5D92A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
340
Chain Sequence
b'MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 107
structure length 340
sequence length 342
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d92A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d92A01
4O6MA 4O6NA 4Q7CA 5D92A 5D91A 4MNDA
chains in the Genus database with same CATH superfamily
4YL1A 2RJ6A 3OKRA 5F28E 4E0IA 2FFHA 3CEXA 2X5ZA 1GA8A 3U9MA 3RQFA 3EGXA 3DI5A 4JISA 5L0DA 3T6BA 4ZLCA 1ZJPA 3ASOC 1RCPA 5KYUB 1XHBA 1XZ6A 4CIPA 2QE9A 3PKPA 2KK1A 3SXYA 3AJMA 5D91A 1FG5N 3N9WA 1YP2A 2XM0A 1QSPA 3B0UX 4FRBA 1EA8A 2Y4JA 5B3SC 2Y4KA 1WOLA 4YT4A 1G4US 3GEHA 4HE8D 4MVRA 2R7WA 2AWCA 3DKAA 2QUPA 3NYJA 2L7AA 4R32A 2BC5A 2VXMA 2LQGA 2A6EF 4DE7A 5DS5A 1LE4A 2CCYA 4O7GA 2VS4A 2J45A 3OAMA 5IDSA 4U5HA 2J9WA 5C4FA 2PX3A 4JCZA 4D4XA 2Q9AA 4F4BA 2RJ1A 4LERA 1VTMP 1HW1A 4HOCA 2XWMA 1XWJA 4MVOA 2IM8A 4BG0A 5C4CA 5C8RA 5KYWA 3C7JA 1MNEA 3SXCA 1Q0FA 2D7RA 4OD5A 4DDZA 3JZ0A 4LDKA 2YQCA 1S05A 5DDTA 4D4NA 4M2BA 3GM3A 2RJ5A 4AAWA 4L41C 2OEXA 1YAUO 1ON6A 4RDAA 2IXNA 2YL1A 2LFFA 1G23A 3A11A 1U89A 1KWSA 4FWVA 2WGZA 4EBBA 1ZCUA 1LS4A 1YVIA 1YP4A 1WT0A 2XL8A 5CQPA 2ICYA 5FTSA 3AGUA 1LIHA 3NYMA 5E3AA 3U2WA 4MIXA 3E9VA 3RF3A 1HW2A 2PF4E 5BXCA 5KYXA 2A68F 4RD9A 3I0KA 3USQA 2CGEA 3QVYA 5F5FA 1NU7D 2WL8A 5KYYA 4LDQA 1DOWA 4G78A 4FCEA 3SXDA 4E0HA 3ECSA 3LAYA 2XS8A 1FAPB 4HO6A 1V55C 3C63A 3Q7LA 3V5ZA 2PA4A 3WODF 2DPWA 2IYLD 5C47A 2L6GA 2CU2A 2AECA 5KYWB 4IAOA 3OH4A 2V0LA 4MTOA 3BEHA 2G3KA 1JPJA 1Y4CA 2R7XA 4XWIA 1E83A 2OG2A 1LE2A 4IB4A 3TJ6A 2A1DD 2NUTA 4ZDQA 2P73A 1EI7A 2EPNA 2D0JA 1E86A 2KC3A 3ST8A 2J9BA 2VC9A 1O3UA 5C3DA 3TD7A 5HS2A 2EIMC 3JSZA 1H4CA 1H7HA 4Y7VA 1ZHZA 3V8ZA 4JKVA 1Z23A 1T6UA 1S7ZA 2FYAA 3W8IA 1A41A 4M4KA 1J8YF 2A69F 2I15A 3EQLF 1LL3A 4AL1A 1FGXA 1CGNA 4KC1A 2R03A 1TZFA 2O1HA 1MMDA 4OIQF 1I52A 2UUIA 3EHMA 5EIYA 1XZPA 2A8WA 1D1AA 1LL2A 1PZTA 3K7DA 5JUAA 1E85A 1JRAA 4U5DE 5JLIA 4G3SA 1LL0A 3IEEA 3AQCA 3MYIA 4K7BA 4EHPA 1Z7Qc 2HSQA 1ZJ3A 2Y6PA 3RVYA 2EPLX 3CKOA 2ZU7A 3LJBA 2VFZA 3HNLA 1MMNA 2NUPB 5BQIA 1R7YA 1TVYA 4YL0A 1ORSC 4CJCA 1ZI1A 2J46A 2W0VA 5I1FA 1NMMB 1G5ZA 2JPUA 3KKBA 3SPTA 1NU9C 2GWWA 3SXAA 1WVCA 3US6A 5AJNA 2A0BA 2WZFA 4KXOA 4C7OB 2V0JA 2ICXA 1WSZA 2RJ0A 1FMWA 4EE3A 3M79A 3GWNA 2JCLA 2ZPAA 4L6RA 3DZAA 5L0FA 4AYLA 2XXAA 2E87A 1NSGB 3CSKA 2Q9CA 3BCVA 3PMRA 5E2QA 2UX8A 1OCCC 4ONSA 2WEEA 4CSAA 4LDRA 2BE5F 2DGJA 4UDVA 3I5PA 4B4GA 4DECA 4J7YA 1INIA 4BJ5C 4U9DA 2IXMA 1NWGB 1HMOA 2XRHA 4XWJA 1PCXA 2H7VC 5CI8A 4OINF 4EUKB 3CKJA 2LCHA 3FVYA 2XL4A 4XPXA 1QVXA 3ABLC 1BBHA 1E2XA 2KGOA 1JYLA 4DRJB 1VPAA 3KL4A 1TFKB 4D0TA 4FRQA 4G87A 3ZQYA 1NQIB 5IDTA 3DAFA 4Z9IA 1WGWA 3K33A 1H5TA 1QGQA 2KNHA 2RJ9A 2L6HA 3AG2C 1Q0GA 4NALA 3G4ZA 5D92A 3NDBB 3JCUQ 3I0JA 2HSBA 1VZUA 2ASRA 1M6TA 3FXHA 1NF5B 1YYXA 2HS5A 1FR8A 1CPRA 2KSFA 3U5SA 3ASNC 3H2VA 3RSBA 2J7PA 2Y3BA 4I1MA 4IRQA 3C8GD 4XEKA 3X2QC 2RJ7A 4BJTA 5DS4A 1Y6DA 5T3WA 2FFUA 1G95A 1V84A 3W2WA 3ATPA 3ZQVA 3FDQA 2LFDA 3DM9B 5T1DB 1Q0DA 1NBBA 1HM9A 2HJ3A 3UMKA 4PJMA 3AG4C 1YZCA 5C4EA 4KRVA 3RQEA 2YLIA 3S28A 3V0PA 2YQJA 5DQTA 3I0DA 3ZGFA 3PDMP 3QTHA 3GANA 4IJJA 1M2VB 1PV3A 4HO2A 3CKQA 2XLEA 3MX3A 4HFKB 2R7QA 1ZJ2A 4Y7GA 2R7TA 2PX0A 4KNVA 4Y62A 2Q9BA 2XLHA 4O6MA 2ZXRA 5JS5A 1G8OA 1ZI4A 1YA7O 3Q7GA 1K05A 4EBKA 5BUOA 3CQZA 3U0CA 1H5TB 2FYCB 1VZTA 4N06A 4CJGA 3POLA 2R25A 2AU5A 5FUHA 4CDYA 2R7SA 3U2VA 5AGFA 4MYBA 2VCCA 1VOMA 1CPQA 3DM5A 4OD4A 4AE4A 3S29A 1R7UA 5BQGA 1FWYA 3BRKX 3NMIA 2JCOA 5CMFX 3DWWA 3K1IA 2R02A 1NHEB 4KNXA 4G3PA 4NC3A 4YK5A 4G7HF 4WGZA 2YC5A 1M56C 3KH2A 1OQCA 3B9QA 1YP3A 3I0GA 4EVWA 1ZYRF 3K8DA 3W8HA 2TMVP 5C1HA 5CQNX 4OIOF 2V0KA 3RW0A 2ZD9A 2LD6A 3KMIA 1H7LA 1TW5A 3F1YA 2IOQA 3QVZA 4FRPA 1ZHTA 5DVWA 1FOAA 2PX7A 5B1AC 4GBPA 4Y63A 1U0BB 2B0HA 2LP4A 2YEVA 5EGYA 2XLMA 4LLEA 4JVSA 3K8EA 2YQYA 3EH1A 1EYRA 2QLAA 3ZTZA 3T6GB 1GQAA 1FO9A 3SX3A 1Z6AA 1OR2A 5AC4A 3GM1A 1H7GA 3DJNB 4D48A 4UEGA 2P0NA 2EPMX 3VF0A 3D5NA 1H6GA 2OOCA 2GAQA 2AM3A 2O1FA 2YKZA 2X51A 1H5SA 3G50A 1D0YA 4FREA 4FAPB 3V0NA 5CQLX 1GM5A 4QI2A 1LM3B 1NFOA 3ZG1A 4AE4B 1M57C 1ZI5A 4ULWA 1EZIA 4GEHA 1ZW2A 2ZU8A 3L1MA 3B0VC 5A6BD 3HLZA 2EPKX 4NAIA 1S4OA 3VRCA 2XMHA 3JSEO 5L6SA 1TQGA 1JOGA 1C02A 4N6HA 4JW1A 1FTSA 2Y4LA 3IQTA 3LLKA 3O6XA 3CKNA 1C03A 4U5GA 4CS8C 2J0AA 2D7IA 1JAFA 2V0HA 4P9FA 3ZC4A 3DAGA 2W9YA 4CDVA 2R7OA 3JTJA 4KPXA 1LZJA 3WHNA 1JV3A 2WVLA 4CVHA 1JYKA 1T6IA 2J8WA 1H7TA 3OGZA 1UG7A 4A2NB 1ZHXA 3LEVA 2RJ4A 4JD0A 3TJ5A 3B29A 3K6BA 3T9OA 4B2WA 3SEOA 3ZF8A 3EGXB 4JTAB 4C2SA 1D0XA 3RIPA 3UMIA 4DOZA 1Z5ZA 1GQ9A 2VD4A 3I5QA 4CDAA 2EPOA 1JV1A 1T6QA 1QKRA 1NG1A 1E5KA 2Q00A 1ST6A 4NQFA 5JQQA 3FMSA 3U8VA 1H5SB 2X60A 4D11A 2EINC 1NLXA 1G3LA 2ZXPA 3CGXA 4ASJA 3HNIA 1UFBA 1VYKA 2AP3A 3EHNA 5KYNA 3GEIA 1GX0A 5CQMX 1KTMA 4WABA 2XLOA 4AYJA 5C38A 4HEAJ 2ZXOA 3USRA 2C04A 4JURI 5TJ5E 2PFDA 2H8AA 4FIXA 2PP4A 1HM8A 4Q4ZF 1R81A 3ZSUA 2YQSA 2P1AA 4BJ6A 2JD3A 4R7PA 4BEMJ 5AJOA 3W2VA 4ER9A 3E25A 1GQCA 1W57A 2O9XA 5L0IA 3EFOA 3KYIA 3U3BA 4DXWA 2WB7A 3EG9A 1ZIZA 1RXQA 3EH2A 2J9VA 1LKXA 2BL2A 1VGWA 1VH3A 2HFIA 1YYJA 2GDCA 4FQWA 2V3CC 1V54C 1LS1A 1KNYA 1FRWA 1W55A 4DJ9A 3H2UA 2FAPB 2OJED 3SXZA 4Y9XA 4BQHA 2XL6A 4EIYA 4ANJA 3IOHA 1JPNA 5KYXB 1FNTc 1D1CA 3K66A 1VYIA 4WGYA 1QWJA 1VLTA 4H4KC 1TW1A 5KYYB 2EIJC 2YLGA 3U2UA 1PD1A 2AM5A 1FGGA 3O10A 5CI9A 1I4ZA 2XLDA 1SYQA 2R05A 4G3QA 5DLJA 4C3EA 2ZU9A 256BA 2CW0F 2YC3A 4B2XA 3EJNA 3V0MA 4C3DA 4CX9A 3OA1A 1OQMB 1SF8A 1AVOB 2Y3GA 2DB4A 2WAWA 2B0JA 1WT2A 3UGPA 1E84A 1OCRC 1HJJA 4K1OA 1LZIA 3IOJA 4Y6UA 3V5XA 4IAQA 1APCA 4LACB 1H9TA 4MS2A 2VS3A 5CMIA 5L3VA 3SX8A 2NUTB 5FV9A 3Q6MA 3EG9B 2HJMA 5DDVA 3QW1A 3ABKC 4ASYA 2JCKA 2XSEA 1ZJOA 4CJOA 3PHF2 3T6JA 