5D92A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
340
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 107
structure length 340
sequence length 342
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d92A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d92A01
4MNDA 4O6MA 4O6NA 4Q7CA 5D92A 5D91A
chains in the Genus database with same CATH superfamily
3RQGA 4A4AA 5IFYA 1VK5A 3QW1A 3ZQVA 3POVA 1LS4A 4H54A 1ZHXA 2WVQA 3NG1A 2EPLX 2NSGA 1QGQA 4W8KA 3S9OA 2A0UA 4XEKA 1I52A 1YDIA 4Y7GA 4E0IA 4ULVA 3DD7A 1LE2A 3I0DA 5FYEA 4DBRA 5F5FA 1K04A 4FIYA 1NFOA 1Q0FA 2YESA 256BA 2B0JA 3K8EA 3ZLLA 3WODF 3QVBA 1MMAA 1VYIA 3QMKA 2LIGA 4WJ0A 2HMQA 1G9RA 3B9QA 1VLSA 2R7TA 3J06A 1D0XA 1ZW2A 3OH2A 1EQ1A 1W77A 5C8RA 4CS9A 4Y7VA 1YLMA 3B0VC 3JTLO 3U3FA 3SX5A 1Q0KA 2E3DA 3AQBA 4N4WA 3U0YA 3ATPA 3OH3A 2ZXPA 2RJ7A 4DBQA 1G0RA 1H9TA 2YL7A 4B6IA 1YVIA 1YARO 4AYJA 3W2WA 2TMVP 1DOWA 1R82A 1TWHA 1A7VA 5AJNA 2ZD9A 2VS5A 1H7GA 5A6KA 1WT1A 3AG4C 3FHDA 1FGGA 2EIJC 3DJ4A 5A6AA 4EIYA 1HMOA 2XMEA 5F28E 1ZDFA 2YL3A 1PZTA 1IZMA 3GWNA 2P61A 3I4UA 3UGOA 1TR2A 4CJOA 4RDAA 4BG0A 3DJUB 3AOUA 2YC5A 1BBHA 4Y62A 1G8OA 4MYBA 2IXNA 1OCZC 4HO6A 4K1OA 2J9BA 2A68F 3E25A 2DYRC 3OWTA 1WT2A 3U8PA 2V0HA 4G3SA 2L7AA 2ZXWC 1ZJ3A 3TJ5A 1IIMA 4JTDB 2GWWA 4MVUA 2XLDA 2WAWA 3I0KA 4H4KC 3CKVA 3OH0A 1FGXA 1FNTc 2R9RB 1PD0A 1PV3A 2NSFA 3TQDA 2OG2A 4A2NB 2FFVA 4CJ8A 1YZCA 5KYYB 5D91A 2Q4FA 2YKZA 1WN0A 3RF3A 5C4EA 1SR2A 1VH1A 4Y7FA 2EINC 1H7FA 2R25A 3OH4A 2CGEA 1ZJ1A 1HM8A 3ASOC 2A8WA 1R5ID 3IQTA 1ZJPA 4U5GA 2XWMA 4OD4A 3IOJA 3IQCA 1MNEA 2XL8A 4PJMA 1E2XA 2HUJA 2P0NA 4BJ6A 1E84A 1AEPA 1GWVA 3I0HA 5KYUB 1NLXA 2J9VA 4EE4A 1S4PA 1I4YA 