4M A;  5B1A C;  4AE4 B;  3N0T A;  1FG5 N;  4ULW A;  3X1O A;  1VYI A;  3B0P A;  2AM4 A;  5AJO A;  5FYE A;  5EIY A;  2A1D D;  1G0R A;  4LLE A;  1O5H A;  1QGS A;  2Y4J A;  4IAO A;  1D0Z A;  1N1C A;  5BUO A;  3CKJ A;  1FO8 A;  2J9W A;  3FWW A;  5IY5 C;  2NUT A;  4G7H F;  1VZX A;  3D98 A;  5T3T A;  4G7O F;  3F1C A;  2I5E A;  3DK5 A;  1FXO A;  2P72 A;  2YQC A;  5C4B A;  3Q6N A;  3N24 A;  3T6J A;  2AM5 A;  5F5H A;  2L81 A;  4AX2 A;  1H5T B;  2RJ7 A;  2GGO A;  2OEG A;  2A8U A;  1ZHY A;  4B3U A;  4IRQ A;  1VZT A;  2D5R B;  4MND A;  3S27 A;  3SXC A;  2M4E A;  5J49 A;  1MP4 A;  2XMH A;  4EE3 A;  1O0R A;  2J0W A;  1ZI5 A;  2I8B A;  2Q3T A;  1ZCT A;  3MLG A;  4LAC B;  2VK9 A;  5KYX B;  3LJB A;  1EYR A;  2VD4 A;  3CKQ A;  3F1Y A;  2Q4J A;  3Q80 A;  4KPX A;  5FU8 A;  2YEV A;  3JCU Q;  5B1B C;  4D0Z A;  3DM9 B;  3CKO A;  3OH3 A;  2DGJ A;  4DBQ A;  3V0O A;  2R7T A;  2PF4 E;  3OH2 A;  1FR8 A;  2WL8 A;  4U5E E;  4Y9X A;  3SXB A;  2D7R A;  3Q7L A;  4YT8 A;  1GA8 A;  5C3B A;  2AGD A;  2Y3G A;  1JVD A;  2OCC C;  4EEG A;  3H65 A;  2UX8 A;  3EFO B;  1JV1 A;  2V0J A;  4JJF A;  4BJ5 A;  1LKX A;  3O39 A;  5L3V A;  1EZI A;  1HJJ A;  4DBR A;  2RJ1 A;  1G1L A;  4E7S A;  3L34 A;  2RJ4 A;  3DD7 A;  3I5Q A;  4O7G A;  1FXJ A;  4PJL A;  3F47 A;  3JUK A;  4XLP F;  5IDS A;  4NAL A;  1OCZ C;  2J46 A;  3LAY A;  2JCL A;  2APC A;  1BR1 A;  1VM8 A;  3EQL F;  2Y6P A;  3V0M A;  1VYK A;  3V7O A;  1S4P A;  2Y3B A;  4ANJ A;  1W55 A;  1H5R A;  4AAW A;  5EGY A;  1H5S C;  3V90 A;  2W9Y A;  5KYU B;  1R80 A;  1TWC A;  1ZHZ A;  2P6V A;  1R81 A;  2FYC B;  2VFZ A;  3SZR A;  4FRP A;  4D0T A;  4AK9 A;  1KWS A;  3B9Q A;  1H7H A;  5KYY B;  1ZHX A;  4MYB A;  4KNW A;  2YZS A;  5F5F A;  3DJ4 A;  3EJN A;  1Z5Z A;  1VGT A;  5JQQ A;  3NRH A;  4J32 B;  1TR2 A;  2VH3 A;  4FCE A;  2YES A;  3D8V A;  4HE8 D;  3V91 A;  5L6V A;  3T7O A;  5KYW B;  5HSW A;  4ECM A;  5CMH A;  4B42 A;  2WE9 A;  4C7O B;  2WVQ A;  3LW6 A;  2A8W A;  2Q9C A;  3EPV A;  1WT3 A;  1ZCV A;  3ASO C;  2FY7 A;  5C1G A;  4EEM A;  4KT7 A;  1LS1 A;  3UGP A;  1S4N A;  3TD7 A;  1TVY A;  3I0J