4JTDB 3SXKA 5F5HA 1OXBA 2AGDA 2IXPA 4AX2A 4XEFA 4M63A 3OC9A 3I0CA 4MTGA 1SZIA 2MHRA 2LK4A 1WT1A 5CMJA 5IFYA 2A0UA 4P9TA 4PACA 3CKVA 1R7TA 2WE9A 3LLIA 4ECMA 4OIRF 4KC4A 3KIAA 3ITFA 2FYBA 4Q7CA 3C8GA 2Z87A 3RQGA 4AC3A 4IWBA 3LUTB 3U2MA 3FOPA 2OEGA 4C3BA 4Y7FA 1QPUA 2AVKA 1IW7F 2YVKA 1VH1A 3ZLKA 1QG8A 1OR3A 3L8JA 1WASA 5GPGB 2YL7A 2QNLA 1R7VA 4XLPF 4CS7A 4GQHA 1LZ7A 3R2WA 3V0OA 3IQCA 3Q6NA 4JZAA 4O79A 1QZXA 1T5OA 5L0CA 4FRAA 4DRHB 1NZEA 1H5RA 1R4TA 1O5HA 3Q4SA 1LZ0A 1QQ3A 5L6VA 3EE5A 2WVOA 5C48A 1V74B 4YL3A 5B1BC 1RKCA 4EBJA 4GYTA 2P72A 1GS9A 4CS9C 3VM6A 1FR0A 3OH2A 2CNWD 3FAPB 4J32B 1V4AA 2RIYA 3M15A 2R9RB 2R7UA 3T7NA 1A7DA 1WTYA 1BR2A 3Q7UA 1RKEA 3VAYA 1OKKA 4YT5A 4XTKA 3QVBA 1DOVA 3ZWIA 2AE7A 3EGDA 2HKVA 4NTBA 1ZJ1A 2XXAB 2YLDA 2VCBA 1MP3A 4JIOA 2BO4A 2O1GA 2PGVA 1HM0A 3HJCA 4JC7A 1D1BA 4LLCA 3WG7C 2EILC 5JRAA 5C4DA 1FFTC 2UUHA 2QY9A 3SZRA 3AG1C 2OCCC 1H3MA 1Q0KA 2NSGA 1Z90A 5C1GA 3S90A 5FU0A 1JR8A 1D0ZA 4E1KA 4J18A 3CZ6A 4FX5A 4IRUA 4H54A 1FZWA 4DVZA 4CSAC 1ON8A 5JSLA 2DYRC 4MVQA 2H7OA 4KT7A 1HE9A 4QDLA 4B42A 4DVYP 4YJWA 3T4RA 4EWCA 1ZDFA 4P6IC 1H5RB 1S4PA 5CMGX 3S9OA 2BO8A 4DRIB 3HL3A 4Z9HA 1HY5A 2L81A 4XPYA 3KPHA 3V0QA 3SXBA 5K0IA 2X65A 4RBNA 2MZBA 1LVWA 2HV6A 2AESA 4FRHA 1VGZA 1I5NA 1H7IA 2PBEA 1FMVA 3OWTA 2HMZA 5C3AA 4EKWA 3JRMO 1RJ9A 1SMYF 3IPMO 4JEAA 2R7VA 1TWHA 2Q4FA 1OMXA 2NSFA 3B0PA 5COGA 1RKEB 4FRLA 2RIZA 3EGDB 3NG1A 1Q0MA 3LS1A 3NYLA 4PJLA 3HNJA 1N1CA 2Y3HA 2XS1A 1VMAA 3KYJA 1YARO 4FRMA 3LESA 5IY5C 3V5YA 3FOOA 4Y7TA 5COFA 4KBLA 1OW6A 1JVDA 4Y64A 1Z63A 2Y3DA 1LI7A 1I4YA 4U5EE 2Y69C 3RVZA 3LNRA 4EEMA 3RKOF 5T3TA 1JVGA 4X0RA 3SYNA 3T7MA 2GGQA 4CJ8A 5L0HA 3PKQA 1CGME 2OJQA 1RMVA 2G62A 3PCVA 1O23B 3AGTA 4ULVA 3HNKA 4U5FE 1H7QA 1PZYB 2FFVA 1MMAA 3CAXA 3GORA 2WVKA 2DYSC 1S4NA 4PK4A 1WT3A 3N0TA 4I1OB 3JUJA 3QW0A 4JRZA 4AK9A 2AH9A 4HO9A 1OCOC 3RMWA 1GWVA 1G0RA 4LW3A 2DI3A 1FFHA 3RYLA 5EJZA 4PJJA 1RJ9B 4YS8A 1WATA 3EPVA 5COMA 3ZIBA 2RJ8A 4NANA 1A7VA 3U9JA 4MW8A 3FHDA 2H7BA 1TWCA 4O6YA 2J0XA 1FR9A 3B71A 4O6NA 1ZCVA 4ZLDA 1FXJA 4JE9A 5FCLA 4I3MA 1TR2A 5J49A 2R7RA 1GGQA 3V7OA 2OEVA 4W8PA 4G0HA 1G93A 4XEVA 1ZHJA 3C18A 3O3PA 4MTFA 3M1CB 3K1IC 1EQ1A 2KYHA 1BR4A 1V83A 2VS5A 2GFHA 3V0LA 4OIPF 3WAQA 5CIVA 1C17M 3DE9A 4KC2A 2P61A 2NXVA 1OXKA 3UR3C 1LI5A 2IBFA 3I0FA 2YL0A 4Y6NA 4PFOA 1FO8A 2YRFA 3DE8A 4Y7UA 5B3IA 3T7OA 3Q80A 3S0XA 2JX0A 1H9GA 1L7CA 4EEGA 1YDIA 2W4MA 3DXJF 5FTVA 3N24A 5EK0A 1IINA 3GEEA 4EE4A 1J8MF 3SP1A 2L6FA 1K04A 1HV9A 1ORYA 1H5SD 2G3VA 5CMHA 2XWLA 1XZQA 2FYDB 2V0IA 1WN0A 1R7XA 1VZXA 3O39A 5AC5A 4J7TA 2M64A 4EE5A 4B5BA 4FRDA 1ZI3A 1F1MA 1AUEA 2V26A 1H5SC 1YA9A 4E7SA 3JTLO 1G97A 5C3BA 2KQ9A 1ZDGA 3FAJA 3NGWA 3SNHA 3UGOA 3MBGA 4E7ZA 2ZXWC 4KI2A 1GX4A 3SX5A 3SXGA 3SXMA 4HO8A 5L0GA 2XMEA 5C4BA 2J0WA 4FROA 4MVSA 1YJGA 3I0IX 3LW6A 5C36A 4EEOA 2OU6A 3TULA 5DS6A 2I8BA 2LIGA 1R82A 3V90A 3VYWA 2VASA 3GUEA 3TOMA 3U2LA 4HG6A 2NUPA 2AM4A 1VK5A 4LW6A 3PNNA 5L3QA 2EIKC 3GODA 3IQ6A 1YZAA 2ETSA 4N4WA 1MNDA 4HO3A 4KNWA 1BZ4A 2OI7A 1K4VA 2C03A 4Q5SF 3CU0A 5A6KA 1BR1A 1EKYA 1HMDA 4CJBA 3AQBA 4C7OA 3I0HA 4YWQA 2QKXA 3O55A 3UNGC 4JJGA 3IQ5A 1G9RA 1LPEA 1VICA 4KNRA 4CIHA 2LSEA 2HMQA 4B6IA 1G2VA 1ZCYA 4NTAA 3FWWA 3NMJA 1ZJ0A 4XQ1A 2YQHA 4E18A 4BJ5A 4AL0A 3MLGA 5FU8A 2RIXA 2FGYA 1H4DA 1VB5A 1TFOB 1H4EA 1MMGA 3GM2A 1M2OA 1V82A 4HO0A 4D11C 1FXOA 1WWPA 2D5RB 4MVZA 4W8KA 1TKNA 3D98A 5JP7A 2KW3C 2I5KA 1VLSA 3QZCA 2A6HF 2OKUA 2XLWA 4NCQA 1LVKA 3FOQA 3DK5A 4ARWA 2Z15A 2YHSA 4KPZA 1H7EA 4CS9A 3TQDA 5FZTA 3JYYA 3EFOB 3ZTMA 4E17A 3MFNA 3UMHA 2E8BA 3V8YA 3F46A 1HJLA 2WZLA 2APCA 1PD0A 4JCHA 1QGSA 4PFPA 1A0BA 3JT1A 2J0BA 3DJ4A 1ZU5A 3L0IA 1T01A 3LEOA 3M4CA 4BJ6C 5JVEA 1MQVA 5L0JA 1MP4A 2VXLA 2Y7AA 3JUKA 2CNWA 2OQMA 2AWYA 3EZHA 4B4MA 1G4WR 2GA0A 2C0NA 1NFNA 2M4EA 4JTCB 2YESA 1GWWA 2Y4MA 4JJFA 2KJGA 4FESA 1VGTA 4FIYA 3S27A 3NKEA 2IXOA 4WJ0A 5A6AA 1G1LA 5EHHA 4IRPA 2F22A 2RITA 1ZZPA 2X0CA 4K6RA 4PJNA 2YWAA 4D0ZA 2VSHA 1OMZA 4K0DA 4BEJA 2MWQA 1ORJA 2FY7A 1HE1A 3DJUB 3M4BA 3I4UA 1O87A 5CQOA 2BO7A 3I0LA 1NKHB 3TZTA 4MNDA 2VH3A 5EJ1A 2BO6A 5BQHA 2XLVA 2A8UA 4NTFA 4HCQA 5AJPA 2P7VA 1VGUA 3DUVA 2WVMA 4I44A 3E70C 4YT8A 3OH1A 4MVUA 2I5EA 1IIMA 5C49A 3TK0A 3E26A 3U0YA 3LS0A 2RSEB 1ZU4A 3NMKA 1M2VA 4XLNF 1MP5A 1L3PA 1K40A 3NKDA 1OW8A 3MYFA 5JT4A 3EZIA 3J06A 3IOIA 2WVNA 3U2XA 1YLMA 2CDQA 4U5CE 4BJ1A 2Q4JA 2QTVA 1A7EA 4A4AA 3ZLLA 2GGOA 1U6HA 1B68A 5FYEA 3ZGGA 2MYSA 4YT2A 2YL3A 4U9EA 3I0EA 4B3UA 4MQ9F 3ABMC 3HTKC 2E3DA 4P02A 1ZHYA 4HO4A 4CBEA 2VB6A 2J9UA 1O0RA 1IZMA 2P6WA 3JYHA 4U5BE 2VCAA 4G7OF 4MVMA 1Z3IX 3C8GB 2JCJA 1W2WA 2QGIA 2X5SA 3R2PA 1O7QA 3QMKA 2Z86A 2HV7A 2Q7RA 1SS9A 1INJA 3POVA 3ZVRA 2VK9A 4JEBA 1YROB 1ZVZA 4DBQA 4IARA 2QH5A 5DQZA 4G7ZF 2P6VA 1SR2A 3F47A 4BMAA 4KC9A 1QLEC 1W77A 3OH3A 4P00A 4KQLA 2NPUA 5A6JA 3NRHA 3RFYA 1TWGA 2HZ8A 1CGOA 1KU2A 4Z9JA 3AOUA 1ZW3A 3TOLA 1OCZC 2W45A 3X1OA 3DMDA 2YZSA 3BRJA 4NAKA 4B4BA 1R80A 2HUJA 1O7OA 1H7FA 2W0WA 2YCMA 3LNMB 3HKKA 1OW7A 2W4BA 3A9CA 2PNOA 1R5ID 3F1CA 5HV9A 3R7CA 1ZHWA 2ICWG 3AG3C 1VM8A 4XPWA 5KYUA 3W4YA 1AEPA 1ZCTA 4PR9A 1G8XA 4N6CA 4NY3A 2XWNA 3RMVA 3H65A 2WVQA 4M28A 1OKKD 2Y39A 3U3FA 1T9KA 3IHUA 4QI0A 4CS8A 2OEFA 5A6BA 4DBRA 3C8ZA 2J7PD 3C62A 3DD7A 3L34A 2CYDA 3OEOA 2XM4A 4BPMA 3R3IA 2D4UA 4M2AA 3V91A 3TQOA 5E33A 2PGYA 3ZDLA 3L8IA 4J30B 1MC3A 2I7BA 4MW3A 4IGGA 5A69A 3JRTA 4EEAA 3OH0A 3GWLA 3RH3A 5E3CA 4HFFB 3G4XA 4HO5A 3SX7A 3S84A 3SXEA 1BDJB 4FCUA 3N2ZB 2VSIA 1JMWA 3D8VA 1TWAA 5C1LA 2OI6A 2L9JA 2Q3TA 2OI5A 3U0XA 2WZGA 4YN0B 2RD9A 2NG1A 3U2TA 5HSWA 3U8PA 3K1HA
chains in the Genus database with same CATH topology