2JCLA 1D1BA 2OEGA 1KU2A 3TJ6A 4FWVA 3ZF8A 1WT0A 1NQIB 4KC4A 3ASNC 3EZIA 5FTSA 4MVRA 2QLAA 4IB4A 5L0FA 3A11A 4DJ9A 1NHEB 3US6A 2VCCA 3CZ6A 1BR4A 4AL1A 2QUPA 4AAWA 4CVHA 1V55C 1OQMB 2CNWD 1M2OA 3HJCA 3H2UA 4ARWA 3QW0A 5IDSA 1WTYA 1TW1A 3TK0A 3G4XA 1RJ9A 2JCJA 3FWWA 4KNXA 3E70C 1JPJA 3C8GB 1TFOB 1OQCA 1JYKA 1FO8A 2CNWA 2AWCA 5C3AA 1HW2A 2YRFA 4NTBA 4FRPA 3B29A 5HV9A 5K0IA 3LNRA 1XWJA 4E17A 2XMHA 5KYNA 3I0EA 1QVXA 3JZ0A 4HO3A 3FMSA 3QTHA 3U2WA 5JUAA 4EEAA 2J7PD 4YS8A 4Z9JA 2Z87A 4YT5A 1HJJA 4ER9A 5C38A 4EWCA 1OW7A 5FU8A 2NUTB 1RMVA 4I3MA 3RQEA 3Q6NA 1T6UA 1GX0A 2J9WA 3FOQA 2AM4A 2XWNA 2HKVA 5L0DA 2OEXA 2XXAA 1BR2A 3AQCA 3O6XA 4B4GA 3UGPA 3EGXA 4EBJA 5BQHA 3S0XA 4OIQF 2YZSA 4ASJA 3SXMA 3BCVA 3L1MA 4GYTA 2MYSA 4P9FA 2PGYA 5EJZA 2BC5A 3S29A 2YL1A 1HM9A 2DPWA 1GGQA 2RJ8A 3IQ6A 4EUKB 3CKNA 2O1HA 1E83A 2EPOA 4AYLA 3AGUA 4IAOA 1N1CA 3JRMO 1CGNA 5JLIA 1YP3A 3CKQA 4ZLCA 2J45A 5B3SC 2ZPAA 4K7BA 1FO9A 1Y6DA 1T6QA 3V5XA 3NMKA 2HSBA 4FREA 3PKQA 3KL4A 4FCUA 2LCHA 1MMNA 1NSGB 2Y4LA 3U2VA 2OU6A 3MYIA 4WGZA 2YQJA 3K6BA 4J18A 3TD7A 2X5ZA 3SPTA 3SP1A 5J49A 1VYKA 4HFKB 3U9MA 4YJWA 5CIVA 4OIRF 5DLJA 3AGTA 1I4ZA 2PA4A 1KWSA 1LZ7A 4B5BA 1V83A 4AE4B 4KC1A 1Z5ZA 1IINA 3ZGGA 3G4ZA 5C4BA 2I15A 1EI7A 4MQ9F 1WOLA 4OD5A 2G3KA 4DVZA 2RJ0A 3JUJA 4JC7A 3VF0A 3OH1A 1C03A 1G1LA 2WB7A 5E33A 2EILC 3KYIA 2RD9A 3K1IA 3SXYA 4NTAA 4FESA 4D4XA 1QQ3A 5CQLX 4UDVA 1RJ9B 4LDRA 1TWCA 1QGSA 1XZQA 4D11C 3UMKA 1FAPB 3IQ5A 5IY5C 2BO4A 1YP4A 2ETSA 2R7UA 3KIAA 1H9GA 4YL3A 3TOMA 3EG9B 3SZRA 2AM5A 4N06A 2V0JA 2KK1A 2XM0A 1HW1A 2NUPB 2PF4E 4BPMA 1LS1A 4IARA 4M4KA 1YZAA 2WZFA 1SYQA 5CI8A 1ZI1A 3AG3C 3DUVA 2Z86A 2FAPB 1Z7Qc 2BE5F 4LERA 2EPNA 4JJGA 