A;  4LW3 A;  1O87 A;  1VGW A;  2EIJ C;  4M28 A;  2NXV A;  3NYL A;  5C3A A;  4RDA A;  2J7P D;  1Z90 A;  1FFT C;  4R7P A;  4NAN A;  4AE4 A;  2R7W A;  2ZXR A;  3ASN C;  3EE5 A;  2BO8 A;  3JTJ A;  3KH2 A;  1ZI1 A;  4ARW A;  1W2W A;  3Q7G A;  3U2V A;  3EGX A;  4DVY P;  3I0G A;  4HG6 A;  4KNV A;  1D0X A;  3ZG1 A;  1GQ9 A;  4PK4 A;  1ZDG A;  3K8D A;  3UMK A;  1K4V A;  2MZB A;  1Z63 A;  1TZF A;  2NUP A;  3S29 A;  2VAS A;  3I0I X;  5E33 A;  2B0J A;  1ZHW A;  3SX5 A;  3V8Z A;  3VAY A;  3SXE A;  4FCU A;  1IW7 F;  4Y7G A;  1HV9 A;  1GWV A;  1D0Y A;  4ZLC A;  1VIC A;  2VS5 A;  3BCV A;  2ZXO A;  5DQZ A;  1FZW A;  2H7V C;  2KW3 C;  4JUR I;  2CDQ A;  4M63 A;  4RBN A;  3POV A;  1JYK A;  2XME A;  3I0F A;  1G23 A;  4BJT A;  4OIO F;  1WSZ A;  4NAI A;  1V84 A;  4Y7F A;  1M57 C;  4C3D A;  1S7Z A;  1NF5 B;  3V0P A;  3CQZ A;  2EIM C;  4P00 A;  4X0R A;  2RJ0 A;  3HL3 A;  2XXA B;  4G0H A;  5CI9 A;  1GWW A;  1ZJ3 A;  3M1C B;  1R7U A;  3RYL A;  3MX3 A;  1ZHT A;  3ZGG A;  3ZLL A;  2R7U A;  2G3V A;  2J9U A;  3N9W A;  5CMG X;  4FRD A;  5C1H A;  2VSI A;  4E1K A;  3OC9 A;  3W8H A;  3USR A;  2KNH A;  1HM8 A;  1NHE B;  2QKX A;  3W2W A;  1ZYR F;  4EWC A;  2DYS C;  3GUE A;  5FV9 A;  1KU2 A;  1FMV A;  1TKN A;  1M56 C;  2C03 A;  4HO0 A;  2XL4 A;  4HOC A;  1S4O A;  2RJ6 A;  3V0Q A;  2WZG A;  4EE4 A;  1HM9 A;  3DZA A;  2O1F A;  4F4B A;  5E2Q A;  2G62 A;  2IOQ A;  5KYN A;  2PP4 A;  5DLJ A;  3CSK A;  4JW1 A;  3UGO A;  1H7L A;  4B4G A;  3UMI A;  3NKE A;  4OIR F;  2C04 A;  3EG9 B;  2FYD B;  4D11 C;  2A6E F;  3O6X A;  2IXO A;  4P02 A;  2VXM A;  1FMW A;  4FES A;  1W77 A;  4BJ1 A;  4JJG A;  3PKP A;  3IOJ A;  1PZT A;  4A2N B;  3PKQ A;  4YJW A;  3ZSU A;  3NYJ A;  1TW5 A;  2J0X A;  1WGW A;  2H7B A;  4CS9 A;  4B4B A;  3PHF 2;  5KYU A;  4FRA A;  4CJC A;  1JVG A;  1JPJ A;  3NYM A;  4EVW A;  2NG1 A;  3AQB A;  5DS5 A;  3AG2 C;  3T6B A;  4IRP A;  3EGD B;  1ZJ0 A;  2PFD A;  3OEO A;  2WVM A;  3AG4 C;  1FGX A;  4CS7 A;  2D7I A;  3POL A;  5C36 A;  4BEJ A;  1ZJ2 A;  4PJM A;  3EH2 A;  2H7O A;  4KPZ A;  1SZI A;  3ZF8 A;  5C4E A;  3T7N A;  1OKK A;  