2V26A 4IRQA 2RJ6A 1H5SC 3OKRA 4E7SA 2VS3A 5CMIA 3X2QC 2FFHA 5L3VA 2RJ7A 1G97A 4BJTA 2NUTB 3SX8A 2X5ZA 5FV9A 3Q6MA 5DS4A 3EG9B 1GA8A 5C3BA 5T3WA 2FFUA 2KQ9A 1ZDGA 3FAJA 5DDVA 1G95A 3ABKC 1V84A 3W2WA 2JCKA 4ASYA 2XSEA 3EGXA 1ZJOA 3NGWA 3SNHA 3FDQA 4JISA 3DM9B 3PHF2 3T6BA 3UGOA 5T1DB 3T6JA 4ZLCA 4E7ZA 2ZXWC 4KI2A 1GX4A 3SX5A 1HM9A 1ZJPA 3SXGA 3ASOC 3UMKA 4PJMA 5F5HA 2AGDA 4HO8A 2IXPA 3AG4C 4AX2A 5KYUB 2XMEA 4M63A 3OC9A 2J0WA 5C4BA 5C4EA 4FROA 1XHBA 1XZ6A 4KRVA 3PKPA 3I0IX 3LW6A 5C36A 3S28A 4EEOA 3V0PA 2YQJA 3I0CA 5D91A 5DQTA 1FG5N 3I0DA 3ZGFA 5DS6A 3N9WA 3GANA 1SZIA 2I8BA 4IJJA 1R82A 1M2VB 1WT1A 3B0UX 1YP2A 5CMJA 4HO2A 5IFYA 3CKQA 4FRBA 2Y4JA 5B3SC 3MX3A 1R7TA 2Y4KA 3CKVA 2WE9A 3V90A 3LLIA 2VASA 4HFKB 2R7QA 3VYWA 4YT4A 1ZJ2A 4ECMA 4HE8D 2R7WA 3GUEA 4OIRF 4HG6A 4KC4A 4Y7GA 2NUPA 2AM4A 3KIAA 2R7TA 3ITFA 1VK5A 2PX0A 4LW6A 3PNNA 3NYJA 2FYBA 4Q7CA 2EIKC 3GODA 4KNVA 5L3QA 4Y62A 2Q9BA 2Z87A 4O6MA 4IWBA 2ZXRA 4AC3A 1G8OA 1ZI4A 4HO3A 1MNDA 3Q7GA 4KNWA 5BUOA 2OEGA 3CQZA 4C3BA 1H5TB 2FYCB 2VXMA 4Y7FA 2A6EF 4DE7A 5DS5A 1VZTA 2OI7A 4O7GA 1K4VA 2C03A 1IW7F 4Q5SF 2VS4A 2J45A 1VH1A 3CU0A 4N06A 1BR1A 3OAMA 4CJBA 3ZLKA 1QG8A 3AQBA 4C7OA 3POLA 5IDSA 4U5HA 2J9WA 5FUHA 3I0HA 5C4FA 2PX3A 2R7SA 2RJ1A 2Q9AA 4F4BA 4YWQA 3U2VA 2QKXA 4LERA 4MYBA 3UNGC 4HOCA 1R7VA 4XLPF 2XWMA 4JJGA 4CS7A 1LZ7A 1VOMA 1G9RA 4BG0A 5C4CA 3DM5A 1VICA 3R2WA 3V0OA 4OD4A 5KYWA 5C8RA 4AE4A 3Q6NA 4CIHA 4KNRA 2LSEA 3S29A 1R7UA 1MNEA 4JZAA 4O79A 1QZXA 4B6IA 3SXCA 1G2VA 1ZCYA 4FRAA 1FWYA 2D7RA 3FWWA 1ZJ0A 1NZEA 4OD5A 1H5RA 2YQHA 3BRKX 4DDZA 4BJ5A 1O5HA 3Q4SA 1LZ0A 2JCOA 5CMFX 5L6VA 3EE5A 2YQCA 3MLGA 5FU8A 2RIXA 2WVOA 1NHEB 4KNXA 5C48A 5DDTA 2FGYA 5B1BC 4G3PA 4M2BA 4G7HF 2RJ5A 4AAWA 2YC5A 1H4DA 4GYTA 1M56C 3KH2A 1H4EA 3B9QA 1YP3A 3I0GA 4L41C 1MMGA 2P72A 4EVWA 1ZYRF 1ON6A 4RDAA 1M2OA 3K8DA 1V82A 4CS9C 4HO0A 3W8HA 4D11C 2IXNA 1FXOA 2D5RB 3OH2A 4W8KA 5C1HA 5CQNX 2CNWD 1TKNA 4OIOF 1G23A 1KWSA 2V0KA 4FWVA 2WGZA 4EBBA 1ZCUA 4J32B 2RIYA 3D98A 1YP4A 2KW3C 3KMIA 1H7LA 1TW5A 1WT0A 3F1YA 2I5KA 2IOQA 2R7UA 5CQPA 3T7NA 3QZCA 2ICYA 5FTSA 2A6HF 1BR2A 3Q7UA 4FRPA 1ZHTA 1OKKA 5DVWA 3VAYA 1FOAA 2PX7A 4YT5A 1LVKA 4XTKA 3NYMA 5E3AA 2AE7A 3DK5A 3FOQA 3QVBA 3U2WA 4ARWA 2Z15A 3EGDA 4MIXA 2YHSA 3E9VA 5B1AC 1H7EA 4GBPA 4KPZA 4Y63A 1ZJ1A 2XXAB 4CS9A 3TQDA 1MP3A 2YEVA 2PF4E 5EGYA 5KYXA 5BXCA 4LLEA 4JVSA 3K8EA 2A68F 2BO4A 2O1GA 2PGVA 4RD9A 3EH1A 1EYRA 1HM0A 3I0KA 3HJCA 3USQA 2CGEA 3EFOB 5F5FA 1FO9A 4LLCA 1D1BA 1NU7D 2WL8A 3WG7C 1Z6AA 2EILC 5KYYA 3SX3A 3UMHA 2E8BA 5C4DA 3V8YA 1FFTC 3SZRA 2QY9A 3AG1C 2OCCC 3F46A 1HJLA 1H7GA 2WZLA 2APCA 1H3MA 1PD0A 3DJNB 4JCHA 1Z90A 5C1GA 1QGSA 4PFPA 3DJ4A 3JT1A 2J0BA 4D48A 4FCEA 1ZU5A 4UEGA 3L0IA 4BJ6C 2Y7AA 5FU0A 3SXDA 3JUKA 1MP4A 1D0ZA 2VXLA 4E1KA 2CNWA 3D5NA 3ECSA 3LAYA 4J18A 3EZHA 3CZ6A 4B4MA 4FX5A 2C0NA 2AM3A 2O1FA 2M4EA 1V55C 3Q7LA 4IRUA 4HO6A 2PA4A 2X51A 1H5SA 2YESA 1FZWA 3WODF 2DPWA 1GWWA 1D0YA 4DVZA 2Y4MA 4JJFA 4CSAC 2KJGA 1ON8A 4FESA 4FREA 2IYLD 2DYRC 5C47A 1VGTA 4FIYA 3S27A 2H7OA 2CU2A 3V0NA 5CQLX 3NKEA 2IXOA 4WJ0A 4QI2A 1G1LA 5EHHA 3ZG1A 5KYWB 2AECA 4IRPA 4AE4B 4KT7A 1M57C 1ZI5A 4QDLA 4IAOA 4ULWA 2RITA 3OH4A 4B42A 4DVYP 4YJWA 3T4RA 4EWCA 1ZDFA 2V0LA 1EZIA 4P6IC 4PJNA 4K6RA 4GEHA 1H5RB 2G3KA 1S4PA 2ZU8A 4LACB 1JPJA 5CMGX 3B0VC 4D0ZA 2VSHA 1OMZA 2BO8A 3HL3A 4K0DA 3HLZA 4BEJA 2L81A 2R7XA 2MWQA 4XWIA 2FY7A 2OG2A 3DJUB 4NAIA 3I4UA 1S4OA 3V0QA 1O87A 3SXBA 2XMHA 5CQOA 2A1DD 2BO7A 3I0LA 5L6SA 1NKHB 2NUTA 3TZTA 4MNDA 2X65A 2VH3A 1FTSA 4JW1A 2P73A 2Y4LA 4RBNA 4ZDQA 5EJ1A 2BO6A 3LLKA 3O6XA 2MZBA 3CKNA 2D0JA 1LVWA 2HV6A 2A8UA 2AESA 4U5GA 1VGZA 4FRHA 4CS8C 3ST8A 1FMVA 3OWTA 5C3DA 4HCQA 5C3AA 2J0AA 3TD7A 2D7IA 5AJPA 2P7VA 1VGUA 3DUVA 2V0HA 5HS2A 2WVMA 3ZC4A 2EIMC 3JSZA 1H4CA 3DAGA 1RJ9A 1SMYF 3E70C 4I44A 4YT8A 3OH1A 2R7VA 1TWHA 2W9YA 1H7HA 4Y7VA 1ZHZA 2I5EA 1OMXA 2R7OA 1IIMA 3V8ZA 3B0PA 3JTJA 1Z23A 4KPXA 1LZJA 4FRLA 5C49A 1S7ZA 2FYAA 3W8IA 3E26A 3U0YA 3LS0A 4M4KA 2RIZA 1JV3A 1J8YF 2A69F 1JYKA 2WVLA 4CVHA 3EQLF 3EGDB 1ZU4A 3NG1A 1H7TA 1LL3A 3OGZA 1M2VA 1FGXA 4XLNF 3LS1A 1MP5A 4KC1A 3NYLA 3NKDA 4PJLA 1ZHXA 4A2NB 3LEVA 1TZFA 1N1CA 2RJ4A 2Y3HA 4JD0A 2O1HA 1VMAA 1MMDA 3K6BA 3EZIA 4OIQF 3EHMA 1I52A 4B2WA 5EIYA 3IOIA 4FRMA 2WVNA 3LESA 5IY5C 2A8WA 4Y7TA 1D1AA 3U2XA 3SEOA 1LL2A 1PZTA 3ZF8A 3EGXB 2CDQA 4KBLA 4U5CE 4C2SA 3K7DA 1D0XA 3RIPA 3UMIA 4BJ1A 2Q4JA 2QTVA 1JVDA 4Y64A 4U5DE 4DOZA 1Z5ZA 1Z63A 2Y3DA 1GQ9A 2VD4A 3ZLLA 3I5QA 2GGOA 4G3SA 1LL0A 1JV1A 4U5EE 3IEEA 2Y69C 3LNRA 4EEMA 3RKOF 5T3TA 1JVGA 1NG1A 3AQCA 4X0RA 1E5KA 4K7BA 1ST6A 3SYNA 3T7MA 5FYEA 2GGQA 4CJ8A 1ZJ3A 5JQQA 2Y6PA 3PKQA 1H5SB 2X60A 3ZGGA 4D11A 2EINC 2MYSA 2G62A 4YT2A 1G3LA 1O23B 3I0EA 4B3UA 3CKOA 4MQ9F 2ZU7A 3ABMC 3HTKC 2E3DA 2ZXPA 4P02A 1ZHYA 3LJBA 4HO4A 4U5FE 2VFZA 4CBEA 3CGXA 2VB6A 2J9UA 1O0RA 1H7QA 1IZMA 2P6WA 4ASJA 1MMNA 3JYHA 2NUPB 1VYKA 3EHNA 4U5BE 5KYNA 1PZYB 2FFVA 1R7YA 1TVYA 4G7OF 1MMAA 1GX0A 2WVKA 1Z3IX 2DYSC 1S4NA 4PK4A 1WT3A 2JCJA 3N0TA 4I1OB 3JUJA 1W2WA 5CQMX 2QGIA 2X5SA 4CJCA 4AK9A 1ZI1A 1O7QA 2AH9A 2J46A 3QMKA 2Z86A 2W0VA 5I1FA 1NMMB 4AYJA 5C38A 4HEAJ 2HV7A 2ZXOA 1SS9A 3KKBA 1INJA 4HO9A 1NU9C 3SPTA 3USRA 3POVA 3ZVRA 2C04A 2VK9A 1WVCA 3SXAA 5AJNA 4JURI 1YROB 2WZFA 1OCOC 4KXOA 2PFDA 4DBQA 4C7OB 4FIXA 2V0JA 2QH5A 2PP4A 5DQZA 4G7ZF 2ICXA 2P6VA 4BMAA 3F47A 1HM8A 3RMWA 4KC9A 1GWVA 1G0RA 1WSZA 2RJ0A 4LW3A 1QLEC 1W77A 3OH3A 1FMWA 4P00A 4Q4ZF 1R81A 4KQLA 1FFHA 3RYLA 5EJZA 4EE3A 4PJJA 1RJ9B 4YS8A 3NRHA 2JCLA 3RFYA 3ZSUA 2ZPAA 3DZAA 1TWGA 3EPVA 2YQSA 4BJ6A 2JD3A 1KU2A 3ZIBA 4M28A 4AYLA 4R7PA 5AJOA 2XXAA 2RJ8A 3W2VA 2E87A 4NANA 3CSKA 3E25A 1GQCA 1W57A 1OCZC 2Q9CA 3BCVA 2W45A 3PMRA 5E2QA 3X1OA 3DMDA 3FHDA 2O9XA 2H7BA 1OCCC 2YZSA 2UX8A 4NAKA 4B4BA 1TWCA 2WEEA 4O6YA 4CSAA 1R80A 3EFOA 1O7OA 2J0XA 2BE5F 1FR9A 2WB7A 4O6NA 1H7FA 3EG9A 1ZCVA 1ZIZA 3EH2A 4ZLDA 1FXJA 2DGJA 2W0WA 2YCMA 