4L41C 4PJLA 4C7OB 2WVLA 2XXAB 2Y7AA 1YYXA 3S90A 4XPWA 5L0IA 5E3CA 1SF8A 3VYWA 1ZHJA 4BJ5C 1TQGA 1FOAA 2R7RA 3EQLF 4HFFB 3W2VA 3Q4SA 5AGFA 1M2VB 1LI7A 1NBBA 1H5RB 3Q7LA 4X0RA 3U0CA 1VGWA 3M4BA 4JURI 3K7DA 2AGDA 3ECSA 4YK5A 3SXGA 2R05A 1C17M 1S4NA 1FXJA 4KXOA 1VLTA 2H7BA 4JTAB 2ASRA 3IHUA 2QY9A 1BR1A 4E18A 2VXLA 2OJQA 3RQFA 4G7OF 2KW3C 1FZWA 5BUOA 4PR9A 1S4OA 2HS5A 4M63A 1R7UA 2RIZA 4JJFA 3NYMA 4HO0A 1QPUA 1PCXA 3HL3A 4YT2A 5KYYA 1SMYF 1V4AA 2A6HF 1OXKA 3SXEA 2LQGA 4YT8A 3UMIA 1EA8A 1ZVZA 2KGOA 1OCCC 1ZU5A 4JCHA 2M64A 2YHSA 1NMMB 2VK9A 3JSZA 1WVCA 5KYUA 2KJGA 3ZIBA 1GQ9A 1APCA 3ZC4A 4N6HA 2P6WA 4YL0A 5CQPA 1H3MA 3HTKC 2RJ4A 3M4CA 1Z3IX 3T6JA 5IDTA 5KYWA 1UG7A 4O6YA 1KNYA 4ASYA 2AWYA 4FCEA 3AG2C 3ITFA 2Y6PA 3BRJA 4CS8C 2V0KA 2YQYA 3IOIA 1KTMA 4KPXA 2LFFA 1WATA 3S27A 3CGXA 5CMGX 4PFPA 2YLGA 1H4EA 3USRA 3C8GD 3EGDB 3L8JA 3B0UX 5E3AA 3Q7UA 5C3DA 3W4YA 1Q0MA 1H7IA 4Y7UA 1VMAA 4OIOF 2EIKC 3FXHA 2DGJA 3V8YA 3V0PA 3V0MA 4G3QA 1OW8A 4BJ1A 2C03A 3C8GA 2CDQA 1YJGA 1TWGA 3D5NA 2YQHA 4EE3A 4HE8D 3S84A 1R7TA 3PKPA 2CYDA 5JP7A 4U9DA 3L34A 2V0LA 2A0BA 1FFTC 1H6GA 4KQLA 1LL3A 2PFDA 5B1BC 5JS5A 5HSWA 1ZCTA 2VCAA 1G93A 4AK9A 4PJJA 4FROA 1AVOB 4YL1A 3ZQYA 4CJGA 2X5SA 5T3WA 2V26A 1R80A 3FVYA 3EHMA 2R7XA 1D1CA 3K1HA 3RVZA 1FMWA 3QVZA 4XTKA 1ST6A 4P9TA 2NUTA 5HS2A 3E9VA 1HMDA 4KNVA 2RIYA 1RXQA 4NY3A 5C48A 1TFKB 2FYDB 4GEHA 1JRAA 4FRBA 1FXOA 4D48A 5DDTA 4G78A 1LL0A 3V8ZA 3M15A 4JCZA 2C04A 5BQGA 3O10A 3I0LA 3AG1C 4HEAJ 1PZYB 1ZHZA 1QLEC 3MLGA 3QVYA 2QTVA 4MNDA 2YWAA 1FMVA 5JRAA 2D7IA 4EVWA 5C4DA 2AVKA 2R7SA 2ZU9A 4NALA 1WASA 3SXKA 4E1KA 4Q4ZF 2YCMA 1CGME 2R7WA 3SXBA 4CJBA 4CSAC 4EEOA 3I0GA 1RKEB 5DVWA 3DM5A 