3AG3 C;  2A69 F;  3RKO F;  3FHD A;  1MP5 A;  2RIY A;  2IXN A;  2J9V A;  4HCQ A;  2Y4L A;  2YHS A;  3WG7 C;  4EEA A;  1LZ0 A;  2ZU7 A;  1D1A A;  5DVW A;  4G3P A;  5C4D A;  5EHH A;  2AEC A;  2YCM A;  1O7Q A;  4FQW A;  1VGU A;  3QVB A;  1E5K A;  1OCO C;  2Q9A A;  1H3M A;  3K8E A;  3OGZ A;  4M2B A;  3HJC A;  4YN0 B;  4FRL A;  3EZI A;  1V55 C;  2DPW A;  2ICX A;  3O3P A;  3SX8 A;  4EE5 A;  3NG1 A;  1LL0 A;  3N2Z B;  5FTV A;  5C47 A;  4B2W A;  1SF8 A;  2JCK A;  3E70 C;  2GGQ A;  2J7P A;  2R7R A;  3ECS A;  1NKH B;  3NDB B;  3GOD A;  1NWG B;  2FFV A;  5IFY A;  1ZU4 A;  1J8Y F;  1Z23 A;  5IDT A;  4QDL A;  2Z87 A;  5DQT A;  1LL2 A;  4FRB A;  2RJ8 A;  2V0H A;  1R7V A;  4KRV A;  1H4E A;  2BE5 F;  1MC3 A;  2PX7 A;  5B3S C;  4FRQ A;  2XWL A;  3ZGF A;  4D11 A;  1WVC A;  4AYL A;  1TWA A;  2ZXW C;  1J8M F;  1VK5 A;  1VPA A;  2VSH A;  2WZL A;  2V26 A;  2XXA A;  5CMF X;  4FRO A;  4G3S A;  4U5D E;  4M4K A;  4BG0 A;  1PD1 A;  3B0V C;  5FTS A;  1R7Y A;  2PGV A;  3AQC A;  2X5Z A;  4L41 C;  5E3A A;  3K66 A;  1YP2 A;  4HO8 A;  1BR2 A;  5CQM X;  2RIX A;  1H5S A;  4OD5 A;  4LLC A;  4NY3 A;  3W2V A;  2YC3 A;  1LVW A;  4C3B A;  2E87 A;  3LS0 A;  1SMY F;  4IRU A;  2AM3 A;  2WGZ A;  3Q4S A;  1MMN A;  2A6H F;  4QI2 A;  2R7Q A;  3LEV A;  3DAG A;  1H5T A;  5D92 A;  2WZF A;  1ZHJ A;  4AYJ A;  3JSZ A;  3I5P A;  2QH5 A;  4B5B A;  1FOA A;  4G3Q A;  5C8R A;  3SXG A;  1ZJP A;  2OEF A;  1M2V A;  2O1H A;  2FFU A;  2RIZ A;  3BRK X;  2Y69 C;  2CNW A;  1OCR C;  2Y3D A;  4ZDQ A;  3CZ6 A;  3FDQ A;  2AH9 A;  5C49 A;  3ZLK A;  5FCL A;  3V0N A;  3CU0 A;  3PMR A;  3I0E A;  1INI A;  2ZU8 A;  1MMG A;  1R82 A;  5FU0 A;  4E7Z A;  4J30 B;  3RMV A;  4JZA A;  2YQH A;  4CSA C;  1ZIZ A;  2OI7 A;  2O9X A;  3HTK C;  4U5H A;  3UMH A;  4XWI A;  2G3K A;  5C48 A;  2P7V A;  4BJ5 C;  2W0W A;  2WVO A;  5BXC A;  4HO9 A;  5T1D B;  4U5C E;  1O7O A;  1XHB A;  4NAK A;  2CU2 A;  3RFY A;  3DUV A;  5AJN A;  3EHM A;  1QZX A;  2P6W A;  4CJ8 A;  1MP3 A;  2IYL D;  2NUP B;  5E3C A;  4KBL A;  3EGD A;  1MNE A;  1V82 A;  2CGE A;  2IXP A;  3JT1 A;  1G9R A;  3USQ A;  