3I5PA 2J9VA 5FCLA 4I3MA 1TR2A 1LKXA 5J49A 4B4GA 1VGWA 2R7RA 1VH3A 3V7OA 2W4BA 3F1CA 4G0HA 1G93A 4DECA 4FQWA 2V3CC 1INIA 4BJ5C 1V54C 1LS1A 1ZHWA 1ZHJA 3O3PA 3M1CB 3AG3C 3K1IC 1VM8A 1FRWA 5KYUA 2IXMA 1NWGB 1W55A 1BR4A 1V83A 2VS5A 2GFHA 1ZCTA 1G8XA 3V0LA 4Y9XA 4OIPF 4BQHA 4NY3A 2XWNA 2XRHA 3RMVA 3H65A 4XWJA 2WVQA 4ANJA 1OKKD 1PCXA 4KC2A 3IOHA 2Y39A 2H7VC 5CI8A 4OINF 2NXVA 3UR3C 1JPNA 5KYXB 1D1CA 3CKJA 3FVYA 4QI0A 4CS8A 3I0FA 2OEFA 3K66A 4Y6NA 2XL4A 4PFOA 1FO8A 1VYIA 4DBRA 3ABLC 1QWJA 2J7PD 4H4KC 1TW1A 5KYYB 2KGOA 3DD7A 2EIJC 3L34A 3OEOA 1JYLA 1VPAA 3KL4A 4Y7UA 3U2UA 1PD1A 4D0TA 4FRQA 4G87A 3T7OA 2AM5A 3R3IA 3Q80A 1NQIB 3S0XA 4M2AA 3V91A 4EEGA 1FGGA 5E33A 3DAFA 2PGYA 5IDTA 1WGWA 3K33A 1H5TA 1QGQA 5CI9A 4J30B 1MC3A 2W4MA 3DXJF 2I7BA 5FTVA 2KNHA 2RJ9A 4G3QA 5DLJA 3N24A 3JRTA 4EEAA 3AG2C 4C3EA 3OH0A 4NALA 5D92A 1IINA 2ZU9A 3NDBB 2CW0F 1J8MF 3JCUQ 3SP1A 4EE4A 3RH3A 3I0JA 5E3CA 2YC3A 4HFFB 4HO5A 4B2XA 1VZUA 3SX7A 3EJNA 1HV9A 3V0MA 4C3DA 1H5SD 2G3VA 5CMHA 3OA1A 2XWLA 3SXEA 4FCUA 3N2ZB 1OQMB 1SF8A 2FYDB 2VSIA 2V0IA 1R7XA 2Y3GA 1VZXA 2WAWA 1NF5B 3O39A 1TWAA 3D8VA 5C1LA 2B0JA 1WT2A 2OI6A 4EE5A 3UGPA 2L9JA 4B5BA 2Q3TA 4FRDA 1FR8A 2OI5A 1OCRC 2WZGA 3U0XA 4YN0B 1HJJA 1ZI3A 1LZIA 3ASNC 2NG1A 3IOJA 4Y6UA 3RSBA 2J7PA 2Y3BA 3U2TA 5HSWA 4I1MA 3K1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6M A;  4O6N A;  4Q7C A;  5D92 A;  5D91 A;  4MND A; 
#chains in the Genus database with same CATH topology
 4YL1 A;  2RJ6 A;  3OKR A;  5F28 E;  4E0I A;  2FFH A;  3CEX A;  2X5Z A;  1GA8 A;  3U9M A;  3RQF A;  3EGX A;  3DI5 A;  4JIS A;  5L0D A;  3T6B A;  4ZLC A;  1ZJP A;  3ASO C;  1RCP A;  5KYU B;  1XHB A;  1XZ6 A;  4CIP A;  2QE9 A;  3PKP A;  2KK1 A;  3SXY A;  3AJM A;  5D91 A;  1FG5 N;  3N9W A;  1YP2 A;  2XM0 A;  1QSP A;  3B0U X;  4FRB A;  1EA8 A;  2Y4J A;  5B3S C;  2Y4K A;  1WOL A;  4YT4 A;  1G4U S;  3GEH A;  4HE8 D;  4MVR A;  2R7W A;  2AWC A;  3DKA A;  2QUP A;  3NYJ A;  2L7A A;  4R32 A;  2BC5 A;  2VXM A;  2LQG A;  2A6E F;  4DE7 A;  5DS5 A;  1LE4 A;  2CCY A;  4O7G A;  2VS4 A;  2J45 A;  3OAM A;  5IDS A;  4U5H A;  2J9W A;  5C4F A;  2PX3 A;  4JCZ A;  4D4X A;  2Q9A A;  4F4B A;  2RJ1 A;  4LER A;  1VTM P;  1HW1 A;  4HOC A;  2XWM A;  1XWJ A;  4MVO A;  2IM8 A;  4BG0 A;  5C4C A;  5C8R A;  5KYW A;  3C7J A;  1MNE A;  3SXC A;  1Q0F A;  2D7R A;  4OD5 A;  4DDZ A;  3JZ0 A;  4LDK A;  2YQC A;  1S05 A;  5DDT A;  4D4N A;  4M2B A;  3GM3 A;  2RJ5 A;  4AAW A;  4L41 C;  2OEX A;  1YAU O;  1ON6 A;  4RDA A;  2IXN A;  2YL1 A;  2LFF A;  1G23 A;  3A11 A;  1U89 A;  1KWS A;  4FWV A;  2WGZ A;  4EBB A;  1ZCU A;  1LS4 A;  1YVI A;  1YP4 A;  1WT0 A;  2XL8 A;  5CQP A;  2ICY A;  5FTS A;  3AGU A;  1LIH A;  3NYM A;  5E3A A;  3U2W A;  4MIX A;  3E9V A;  3RF3 A;  1HW2 A;  2PF4 E;  5BXC A;  5KYX A;  2A68 F;  4RD9 A;  3I0K A;  3USQ A;  2CGE A;  3QVY A;  5F5F A;  1NU7 D;  2WL8 A;  5KYY A;  4LDQ A;  1DOW A;  4G78 A;  4FCE A;  3SXD A;  4E0H A;  3ECS A;  3LAY A;  2XS8 A;  1FAP B;  4HO6 A;  1V55 C;  3C63 A;  3Q7L A;  3V5Z A;  2PA4 A;  3WOD F;  2DPW A;  2IYL D;  5C47 A;  2L6G A;  2CU2 A;  2AEC A;  5KYW B;  4IAO A;  3OH4 A;  2V0L A;  4MTO A;  3BEH A;  2G3K A;  1JPJ A;  1Y4C A;  2R7X A;  4XWI A;  1E83 A;  2OG2 A;  1LE2 A;  4IB4 A;  3TJ6 A;  2A1D D;  2NUT A;  4ZDQ A;  2P73 A;  1EI7 A;  2EPN A;  2D0J A;  1E86 A;  2KC3 A;  3ST8 A;  2J9B A;  2VC9 A;  1O3U A;  5C3D A;  3TD7 A;  5HS2 A;  2EIM C;  3JSZ A;  1H4C A;  1H7H A;  4Y7V A;  1ZHZ A;  3V8Z A;  4JKV A;  1Z23 A;  1T6U A;  1S7Z A;  2FYA A;  3W8I A;  1A41 A;  4M4K A;  1J8Y F;  2A69 F;  2I15 A;  3EQL F;  1LL3 A;  4AL1 A;  1FGX A;  1CGN A;  4KC1 A;  2R03 A;  1TZF A;  2O1H A;  1MMD A;  4OIQ F;  1I52 A;  2UUI A;  3EHM A;  5EIY A;  1XZP A;  2A8W A;  1D1A A;  1LL2 A;  1PZT A;  3K7D A;  5JUA A;  1E85 A;  1JRA A;  4U5D E;  5JLI A;  4G3S A;  1LL0 A;  3IEE A;  3AQC A;  3MYI A;  4K7B A;  4EHP A;  1Z7Q c;  2HSQ A;  1ZJ3 A;  2Y6P A;  3RVY A;  2EPL X;  3CKO A;  2ZU7 A;  3LJB A;  2VFZ A;  3HNL A;  1MMN A;  2NUP B;  5BQI A;  1R7Y A;  1TVY A;  4YL0 A;  1ORS C;  4CJC A;  1ZI1 A;  2J46 A;  2W0V A;  5I1F A;  1NMM B;  1G5Z A;  2JPU A;  3KKB A;  3SPT A;  1NU9 C;  2GWW A;  3SXA A;  1WVC A;  3US6 A;  5AJN A;  2A0B A;  2WZF A;  4KXO A;  4C7O B;  2V0J A;  2ICX A;  1WSZ A;  2RJ0 A;  1FMW A;  4EE3 A;  3M79 A;  3GWN A;  2JCL A;  2ZPA A;  4L6R A;  3DZA A;  5L0F A;  4AYL A;  2XXA A;  2E87 A;  1NSG B;  3CSK A;  2Q9C A;  3BCV A;  3PMR A;  5E2Q A;  2UX8 A;  1OCC C;  4ONS A;  2WEE A;  4CSA A;  4LDR A;  2BE5 F;  2DGJ A;  4UDV A;  3I5P A;  4B4G A;  4DEC A;  4J7Y A;  1INI A;  4BJ5 C;  4U9D A;  2IXM A;  1NWG B;  1HMO A;  2XRH A;  4XWJ A;  1PCX A;  2H7V C;  5CI8 A;  4OIN F;  4EUK B;  3CKJ A;  2LCH A;  3FVY A;  2XL4 A;  4XPX A;  1QVX A;  3ABL C;  1BBH A;  1E2X A;  2KGO A;  1JYL A;  4DRJ B;  1VPA A;  3KL4 A;  1TFK B;  4D0T A;  4FRQ A;  4G87 A;  3ZQY A;  1NQI B;  5IDT A;  3DAF A;  4Z9I A;  1WGW A;  3K33 A;  1H5T A;  1QGQ A;  2KNH A;  2RJ9 A;  2L6H A;  3AG2 C;  1Q0G A;  4NAL A;  3G4Z A;  5D92 A;  3NDB B;  3JCU Q;  3I0J A;  2HSB A;  1VZU A;  2ASR A;  1M6T A;  3FXH A;  1NF5 B;  1YYX A;  2HS5 A;  1FR8 A;  1CPR A;  2KSF A;  3U5S A;  3ASN C;  3H2V A;  3RSB A;  2J7P A;  2Y3B A;  4I1M A;  4IRQ A;  3C8G D;  4XEK A;  3X2Q C;  2RJ7 A;  4BJT A;  5DS4 A;  1Y6D A;  5T3W A;  2FFU A;  1G95 A;  1V84 A;  3W2W A;  3ATP A;  3ZQV A;  3FDQ A;  2LFD A;  3DM9 B;  5T1D B;  1Q0D A;  1NBB A;  1HM9 A;  2HJ3 A;  3UMK A;  4PJM A;  3AG4 C;  1YZC A;  5C4E A;  4KRV A;  3RQE A;  2YLI A;  3S28 A;  3V0P A;  2YQJ A;  5DQT A;  3I0D A;  3ZGF A;  3PDM P;  3QTH A;  3GAN A;  4IJJ A;  1M2V B;  1PV3 A;  4HO2 A;  3CKQ A;  2XLE A;  3MX3 A;  4HFK B;  2R7Q A;  1ZJ2 A;  4Y7G