1INIA 4ZLDA 3IPMO 4E7ZA 2UX8A 4BEMJ 2L6HA 2IOQA 2HZ8A 1CPRA 3NYJA 3L0IA 1JV3A 5JVEA 4J32B 1LKXA 3DE9A 3RFYA 5DQTA 2APCA 4Z9IA 3V91A 3HNJA 1HJLA 3U2LA 3U9JA 1VTMP 5CMFX 5FZTA 1JV1A 4NAKA 2P73A 2X51A 4C3EA 2MHRA 4J7TA 4IRQA 2YQSA 3K66A 4C3DA 2NPUA 3LLKA 4IAQA 4ONSA 1R7VA 2H7OA 2IBFA 1FWYA 3LJBA 1H5SC 1A7DA 4AE4A 5DS6A 5KYWB 1J8YF 2IXMA 2P7VA 1H4DA 1ORSC 4P02A 1QZXA 3LW6A 4U5FE 3FOPA 3W8IA 4MIXA 4IWBA 3B0PA 5DQZA 2H8AA 2BL2A 2LD6A 4EE5A 1I5NA 4U5DE 3Q80A 1FFHA 1U0BB 2GA0A 1NKHB 2Y69C 5L0JA 3IEEA 4KC9A 1GA8A 4Q7CA 1ZCUA 2D7RA 1MP4A 4M28A 2X65A 1J8MF 4LLEA 3HNIA 3C63A 2NG1A 1F1MA 2GFHA 4DE7A 1TKNA 1ZI4A 2R03A 3DI5A 3JRTA 3RW0A 2I7BA 2OI5A 1VZUA 1ZIZA 3EG9A 2YL0A 1ZZPA 4XLPF 4KI2A 2NUPA 1E85A 1JVGA 5C49A 1ZI5A 5FUHA 1IW7F 3VRCA 1FR0A 3SYNA 3H65A 2OEFA 2L6FA 2XS8A 5CI9A 1D0ZA 2E87A 1ZHTA 1OKKD 2KNHA 3K33A 4NC3A 2FY7A 3KKBA 1M57C 2W0VA 3LESA 4G3PA 2PX0A 3SXZA 4C7OA 3ZGFA 4HO8A 4U5HA 1OKKA 2LFDA 2OI7A 4RD9A 4I44A 4KPZA 2PNOA 3GANA 3EHNA 1LVWA 3UNGC 2RITA 5C47A 2QNLA 1M2VA 1PD1A 4JE9A 3ZVRA 1H5RA 2H7VC 2NXVA 2C0NA 4MTOA 1ZCVA 1YYJA 2FYAA 3SXCA 1W2WA 5F5HA 2UUIA 4RBNA 2O1FA 4AC3A 1H7EA 4XQ1A 5A6BD 1QG8A 3R7CA 1JPNA 4ULWA 2ZXRA 2A69F 5TJ5E 5A6BA 1NU9C 2L6GA 1INJA 5FTVA 1VGZA 3D98A 3DWWA 1L3PA 4JTCB 4DVYP 4JRZA 5CQNX 2ICWG 3EPVA 3LEOA 4G0HA 2WGZA 3LNMB 4C2SA 2YEVA 3KYJA 3JT1A 4IGGA 2W4MA 2Y3DA 5L0CA 1WT3A 3D8VA 4FQWA 1XZPA 1S05A 2A6EF 3I0FA 4LDQA 4Z9HA 3I0CA 2L81A 3NKDA 4CDVA 1MMGA 1GM5A 1D0YA 1H7LA 4FX5A 1T9KA 2QKXA 4IRPA 1Z63A 2XLMA 1QWJA 2VFZA 2FYCB 4HO9A 1NG1A 3TULA 2AECA 4DXWA 3T7OA 2DYSC 2G62A 1JR8A 1LZIA 4FRMA 2LP4A 1SZIA 2HJ3A 3OA1A 2OCCC 2M4EA 1O7OA 3IOHA 1M6TA 3EGDA 3V0NA 1BZ4A 3Q7GA 