2EIL C;  2W4B A;  4EEO A;  1ON8 A;  4Y7V A;  4M2A A;  4I3M A;  2R7O A;  3Q6M A;  3SP1 A;  4JCH A;  3E25 A;  2MWQ A;  2VS4 A;  4I44 A;  2X5S A;  3PNN A;  2HV7 A;  1G93 A;  1QGQ A;  3KIA A;  3OWT A;  2IXM A;  4Q7C A;  1W57 A;  2L9J A;  1WT2 A;  2KGO A;  4O6Y A;  5KYW A;  1WT1 A;  4GYT A;  3LES A;  1H4D A;  3OH1 A;  4FRM A;  4KC4 A;  3ST8 A;  3SXD A;  4D48 A;  4FRE A;  4HO5 A;  4DEC A;  1H7Q A;  3LNR A;  3KL4 A;  4W8K A;  1RJ9 B;  3I4U A;  1YRO B;  4CS9 C;  4KQL A;  4Y64 A;  1PZY B;  2FGY A;  2HV6 A;  1GX0 A;  4Y6U A;  3V0L A;  4J18 A;  4RD9 A;  4WJ0 A;  5DDT A;  1JYL A;  2BO7 A;  2JCO A;  1VMA A;  1FRW A;  3TZT A;  2WAW A;  5CI8 A;  3LLK A;  4FRH A;  2J0A A;  1PCX A;  1D1B A;  5C4F A;  2VB6 A;  1SS9 A;  2NUT B;  4KC1 A;  2V0L A;  3SYN A;  3SPT A;  1ZCU A;  4FIX A;  3S0X A;  2Y3H A;  1I52 A;  1NU7 D;  3ABM C;  3OH4 A;  4G7Z F;  1FGG A;  1G3L A;  2BO4 A;  3V8Y A;  4KNR A;  3DMD A;  4YT5 A;  4HO2 A;  4KXO A;  5AJP A;  4ASY A;  3NKD A;  2XRH A;  2WVN A;  2V3C C;  4C7O A;  1ZI3 A;  4IWB A;  1NQI B;  1Z3I X;  2JD3 A;  1H7G A;  4Y62 A;  3OAM A;  3HLZ A;  4K0D A;  3IEE A;  4KI2 A;  5L3Q A;  4HO6 A;  3D5N A;  3E9V A;  2XWM A;  2XSE A;  1WT0 A;  3CKV A;  4Y6N A;  1H5S B;  3U2X A;  2AE7 A;  1IIM A;  4N06 A;  4U5F E;  1H4C A;  3R3I A;  4CS8 A;  5EJZ A;  1OMZ A;  2PGY A;  3T4R A;  3RSB A;  2AES A;  3F46 A;  4EBB A;  1FO9 A;  3SNH A;  1MMD A;  2DYR C;  4IJJ A;  1G95 A;  5T3W A;  4FWV A;  1OMX A;  2O1G A;  4YS8 A;  5FUH A;  4BMA A;  1LZ7 A;  4UEG A;  4HFF B;  1IZM A;  4OIN F;  1QG8 A;  5C4C A;  2J0B A;  4ZLD A;  3FAJ A;  2X51 A;  2CNW D;  3B0U X;  1JPN A;  3LS1 A;  3U2T A;  2WVL A;  5CQP A;  3DAF A;  4YT4 A;  1YP4 A;  2P73 A;  3ZVR A;  1MMA A;  4YWQ A;  2RJ9 A;  2R7V A;  2FYB A;  3DXJ F;  2WEE A;  2PX3 A;  4U5B E;  1JV3 A;  1OCC C;  4O79 A;  1VZU A;  2Y4M A;  5KYX A;  2CW0 F;  3RIP A;  1NU9 C;  1LVK A;  4JVS A;  4Y7U A;  3DM5 A;  2ICY A;  3KKB A;  3CGX A;  4DE7 A;  5DDV A;  3VYW A;  1ZDF A;  3K6B A;  3X2Q C;  4B6I A;  1H5R B;  2R7S A;  4PFP A;  2I5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...