A;  2R7T A;  2PX0 A;  4KNV A;  4Y62 A;  2Q9B A;  2XLH A;  4O6M A;  2ZXR A;  5JS5 A;  1G8O A;  1ZI4 A;  1YA7 O;  3Q7G A;  1K05 A;  4EBK A;  5BUO A;  3CQZ A;  3U0C A;  1H5T B;  2FYC B;  1VZT A;  4N06 A;  4CJG A;  3POL A;  2R25 A;  2AU5 A;  5FUH A;  4CDY A;  2R7S A;  3U2V A;  5AGF A;  4MYB A;  2VCC A;  1VOM A;  1CPQ A;  3DM5 A;  4OD4 A;  4AE4 A;  3S29 A;  1R7U A;  5BQG A;  1FWY A;  3BRK X;  3NMI A;  2JCO A;  5CMF X;  3DWW A;  3K1I A;  2R02 A;  1NHE B;  4KNX A;  4G3P A;  4NC3 A;  4YK5 A;  4G7H F;  4WGZ A;  2YC5 A;  1M56 C;  3KH2 A;  1OQC A;  3B9Q A;  1YP3 A;  3I0G A;  4EVW A;  1ZYR F;  3K8D A;  3W8H A;  2TMV P;  5C1H A;  5CQN X;  4OIO F;  2V0K A;  3RW0 A;  2ZD9 A;  2LD6 A;  3KMI A;  1H7L A;  1TW5 A;  3F1Y A;  2IOQ A;  3QVZ A;  4FRP A;  1ZHT A;  5DVW A;  1FOA A;  2PX7 A;  5B1A C;  4GBP A;  4Y63 A;  1U0B B;  2B0H A;  2LP4 A;  2YEV A;  5EGY A;  2XLM A;  4LLE A;  4JVS A;  3K8E A;  2YQY A;  3EH1 A;  1EYR A;  2QLA A;  3ZTZ A;  3T6G B;  1GQA A;  1FO9 A;  3SX3 A;  1Z6A A;  1OR2 A;  5AC4 A;  3GM1 A;  1H7G A;  3DJN B;  4D48 A;  4UEG A;  2P0N A;  2EPM X;  3VF0 A;  3D5N A;  1H6G A;  2OOC A;  2GAQ A;  2AM3 A;  2O1F A;  2YKZ A;  2X51 A;  1H5S A;  3G50 A;  1D0Y A;  4FRE A;  4FAP B;  3V0N A;  5CQL X;  1GM5 A;  4QI2 A;  1LM3 B;  1NFO A;  3ZG1 A;  4AE4 B;  1M57 C;  1ZI5 A;  4ULW A;  1EZI A;  4GEH A;  1ZW2 A;  2ZU8 A;  3L1M A;  3B0V C;  5A6B D;  3HLZ A;  2EPK X;  4NAI A;  1S4O A;  3VRC A;  2XMH A;  3JSE O;  5L6S A;  1TQG A;  1JOG A;  1C02 A;  4N6H A;  4JW1 A;  1FTS A;  2Y4L A;  3IQT A;  3LLK A;  3O6X A;  3CKN A;  1C03 A;  4U5G A;  4CS8 C;  2J0A A;  2D7I A;  1JAF A;  2V0H A;  4P9F A;  3ZC4 A;  3DAG A;  2W9Y A;  4CDV A;  2R7O A;  3JTJ A;  4KPX A;  1LZJ A;  3WHN A;  1JV3 A;  2WVL A;  4CVH A;  1JYK A;  1T6I A;  2J8W A;  1H7T A;  3OGZ A;  1UG7 A;  4A2N B;  1ZHX A;  3LEV A;  2RJ4 A;  4JD0 A;  3TJ5 A;  3B29 A;  3K6B A;  3T9O A;  4B2W A;  3SEO A;  3ZF8 A;  3EGX B;  4JTA B;  4C2S A;  1D0X A;  3RIP A;  3UMI A;  4DOZ A;  1Z5Z A;  1GQ9 A;  2VD4 A;  3I5Q A;  4CDA A;  2EPO A;  1JV1 A;  1T6Q A;  1QKR A;  1NG1 A;  1E5K A;  2Q00 A;  1ST6 A;  4NQF A;  5JQQ A;  3FMS A;  3U8V A;  1H5S B;  2X60 A;  4D11 A;  2EIN C;  1NLX A;  1G3L A;  2ZXP A;  3CGX A;  4ASJ A;  3HNI A;  1UFB A;  1VYK A;  2AP3 A;  3EHN A;  5KYN A;  3GEI A;  1GX0 A;  5CQM X;  1KTM A;  4WAB A;  2XLO A;  4AYJ A;  5C38 A;  4HEA J;  2ZXO A;  3USR A;  2C04 A;  4JUR I;  5TJ5 E;  2PFD A;  2H8A A;  4FIX A;  2PP4 A;  1HM8 A;  4Q4Z F;  1R81 A;  3ZSU A;  2YQS A;  2P1A A;  4BJ6 A;  2JD3 A;  4R7P A;  4BEM J;  5AJO A;  3W2V A;  4ER9 A;  3E25 A;  1GQC A;  1W57 A;  2O9X A;  5L0I A;  3EFO A;  3KYI A;  3U3B A;  4DXW A;  2WB7 A;  3EG9 A;  1ZIZ A;  1RXQ A;  3EH2 A;  2J9V A;  1LKX A;  2BL2 A;  1VGW A;  1VH3 A;  2HFI A;  1YYJ A;  2GDC A;  4FQW A;  2V3C C;  1V54 C;  1LS1 A;  1KNY A;  1FRW A;  1W55 A;  4DJ9 A;  3H2U A;  2FAP B;  2OJE D;  3SXZ A;  4Y9X A;  4BQH A;  2XL6 A;  4EIY A;  4ANJ A;  3IOH A;  1JPN A;  5KYX B;  1FNT c;  1D1C A;  3K66 A;  1VYI A;  4WGY A;  1QWJ A;  1VLT A;  4H4K C;  1TW1 A;  5KYY B;  2EIJ C;  2YLG A;  3U2U A;  1PD1 A;  2AM5 A;  1FGG A;  3O10 A;  5CI9 A;  1I4Z A;  2XLD A;  1SYQ A;  2R05 A;  4G3Q A;  5DLJ A;  4C3E A;  2ZU9 A;  256B A;  2CW0 F;  2YC3 A;  4B2X A;  3EJN A;  3V0M A;  4C3D A;  4CX9 A;  3OA1 A;  1OQM B;  1SF8 A;  1AVO B;  2Y3G A;  2DB4 A;  2WAW A;  2B0J A;  1WT2 A;  3UGP A;  1E84 A;  1OCR C;  1HJJ A;  4K1O A;  1LZI A;  3IOJ A;  4Y6U A;  3V5X A;  4IAQ A;  1APC A;  4LAC B;  1H9T A;  4MS2 A;  2VS3 A;  5CMI A;  5L3V A;  3SX8 A;  2NUT B;  5FV9 A;  3Q6M A;  3EG9 B;  2HJM A;  5DDV A;  3QW1 A;  3ABK C;  4ASY A;  2JCK A;  2XSE A;  1ZJO A;  4CJO A;  3PHF 2;  3T6J A;  4JTD B;  3SXK A;  5F5H A;  1OXB A;  2AGD A;  2IXP A;  4AX2 A;  4XEF A;  4M63 A;  3OC9 A;  3I0C A;  4MTG A;  1SZI A;  2MHR A;  2LK4 A;  1WT1 A;  5CMJ A;  5IFY A;  2A0U A;  4P9T A;  4PAC A;  3CKV A;  1R7T A;  2WE9 A;  3LLI A;  4ECM A;  4OIR F;  4KC4 A;  3KIA A;  3ITF A;  2FYB A;  4Q7C A;  3C8G A;  2Z87 A;  3RQG A;  4AC3 A;  4IWB A;  3LUT B;  3U2M A;  3FOP A;  2OEG A;  4C3B A;  4Y7F A;  1QPU A;  2AVK A;  1IW7 F;  2YVK A;  1VH1 A;  3ZLK A;  1QG8 A;  1OR3 A;  3L8J A;  1WAS A;  5GPG B;  2YL7 A;  2QNL A;  1R7V A;  4XLP F;  4CS7 A;  4GQH A;  1LZ7 A;  3R2W A;  3V0O A;  3IQC A;  3Q6N A;  4JZA A;  4O79 A;  1QZX A;  1T5O A;  5L0C A;  4FRA A;  4DRH B;  1NZE A;  1H5R A;  1R4T A;  1O5H A;  3Q4S A;  1LZ0 A;  1QQ3 A;  5L6V A;  3EE5 A;  2WVO A;  5C48 A;  1V74 B;  4YL3 A;  5B1B C;  1RKC A;  4EBJ A;  4GYT A;  2P72 A;  1GS9 A;  4CS9 C;  3VM6 A;  1FR0 A;  3OH2 A;  2CNW D;  3FAP B;  4J32 B;  1V4A A;  2RIY A;  3M15 A;  2R9R B;  2R7U A;  3T7N A;  1A7D A;  1WTY A;  1BR2 A;  3Q7U A;  1RKE A;  3VAY A;  1OKK A;  4YT5 A;  4XTK A;  3QVB A;  1DOV A;  3ZWI A;  2AE7 A;  3EGD A;  2HKV A;  4NTB A;  1ZJ1 A;  2XXA B;  2YLD A;  2VCB A;  1MP3 A;  4JIO A;  2BO4 A;  2O1G A;  2PGV A;  1HM0 A;  3HJC A;  4JC7 A;  1D1B A;  4LLC A;  3WG7 C;  2EIL C;  5JRA A;  5C4D A;  1FFT C;  2UUH A;  2QY9 A;  3SZR A;  3AG1 C;  2OCC C;  1H3M A;  1Q0K A;  2NSG A;  1Z90 A;  5C1G A;  3S90 A;  5FU0 A;  1JR8 A;  1D0Z A;  4E1K A;  4J18 A;  3CZ6 A;  4FX5 A;  4IRU A;  4H54 A;  1FZW A;  4DVZ A;  4CSA C;  1ON8 A;  5JSL A;  2DYR C;  4MVQ A;  2H7O A;  4KT7 A;  1HE9 A;  4QDL A;  4B42 A;  4DVY P;  4YJW A;  3T4R A;  4EWC A;  1ZDF A;  4P6I C;  1H5R B;  1S4P A;  5CMG X;  3S9O A;  2BO8 A;  4DRI B;  3HL3 A;  4Z9H A;  1HY5 A;  2L81 A;  4XPY A;  3KPH A;  3V0Q A;  3SXB A;  5K0I A;  2X65 A;  4RBN A;  2MZB A;  1LVW A;  2HV6 A;  2AES A;  4FRH A;  1VGZ A;  1I5N A;  1H7I A;  2PBE A;  1FMV A;  3OWT A;  2HMZ A;  5C3A A;  4EKW A;  3JRM O;  1RJ9 A;  1SMY F;  