4Y9XA 4DRHB 4O79A 1GS9A 1EKYA 2RJ6A 5CMHA 5A69A 2QGIA 4L6RA 3ZSUA 1G95A 4MW3A 4AX2A 3DKAA 3DJNB 1NF5B 1A7EA 2XWLA 4B2WA 3O55A 3WAQA 1W57A 3B71A 4KRVA 1U6HA 5E2QA 3ZLKA 3POLA 4XLNF 2J46A 2CW0F 5A6JA 3OGZA 1JYLA 2XM4A 3NDBB 1G2VA 5L0GA 3N24A 3C7JA 3X1OA 1R81A 2KC3A 4MTGA 5DS5A 4JVSA 1A41A 4LACB 2AM3A 2JCOA 3R2PA 3GODA 2WZLA 3ZWIA 2XRHA 1VGTA 3V90A 4PK4A 1VH3A 1OR2A 5CQOA 1YP2A 4CDAA 1VICA 3SNHA 2KSFA 4LDKA 2F22A 4OINF 5JT4A 2P72A 2RJ5A 2AP3A 3GM1A 4R32A 4BQHA 4PJNA 3EJNA 1LVKA 3RSBA 4D0TA 4CS9C 3T6BA 2W9YA 1B68A 3CAXA 3GEIA 4QI0A 4JW1A 4QI2A 1ZJ2A 4JISA 4HCQA 4B3UA 4ANJA 1QSPA 1H5SB 2BO8A 3ABLC 5T1DB 1GQCA 1G4US 4U5CE 3RYLA 4NCQA 3V0QA 1R7YA 3I5PA 4W8PA 4B4BA 2XSEA 2IXOA 5GPGB 2R7OA 3VM6A 1RKEA 2A1DD 4NANA 3U5SA 1OR3A 4FRDA 1L7CA 1FR9A 2J0XA 3OKRA 1YA9A 2ZU8A 2UUHA 5CMJA 2Z15A 1H5TA 1LI5A 2XLHA 4YN0B 1D1AA 3MBGA 2VH3A 2I8BA 2W45A 2WVMA 2HMZA 4D11A 1G3LA 1HM0A 3FAJA 1HY5A 1O0RA 1TWAA 2OI6A 3CKJA 1HE1A 2B0HA 3G50A 1H4CA 2D0JA 5AC5A 3C62A 2FFUA 2GGQA 3U8VA 2OEVA 2VB6A 3JUKA 3GM3A 3DM9B 1ZJ0A 5AJOA 3OAMA 2HV6A 5C1GA 4K0DA 2GDCA 4CIPA 1K4VA 5COMA 4B4MA 4OIPF 2HV7A 4B2XA 3CSKA 3CKOA 3SX7A 5KYXB 4I1OB 2AE7A 5EHHA 1FR8A 3KPHA 1ZHYA 4DDZA 3HNLA 3SXDA 3GUEA 4BEJA 5FV9A 1YROB 3M79A 2O9XA 1K05A 3FAPB 1G23A 3F47A 1AUEA 1TVYA 3ZG1A 3SEOA 4JIOA 4D4NA 3AJMA 2Q9CA 5L6SA 4XPXA 2YC3A 2AU5A 4BJ6C 2FFHA 2HSQA 2P1AA 2RIXA 3W8HA 4XWIA 4BJ5A 2Q9AA 1NZEA 4KNRA 2LSEA 4BMAA 3EFOB 2QH5A 2R7VA 1NU7D 2XLWA 4WGYA 4QDLA 2GGOA 4HO2A 3MFNA 3F1YA 1Z6AA 4UEGA 1V54C 3V0OA 1FTSA 5DS4A 4O6NA 1MP3A 1ZJOA 4FRAA 3F46A 2OOCA 3PNNA 4Y7TA 1LZ0A 4DECA 3HNKA 1HV9A 4YT4A 2PP4A 1U89A 3N2ZB 1O87A 3PMRA 2AESA 4JEAA 4G7HF 2BO7A 1VZTA 4G87A 1A0BA 2EIMC 5C36A 3NYLA 1TZFA 1WGWA 3EZHA 2EPMX 1VM8A 5DDVA 1O3UA 1JVDA 4NAIA 1JAFA 2MZBA 1RCPA 1MNDA 5L3VA 3A9CA 4IJJA 2VS4A 3ZTMA 1MMDA 2L9JA 3DXJF 1Z90A 3VAYA 1G8XA 2RJ9A 4JD0A 4CJCA 4FRHA 3CU0A 2J8WA 3BRKX 5BXCA 4NQFA 4CS8A 2XLOA 2ICYA 1FG5N 4CIHA 1H5TB 2A8UA 3Q6MA 3LS1A 1O7QA 4XEFA 3RKOF 1BDJB 4JEBA 2AH9A 1ON6A 2J0AA 3RVYA 4U5BE 3TOLA 5FU0A 4MS2A 1OMXA 2DB4A 1R7XA 4PACA 3R2WA 3PCVA 2VSIA 2VCBA 2DI3A 3NMJA 1K40A 1ZW3A 2Y4KA 3V5ZA 1CPQA 1VB5A 3NKEA 3JCUQ 5B3IA 3JSEO 3DK5A 4AL0A 3DMDA 3I0IX 4EEMA 3S28A 4JKVA 4BJTA 3RMWA 2PX3A 4YWQA 3LS0A 4KNWA 2IYLD 3DE8A 4Y63A 2Q4JA 2OJED 5CMIA 2Q7RA 5COGA 1SS9A 4FIXA 3OEOA 1T6IA 5EGYA 2I5EA 1E5KA 1Q0DA 2JPUA 1WSZA 3RIPA 3TQOA 3UR3C 4E0HA 2IXPA 4EHPA 3LLIA 3LEVA 4PFOA 2VS3A 1YA7O 2WVOA 4P6IC 3GM2A 4N6CA 4CDYA 3SXAA 2WZGA 3T4RA 2ZXOA 3I0JA 1EYRA 3RH3A 1DOVA 3U3BA 1OCRC 3NMIA 4EEGA 2V3CC 3FDQA 3CEXA 2LK4A 4MVOA 2YLDA 4KC2A 3TZTA 2KQ9A 1MP5A 4LLCA 1T5OA 1MQVA 3H2VA 3BEHA 1MC3A 1LE4A 4C3BA 4HG6A 5L6VA 4CSAA 3K1IC 4MVQA 5L0HA 1H7TA 3MX3A 1JOGA 2VASA 3HKKA 2J7PA 4MW8A 3SX3A 1Q0GA 3DAFA 2WVKA 1O23B 1LZJA 2JD3A 4CX9A 2E8BA 4Y64A 4XPYA 5C4FA 1H5SD 3NGWA 2ICXA 5C3BA 4MVMA 4EBKA 4M2AA 2V0IA 4HOCA 2Q00A 3T9OA 4EKWA 3KMIA 1GX4A 3GEHA 1H5SA 4CBEA 2PGVA 2J0WA 2PBEA 1GWWA 4Y6NA 2W0WA 3PHF2 2D5RB 1NFNA 2I5KA 5I1FA 3C18A 4MTFA 1XZ6A 4XWJA 1UFBA 2EPKX 2FGYA 4J7YA 4FRLA 1ZYRF 2RSEB 3SX8A 2VXMA 3LAYA 2XL6A 4JZAA 5B1AC 1ZU4A 3GWLA 1VOMA 2MWQA 2HJMA 4R7PA 2VD4A 4EBBA 3ABKC 1XHBA 5AC4A 2P6VA 2HFIA 2OKUA 1T01A 3U2UA 1LM3B 4KBLA 4U5EE 5EIYA 5L3QA 1H7HA 3GEEA 1Z23A 3U2MA 2J0BA 4LW6A 3JTJA 3FOOA 3OC9A 3T6GB 3V7OA 4ZDQA 2XL4A 3N0TA 4Y6UA 1OXBA 3T7NA 2X60A 2G3VA 1EZIA 2ZU7A 