3IPM O;  4JEA A;  2R7V A;  1TWH A;  2Q4F A;  1OMX A;  2NSF A;  3B0P A;  5COG A;  1RKE B;  4FRL A;  2RIZ A;  3EGD B;  3NG1 A;  1Q0M A;  3LS1 A;  3NYL A;  4PJL A;  3HNJ A;  1N1C A;  2Y3H A;  2XS1 A;  1VMA A;  3KYJ A;  1YAR O;  4FRM A;  3LES A;  5IY5 C;  3V5Y A;  3FOO A;  4Y7T A;  5COF A;  4KBL A;  1OW6 A;  1JVD A;  4Y64 A;  1Z63 A;  2Y3D A;  1LI7 A;  1I4Y A;  4U5E E;  2Y69 C;  3RVZ A;  3LNR A;  4EEM A;  3RKO F;  5T3T A;  1JVG A;  4X0R A;  3SYN A;  3T7M A;  2GGQ A;  4CJ8 A;  5L0H A;  3PKQ A;  1CGM E;  2OJQ A;  1RMV A;  2G62 A;  3PCV A;  1O23 B;  3AGT A;  4ULV A;  3HNK A;  4U5F E;  1H7Q A;  1PZY B;  2FFV A;  1MMA A;  3CAX A;  3GOR A;  2WVK A;  2DYS C;  1S4N A;  4PK4 A;  1WT3 A;  3N0T A;  4I1O B;  3JUJ A;  3QW0 A;  4JRZ A;  4AK9 A;  2AH9 A;  4HO9 A;  1OCO C;  3RMW A;  1GWV A;  1G0R A;  4LW3 A;  2DI3 A;  1FFH A;  3RYL A;  5EJZ A;  4PJJ A;  1RJ9 B;  4YS8 A;  1WAT A;  3EPV A;  5COM A;  3ZIB A;  2RJ8 A;  4NAN A;  1A7V A;  3U9J A;  4MW8 A;  3FHD A;  2H7B A;  1TWC A;  4O6Y A;  2J0X A;  1FR9 A;  3B71 A;  4O6N A;  1ZCV A;  4ZLD A;  1FXJ A;  4JE9 A;  5FCL A;  4I3M A;  1TR2 A;  5J49 A;  2R7R A;  1GGQ A;  3V7O A;  2OEV A;  4W8P A;  4G0H A;  1G93 A;  4XEV A;  1ZHJ A;  3C18 A;  3O3P A;  4MTF A;  3M1C B;  3K1I C;  1EQ1 A;  2KYH A;  1BR4 A;  1V83 A;  2VS5 A;  2GFH A;  3V0L A;  4OIP F;  3WAQ A;  5CIV A;  1C17 M;  3DE9 A;  4KC2 A;  2P61 A;  2NXV A;  1OXK A;  3UR3 C;  1LI5 A;  2IBF A;  3I0F A;  2YL0 A;  4Y6N A;  4PFO A;  1FO8 A;  2YRF A;  3DE8 A;  4Y7U A;  5B3I A;  3T7O A;  3Q80 A;  3S0X A;  2JX0 A;  1H9G A;  1L7C A;  4EEG A;  1YDI A;  2W4M A;  3DXJ F;  5FTV A;  3N24 A;  5EK0 A;  1IIN A;  3GEE A;  4EE4 A;  1J8M F;  3SP1 A;  2L6F A;  1K04 A;  1HV9 A;  1ORY A;  1H5S D;  2G3V A;  5CMH A;  2XWL A;  1XZQ A;  2FYD B;  2V0I A;  1WN0 A;  1R7X A;  1VZX A;  3O39 A;  5AC5 A;  4J7T A;  2M64 A;  4EE5 A;  4B5B A;  4FRD A;  1ZI3 A;  1F1M A;  1AUE A;  2V26 A;  1H5S C;  1YA9 A;  4E7S A;  3JTL O;  1G97 A;  5C3B A;  2KQ9 A;  1ZDG A;  3FAJ A;  3NGW A;  3SNH A;  3UGO A;  3MBG A;  4E7Z A;  2ZXW C;  4KI2 A;  1GX4 A;  3SX5 A;  3SXG A;  3SXM A;  4HO8 A;  5L0G A;  2XME A;  5C4B A;  2J0W A;  4FRO A;  4MVS A;  1YJG A;  3I0I X;  3LW6 A;  5C36 A;  4EEO A;  2OU6 A;  3TUL A;  5DS6 A;  2I8B A;  2LIG A;  1R82 A;  3V90 A;  3VYW A;  2VAS A;  3GUE A;  3TOM A;  3U2L A;  4HG6 A;  2NUP A;  2AM4 A;  1VK5 A;  4LW6 A;  3PNN A;  5L3Q A;  2EIK C;  3GOD A;  3IQ6 A;  1YZA A;  2ETS A;  4N4W A;  1MND A;  4HO3 A;  4KNW A;  1BZ4 A;  2OI7 A;  1K4V A;  2C03 A;  4Q5S F;  3CU0 A;  5A6K A;  1BR1 A;  1EKY A;  1HMD A;  4CJB A;  3AQB A;  4C7O A;  3I0H A;  4YWQ A;  2QKX A;  3O55 A;  3UNG C;  4JJG A;  3IQ5 A;  1G9R A;  1LPE A;  1VIC A;  4KNR A;  4CIH A;  2LSE A;  2HMQ A;  4B6I A;  1G2V A;  1ZCY A;  4NTA A;  3FWW A;  3NMJ A;  1ZJ0 A;  4XQ1 A;  2YQH A;  4E18 A;  4BJ5 A;  4AL0 A;  3MLG A;  5FU8 A;  2RIX A;  2FGY A;  1H4D A;  1VB5 A;  1TFO B;  1H4E A;  1MMG A;  3GM2 A;  1M2O A;  1V82 A;  4HO0 A;  4D11 C;  1FXO A;  1WWP A;  2D5R B;  4MVZ A;  4W8K A;  1TKN A;  3D98 A;  5JP7 A;  2KW3 C;  2I5K A;  1VLS A;  3QZC A;  2A6H F;  2OKU A;  2XLW A;  4NCQ A;  1LVK A;  3FOQ A;  3DK5 A;  4ARW A;  2Z15 A;  2YHS A;  4KPZ A;  1H7E A;  4CS9 A;  3TQD A;  5FZT A;  3JYY A;  3EFO B;  3ZTM A;  4E17 A;  3MFN A;  3UMH A;  2E8B A;  3V8Y A;  3F46 A;  1HJL A;  2WZL A;  2APC A;  1PD0 A;  4JCH A;  1QGS A;  4PFP A;  1A0B A;  3JT1 A;  2J0B A;  3DJ4 A;  1ZU5 A;  3L0I A;  1T01 A;  3LEO A;  3M4C A;  4BJ6 C;  5JVE A;  1MQV A;  5L0J A;  1MP4 A;  2VXL A;  2Y7A A;  3JUK A;  2CNW A;  2OQM A;  2AWY A;  3EZH A;  4B4M A;  1G4W R;  2GA0 A;  2C0N A;  1NFN A;  2M4E A;  4JTC B;  2YES A;  1GWW A;  2Y4M A;  4JJF A;  2KJG A;  4FES A;  1VGT A;  4FIY A;  3S27 A;  3NKE A;  2IXO A;  4WJ0 A;  5A6A A;  1G1L A;  5EHH A;  4IRP A;  2F22 A;  2RIT A;  1ZZP A;  2X0C A;  4K6R A;  4PJN A;  2YWA A;  4D0Z A;  2VSH A;  1OMZ A;  4K0D A;  4BEJ A;  2MWQ A;  1ORJ A;  2FY7 A;  1HE1 A;  3DJU B;  3M4B A;  3I4U A;  1O87 A;  5CQO A;  2BO7 A;  3I0L A;  1NKH B;  3TZT A;  4MND A;  2VH3 A;  5EJ1 A;  2BO6 A;  5BQH A;  2XLV A;  2A8U A;  4NTF A;  4HCQ A;  5AJP A;  2P7V A;  1VGU A;  3DUV A;  2WVM A;  4I44 A;  3E70 C;  4YT8 A;  3OH1 A;  4MVU A;  2I5E A;  1IIM A;  5C49 A;  3TK0 A;  3E26 A;  3U0Y A;  3LS0 A;  2RSE B;  1ZU4 A;  3NMK A;  1M2V A;  4XLN F;  1MP5 A;  1L3P A;  1K40 A;  3NKD A;  1OW8 A;  3MYF A;  5JT4 A;  3EZI A;  3J06 A;  3IOI A;  2WVN A;  3U2X A;  1YLM A;  2CDQ A;  4U5C E;  4BJ1 A;  2Q4J A;  2QTV A;  1A7E A;  4A4A A;  3ZLL A;  2GGO A;  1U6H A;  1B68 A;  5FYE A;  3ZGG A;  2MYS A;  4YT2 A;  2YL3 A;  4U9E A;  3I0E A;  4B3U A;  4MQ9 F;  3ABM C;  3HTK C;  2E3D A;  4P02 A;  1ZHY A;  4HO4 A;  4CBE A;  2VB6 A;  2J9U A;  1O0R A;  1IZM A;  2P6W A;  3JYH A;  4U5B E;  2VCA A;  4G7O F;  4MVM A;  1Z3I X;  3C8G B;  2JCJ A;  1W2W A;  2QGI A;  2X5S A;  3R2P A;  1O7Q A;  3QMK A;  2Z86 A;  2HV7 A;  2Q7R A;  1SS9 A;  1INJ A;  3POV A;  3ZVR A;  2VK9 A;  4JEB A;  1YRO B;  1ZVZ A;  4DBQ A;  4IAR A;  2QH5 A;  5DQZ A;  4G7Z F;  2P6V A;  1SR2 A;  3F47 A;  4BMA A;  4KC9 A;  1QLE C;  1W77 A;  3OH3 A;  4P00 A;  4KQL A;  2NPU A;  5A6J A;  3NRH A;  3RFY A;  1TWG A;  2HZ8 A;  1CGO A;  1KU2 A;  4Z9J A;  3AOU A;  1ZW3 A;  3TOL A;  1OCZ C;  2W45 A;  3X1O A;  3DMD A;  2YZS A;  3BRJ A;  4NAK A;  4B4B A;  1R80 A;  2HUJ A;  1O7O A;  1H7F A;  2W0W A;  2YCM A;  3LNM B;  3HKK A;  1OW7 A;  2W4B A;  3A9C A;  2PNO A;  1R5I D;  3F1C A;  5HV9 A;  3R7C A;  1ZHW A;  2ICW G;  3AG3 C;  1VM8 A;  4XPW A;  5KYU A;  3W4Y A;  1AEP A;  1ZCT A;  4PR9 A;  1G8X A;  4N6C A;  4NY3 A;  2XWN A;  3RMV A;  3H65 A;  2WVQ A;  4M28 A;  1OKK D;  2Y39 A;  3U3F A;  1T9K A;  3IHU A;  4QI0 A;  4CS8 A;  2OEF A;  5A6B A;  4DBR A;  3C8Z A;  2J7P D;  3C62 A;  3DD7 A;  3L34 A;  2CYD A;  3OEO A;  2XM4 A;  4BPM A;  3R3I A;  2D4U A;  4M2A A;  3V91 A;  3TQO A;  5E33 A;  2PGY A;  3ZDL A;  3L8I A;  4J30 B;  1MC3 A;  2I7B A;  4MW3 A;  4IGG A;  5A69 A;  3JRT A;  4EEA A;  3OH0 A;  3GWL A;  3RH3 A;  5E3C A;  4HFF B;  3G4X A;  4HO5 A;  3SX7 A;  3S84 A;  3SXE A;  1BDJ B;  4FCU A;  3N2Z B;  2VSI A;  1JMW A;  3D8V A;  1TWA A;  5C1L A;  2OI6 A;  2L9J A;  2Q3T A;  2OI5 A;  3U0X A;  2WZG A;  4YN0 B;  2RD9 A;  2NG1 A;  3U2T A;  5HSW A;  3U8P A;  3K1H A; 
#chains in the Genus database with same CATH homology
 2V26 A;  4IRQ A;  2RJ6 A;  1H5S C;  3OKR A;  4E7S A;  2VS3 A;  5CMI A;  3X2Q C;  2FFH A;  5L3V A;  2RJ7 A;  1G97 A;  4BJT A;  2NUT B;  3SX8 A;  2X5Z A;  5FV9 A;  3Q6M A;  5DS4 A;  3EG9 B;  1GA8 A;  5C3B A;  5T3W A;  2FFU A;  2KQ9 A;  1ZDG A;  3FAJ A;  5DDV A;  1G95 A;  3ABK C;  1V84 A;  3W2W A;  2JCK A;  4ASY A;  2XSE A;  3EGX A;  1ZJO A;  3NGW A;  3SNH A;  3FDQ A;  4JIS A;  3DM9 B;  3PHF 2;  3T6B A;  3UGO A;  5T1D B;  3T6J A;  4ZLC A;  4E7Z A;  2ZXW C;  4KI2 A;  1GX4 A;  3SX5 A;  1HM9 A;  1ZJP A;  3SXG A;  3ASO C;  3UMK A;  4PJM A;  5F5H A;  2AGD A;  4HO8 A;  2IXP A;  3AG4 C;  4AX2 A;  5KYU B;  2XME A;  4M63 A;  3OC9 A;  2J0W A;  5C4B A;  5C4E A;  4FRO A;  1XHB A;  1XZ6 A;  4KRV A;  3PKP A;  3I0I X;  3LW6 A;  5C36 A;  3S28 A;  4EEO A;  3V0P A;  2YQJ A;  3I0C A;  5D91 A;  5DQT A;  1FG5 N;  3I0D A;  3ZGF A;  5DS6 A;  3N9W A;  3GAN A;  1SZI A;  2I8B A;  4IJJ A;  1R82 A;  1M2V B;  1WT1 A;  3B0U X;  1YP2 A;  5CMJ A;  4HO2 A;  5IFY A;  3CKQ A;  4FRB A;  2Y4J A;  5B3S C;  3MX3 A;  1R7T A;  2Y4K A;  3CKV A;  2WE9 A;  3V90 A;  3LLI A;  2VAS A;  4HFK B;  2R7Q A;  3VYW A;  4YT4 A;  1ZJ2 A;  4ECM A;  4HE8 D;  2R7W A;  3GUE A;  4OIR F;  4HG6 A;  4KC4 A;  4Y7G A;  2NUP A;  2AM4 A;  3KIA A;  2R7T A;  3ITF A;  1VK5 A;  2PX0 A;  4LW6 A;  3PNN A;  3NYJ A;  2FYB A;  4Q7C A;  2EIK C;  3GOD A;  4KNV A;  5L3Q A;  4Y62 A;  2Q9B A;  2Z87 A;  4O6M A;  4IWB A;  2ZXR A;  4AC3 A;  1G8O A;  1ZI4 A;  4HO3 A;  1MND A;  3Q7G A;  4KNW A;  5BUO A;  2OEG A;  3CQZ A;  4C3B A;  1H5T B;  2FYC B;  2VXM A;  4Y7F A;  2A6E F;  4DE7 A;  5DS5 A;  1VZT A;  2OI7 A;  4O7G A;  1K4V A;  2C03 A;  1IW7 F;  4Q5S F;  2VS4 A;  2J45 A;  1VH1 A;  3CU0 A;  4N06 A;  1BR1 A;  3OAM A;  4CJB A;  3ZLK A;  1QG8 A;  3AQB A;  4C7O A;  3POL A;  5IDS A;  4U5H A;  2J9W A;  5FUH A;  3I0H A;  5C4F A;  2PX3 A;  2R7S A;  2RJ1 A;  2Q9A A;  4F4B A;  4YWQ A;  3U2V A;  2QKX A;  4LER A;  4MYB A;  3UNG C;  4HOC A;  1R7V A;  4XLP F;  2XWM A;  4JJG A;  4CS7 A;  1LZ7 A;  1VOM A;  1G9R A;  4BG0 A;  5C4C A;  3DM5 A;  1VIC A;  3R2W A;  3V0O A;  4OD4 A;  5KYW A;  5C8R A;  4AE4 A;  3Q6N A;  4CIH A;  4KNR A;  2LSE A;  3S29 A;  1R7U A;  1MNE A;  4JZA A;  4O79 A;  1QZX A;  4B6I A;  3SXC A;  1G2V A;  1ZCY A;  4FRA A;  1FWY A;  2D7R A;  3FWW A;  1ZJ0 A;  1NZE A;  4OD5 A;  1H5R A;  2YQH A;  3BRK X;  4DDZ A;  4BJ5 A;  1O5H A;  3Q4S A;  1LZ0 A;  2JCO A;  5CMF X;  5L6V A;  3EE5 A;  2YQC A;  3MLG A;  5FU8 A;  2RIX A;  2WVO A;  1NHE B;  4KNX A;  5C48 A;  5DDT A;  2FGY A;  5B1B C;  4G3P A;  4M2B A;  4G7H F;  2RJ5 A;  4AAW A;  2YC5 A;  1H4D A;  4GYT A;  1M56 C;  3KH2 A;  1H4E A;  3B9Q A;  1YP3 A;  3I0G A;  4L41 C;  1MMG A;  2P72 A;  4EVW A;  1ZYR F;  1ON6 A;  4RDA A;  1M2O A;  3K8D A;  1V82 A;  4CS9 C;  4HO0 A;  3W8H A;  4D11 C;  2IXN A;  1FXO A;  2D5R B;  3OH2 A;  4W8K A;  5C1H A;  5CQN X;  2CNW D;  1TKN A;  4OIO F;  1G23 A;  1KWS A;  2V0K A;  4FWV A;  2WGZ A;  4EBB A;  1ZCU A;  4J32 B;  2RIY A;  3D98 A;  1YP4 A;  2KW3 C;  3KMI A;  1H7L A;  1TW5 A;  1WT0 A;  3F1Y A;  2I5K A;  2IOQ A;  2R7U A;  5CQP A;  3T7N A;  3QZC A;  2ICY A;  5FTS A;  2A6H F;  1BR2 A;  3Q7U A;  4FRP A;  1ZHT A;  1OKK A;  5DVW A;  3VAY A;  1FOA A;  2PX7 A;  4YT5 A;  1LVK A;  4XTK A;  3NYM A;  5E3A A;  2AE7 A;  3DK5 A;  3FOQ A;  3QVB A;  3U2W A;  4ARW A;  2Z15 A;  3EGD A;  4MIX A;  2YHS A;  3E9V A;  5B1A C;  1H7E A;  4GBP A;  4KPZ A;  4Y63 A;  1ZJ1 A;  2XXA B;  4CS9 A;  3TQD A;  1MP3 A;  2YEV A;  2PF4 E;  5EGY A;  5KYX A;  5BXC A;  4LLE A;  4JVS A;  3K8E A;  2A68 F;  2BO4 A;  2O1G A;  2PGV A;  4RD9 A;  3EH1 A;  1EYR A;  1HM0 A;  3I0K A;  3HJC A;  3USQ A;  2CGE A;  3EFO B;  5F5F A;  1FO9 A;  4LLC A;  1D1B A;  1NU7 D;  2WL8 A;  3WG7 C;  1Z6A A;  2EIL C;  5KYY A;  3SX3 A;  3UMH A;  2E8B A;  5C4D A;  3V8Y A;  1FFT C;  3SZR A;  2QY9 A;  3AG1 C;  2OCC C;  3F46 A;  1HJL A;  1H7G A;  2WZL A;  2APC A;  1H3M A;  1PD0 A;  3DJN B;  4JCH A;  1Z90 A;  5C1G A;  1QGS A;  4PFP A;  3DJ4 A;  3JT1 A;  2J0B A;  4D48 A;  4FCE A;  1ZU5 A;  4UEG A;  3L0I A;  4BJ6 C;  2Y7A A;  5FU0 A;  3SXD A;  3JUK A;  1MP4 A;  1D0Z A;  2VXL A;  4E1K A;  2CNW A;  3D5N A;  3ECS A;  3LAY A;  4J18 A;  3EZH A;  3CZ6 A;  4B4M A;  4FX5 A;  2C0N A;  2AM3 A;  2O1F A;  2M4E A;  1V55 C;  3Q7L A;  4IRU A;  4HO6 A;  2PA4 A;  2X51 A;  1H5S A;  2YES A;  1FZW A;  3WOD F;  2DPW A;  1GWW A;  1D0Y A;  4DVZ A;  2Y4M A;  4JJF A;  4CSA C;  2KJG A;  1ON8 A;  4FES A;  4FRE A;  2IYL D;  2DYR C;  5C47 A;  1VGT A;  4FIY A;  3S27 A;  2H7O A;  2CU2 A;  3V0N A;  5CQL X;  3NKE A;  2IXO A;  4WJ0 A;  4QI2 A;  1G1L A;  5EHH A;  3ZG1 A;  5KYW B;  2AEC A;  4IRP A;  4AE4 B;  4KT7 A;  1M57 C;  1ZI5 A;  4QDL A;  4IAO A;  4ULW A;  2RIT A;  3OH4 A;  4B42 A;  4DVY P;  4YJW A;  3T4R A;  4EWC A;  1ZDF A;  2V0L A;  1EZI A;  4P6I C;  4PJN A;  4K6R A;  4GEH A;  1H5R B;  2G3K A;  1S4P A;  2ZU8 A;  4LAC B;  1JPJ A;  5CMG X;  3B0V C;  4D0Z A;  2VSH A;  1OMZ A;  2BO8 A;  3HL3 A;  4K0D A;  3HLZ A;  4BEJ A;  2L81 A;  2R7X A;  2MWQ A;  4XWI A;  2FY7 A;  2OG2 A;  3DJU B;  4NAI A;  3I4U A;  1S4O A;  3V0Q A;  1O87 A;  3SXB A;  2XMH A;  5CQO A;  2A1D D;  2BO7 A;  3I0L A;  5L6S A;  1NKH B;  2NUT A;  3TZT A;  4MND A;  2X65 A;  2VH3 A;  1FTS A;  4JW1 A;  2P73 A;  2Y4L A;  4RBN A;  4ZDQ A;  5EJ1 A;  2BO6 A;  3LLK A;  3O6X A;  2MZB A;  3CKN A;  2D0J A;  1LVW A;  2HV6 A;  2A8U A;  2AES A;  4U5G A;  1VGZ A;  4FRH A;  4CS8 C;  3ST8 A;  1FMV A;  3OWT A;  5C3D A;  4HCQ A;  5C3A A;  2J0A A;  3TD7 A;  2D7I A;  5AJP A;  2P7V A;  1VGU A;  3DUV A;  2V0H A;  5HS2 A;  2WVM A;  3ZC4 A;  2EIM C;  3JSZ A;  1H4C A;  3DAG A;  1RJ9 A;  1SMY F;  3E70 C;  4I44 A;  4YT8 A;  3OH1 A;  2R7V A;  1TWH A;  2W9Y A;  1H7H A;  4Y7V A;  1ZHZ A;  2I5E A;  1OMX A;  2R7O A;  1IIM A;  3V8Z A;  3B0P A;  3JTJ A;  1Z23 A;  4KPX A;  1LZJ A;  4FRL A;  5C49 A;  1S7Z A;  2FYA A;  3W8I A;  3E26 A;  3U0Y A;  3LS0 A;  4M4K A;  2RIZ A;  1JV3 A;  1J8Y F;  2A69 F;  1JYK A;  2WVL A;  4CVH A;  3EQL F;  3EGD B;  1ZU4 A;  3NG1 A;  1H7T A;  1LL3 A;  3OGZ A;  1M2V A;  1FGX A;  4XLN F;  3LS1 A;  1MP5 A;  4KC1 A;  3NYL A;  3NKD A;  4PJL A;  1ZHX A;  4A2N B;  3LEV A;  1TZF A;  1N1C A;  2RJ4 A;  2Y3H A;  4JD0 A;  2O1H A;  1VMA A;  1MMD A;  3K6B A;  3EZI A;  4OIQ F;  3EHM A;  1I52 A;  4B2W A;  5EIY A;  3IOI A;  4FRM A;  2WVN A;  3LES A;  5IY5 C;  2A8W A;  4Y7T A;  1D1A A;  3U2X A;  3SEO A;  1LL2 A;  1PZT A;  3ZF8 A;  3EGX B;  2CDQ A;  4KBL A;  4U5C E;  4C2S A;  3K7D A;  1D0X A;  3RIP A;  3UMI A;  4BJ1 A;  2Q4J A;  2QTV A;  1JVD A;  4Y64 A;  4U5D E;  4DOZ A;  1Z5Z A;  1Z63 A;  2Y3D A;  1GQ9 A;  2VD4 A;  3ZLL A;  3I5Q A;  2GGO A;  4G3S A;  1LL0 A;  1JV1 A;  4U5E E;  3IEE A;  2Y69 C;  3LNR A;  4EEM A;  3RKO F;  5T3T A;  1JVG A;  1NG1 A;  3AQC A;  4X0R A;  1E5K A;  4K7B A;  1ST6 A;  3SYN A;  3T7M A;  5FYE A;  2GGQ A;  4CJ8 A;  1ZJ3 A;  5JQQ A;  2Y6P A;  3PKQ A;  1H5S B;  2X60 A;  3ZGG A;  4D11 A;  2EIN C;  2MYS A;  2G62 A;  4YT2 A;  1G3L A;  1O23 B;  3I0E A;  4B3U A;  3CKO A;  4MQ9 F;  2ZU7 A;  3ABM C;  3HTK C;  2E3D A;  2ZXP A;  4P02 A;  1ZHY A;  3LJB A;  4HO4 A;  4U5F E;  2VFZ A;  4CBE A;  3CGX A;  2VB6 A;  2J9U A;  1O0R A;  1H7Q A;  1IZM A;  2P6W A;  4ASJ A;  1MMN A;  3JYH A;  2NUP B;  1VYK A;  3EHN A;  4U5B E;  5KYN A;  1PZY B;  2FFV A;  1R7Y A;  1TVY A;  4G7O F;  1MMA A;  1GX0 A;  2WVK A;  1Z3I X;  2DYS C;  1S4N A;  4PK4 A;  1WT3 A;  2JCJ A;  3N0T A;  4I1O B;  3JUJ A;  1W2W A;  5CQM X;  2QGI A;  2X5S A;  4CJC A;  4AK9 A;  1ZI1 A;  1O7Q A;  2AH9 A;  2J46 A;  3QMK A;  2Z86 A;  2W0V A;  5I1F A;  1NMM B;  4AYJ A;  5C38 A;  4HEA J;  2HV7 A;  2ZXO A;  1SS9 A;  3KKB A;  1INJ A;  4HO9 A;  1NU9 C;  3SPT A;  3USR A;  3POV A;  3ZVR A;  2C04 A;  2VK9 A;  1WVC A;  3SXA A;  5AJN A;  4JUR I;  1YRO B;  2WZF A;  1OCO C;  4KXO A;  2PFD A;  4DBQ A;  4C7O B;  4FIX A;  2V0J A;  2QH5 A;  2PP4 A;  5DQZ A;  4G7Z F;  2ICX A;  2P6V A;  4BMA A;  3F47 A;  1HM8 A;  3RMW A;  4KC9 A;  1GWV A;  1G0R A;  1WSZ A;  2RJ0 A;  4LW3 A;  1QLE C;  1W77 A;  3OH3 A;  1FMW A;  4P00 A;  4Q4Z F;  1R81 A;  4KQL A;  1FFH A;  3RYL A;  5EJZ A;  4EE3 A;  4PJJ A;  1RJ9 B;  4YS8 A;  3NRH A;  2JCL A;  3RFY A;  3ZSU A;  2ZPA A;  3DZA A;  1TWG A;  3EPV A;  2YQS A;  4BJ6 A;  2JD3 A;  1KU2 A;  3ZIB A;  4M28 A;  4AYL A;  4R7P A;  5AJO A;  2XXA A;  2RJ8 A;  3W2V A;  2E87 A;  4NAN A;  3CSK A;  3E25 A;  1GQC A;  1W57 A;  1OCZ C;  2Q9C A;  3BCV A;  2W45 A;  3PMR A;  5E2Q A;  3X1O A;  3DMD A;  3FHD A;  2O9X A;  2H7B A;  1OCC C;  2YZS A;  2UX8 A;  4NAK A;  4B4B A;  1TWC A;  2WEE A;  4O6Y A;  4CSA A;  1R80 A;  3EFO A;  1O7O A;  2J0X A;  2BE5 F;  1FR9 A;  2WB7 A;  4O6N A;  1H7F A;  3EG9 A;  1ZCV A;  1ZIZ A;  3EH2 A;  4ZLD A;  1FXJ A;  2DGJ A;  2W0W A;  2YCM A;  3I5P A;  2J9V A;  5FCL A;  4I3M A;  1TR2 A;  1LKX A;  5J49 A;  4B4G A;  1VGW A;  2R7R A;  1VH3 A;  3V7O A;  2W4B A;  3F1C A;  4G0H A;  1G93 A;  4DEC A;  4FQW A;  2V3C C;  1INI A;  4BJ5 C;  1V54 C;  1LS1 A;  1ZHW A;  1ZHJ A;  3O3P A;  3M1C B;  3AG3 C;  3K1I C;  1VM8 A;  1FRW A;  5KYU A;  2IXM A;  1NWG B;  1W55 A;  1BR4 A;  1V83 A;  2VS5 A;  2GFH A;  1ZCT A;  1G8X A;  3V0L A;  4Y9X A;  4OIP F;  4BQH A;  4NY3 A;  2XWN A;  2XRH A;  3RMV A;  3H65 A;  4XWJ A;  2WVQ A;  4ANJ A;  1OKK D;  1PCX A;  4KC2 A;  3IOH A;  2Y39 A;  2H7V C;  5CI8 A;  4OIN F;  2NXV A;  3UR3 C;  1JPN A;  5KYX B;  1D1C A;  3CKJ A;  3FVY A;  4QI0 A;  4CS8 A;  3I0F A;  2OEF A;  3K66 A;  4Y6N A;  2XL4 A;  4PFO A;  1FO8 A;  1VYI A;  4DBR A;  3ABL C;  1QWJ A;  2J7P D;  4H4K C;  1TW1 A;  5KYY B;  2KGO A;  3DD7 A;  2EIJ C;  3L34 A;  3OEO A;  1JYL A;  1VPA A;  3KL4 A;  4Y7U A;  3U2U A;  1PD1 A;  4D0T A;  4FRQ A;  4G87 A;  3T7O A;  2AM5 A;  3R3I A;  3Q80 A;  1NQI B;  3S0X A;  4M2A A;  3V91 A;  4EEG A;  1FGG A;  5E33 A;  3DAF A;  2PGY A;  5IDT A;  1WGW A;  3K33 A;  1H5T A;  1QGQ A;  5CI9 A;  4J30 B;  1MC3 A;  2W4M A;  3DXJ F;  2I7B A;  5FTV A;  2KNH A;  2RJ9 A;  4G3Q A;  5DLJ A;  3N24 A;  3JRT A;  4EEA A;  3AG2 C;  4C3E A;  3OH0 A;  4NAL A;  5D92 A;  1IIN A;  2ZU9 A;  3NDB B;  2CW0 F;  1J8M F;  3JCU Q;  3SP1 A;  4EE4 A;  3RH3 A;  3I0J A;  5E3C A;  2YC3 A;  4HFF B;  4HO5 A;  4B2X A;  1VZU A;  3SX7 A;  3EJN A;  1HV9 A;  3V0M A;  4C3D A;  1H5S D;  2G3V A;  5CMH A;  3OA1 A;  2XWL A;  3SXE A;  4FCU A;  3N2Z B;  1OQM B;  1SF8 A;  2FYD B;  2VSI A;  2V0I A;  1R7X A;  2Y3G A;  1VZX A;  2WAW A;  1NF5 B;  3O39 A;  1TWA A;  3D8V A;  5C1L A;  2B0J A;  1WT2 A;  2OI6 A;  4EE5 A;  3UGP A;  2L9J A;  4B5B A;  2Q3T A;  4FRD A;  1FR8 A;  2OI5 A;  1OCR C;  2WZG A;  3U0X A;  4YN0 B;  1HJJ A;  1ZI3 A;  1LZI A;  3ASN C;  2NG1 A;  3IOJ A;  4Y6U A;  3RSB A;  2J7P A;  2Y3B A;  3U2T A;  5HSW A;  4I1M A;  3K1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...