4ECMA 3ABMC 2IM8A 1ZCYA 4P00A 2WL8A 1YAUO 5KYXA 1QKRA 2JCKA 2WE9A 1VZXA 1ORYA 5JSLA 3R3IA 1TW5A 4CS7A 4XEVA 2XLVA 5FCLA 2RJ1A 4LW3A 3X2QC 1ZHWA 1OW6A 3GORA 3EH2A 2Y4MA 4DRIB 2VSHA 3DZAA 5CQMX 2Y4JA 1OCOC 3O3PA 4DOZA 3DAGA 4J30B 2GAQA 1VPAA 5EK0A 3ZDLA 4I1MA 3WG7C 5C4CA 3USQA 2CU2A 2J9UA 1CGOA 3EFOA 2VC9A 2CCYA 1GQAA 5T3TA 3PDMP 2YQCA 1JMWA 4O6MA 2WEEA 3E26A 5AJPA 3JYYA 1G97A 2Y3BA 4F4BA 5COFA 5EJ1A 3I5QA 3HLZA 1VGUA 3T7MA 2XS1A 2R7QA 3EH1A 3WHNA 3U0XA 1OMZA 2BO6A 4GQHA 4WABA 2Q9BA 1M56C 4U9EA 1V74B 1ORJA 3CQZA 1E86A 4NTFA 2OQMA 3EGXB 4M2BA 2Y3GA 1FRWA 3V5YA 2Y3HA 4FAPB 2D4UA 3JYHA 4MVZA 5BQIA 2JX0A 2O1GA 1Y4CA 1V82A 1LIHA 1R4TA 4HO5A 2FYBA 5C1LA 1C02A 3O39A 4MVSA 4D0ZA 4E7SA 2X0CA 2YVKA 1LL2A 4FRQA 4Q5SF 3KH2A 1H7QA 3ST8A 4HO4A 2R02A 1RKCA 1ZDGA 3UMHA 1W55A 2W4BA 4DRJB 1G4WR 3U2XA 2QE9A 3K8DA 2YLIA 3F1CA 1G5ZA 4G7ZF 2PX7A 3U2TA 2Q3TA 3QZCA 3M1CB 1V84A 1WWPA 4K6RA 1S7ZA 3C8ZA 5JQQA 4O7GA 5C1HA 3MYFA 2XLEA 4B42A 3L8IA 3RMVA 1ZI3A 3V0LA 4IRUA 3LUTB 4KT7A 3N9WA 3EE5A 1LPEA 3NRHA 5D92A 2KYHA 3ZTZA 2WVNA 1O5HA 4GBPA 1NWGB 2Y39A 1HE9A 1ON8A
chains in the Genus database with same CATH topology
5IFYA 1VK5A 3EG9B 3SZRA 3UNGC 2AM5A 4CS8A 3POVA 4N06A 2RITA 2ICYA 2V0JA 1FG5N 5C47A 1ZHXA 4CIHA 1H5TB 2A8UA 2NUPB 2WVQA 2PF4E 3NG1A 1LS1A 1M2VA 4M4KA 1QGQA 2WZFA 1PD1A 4W8KA 3ZVRA 1H5RA 2H7VC 2NXVA 3Q6MA 2C0NA 1I52A 1ZCVA 3LS1A 1O7QA 2FYAA 4Y7GA 3RKOF 5CI8A 1ZI1A 3SXCA 3DD7A 1W2WA 2AH9A 5F5HA 1ON6A 3AG3C 3I0DA 5FYEA 4DBRA 5F5FA 2J0AA 4FIYA 4RBNA 3DUVA 2Z86A 2O1FA 4AC3A 1H7EA 2YESA 2BE5F 4U5BE 4LERA 2B0JA 3K8EA 4JJGA 3ZLLA 4L41C 3WODF 5FU0A 3QVBA 4PJLA 4C7OB 1MMAA 1OMXA 1QG8A 1R7XA 2WVLA 1VYIA 3R2WA 2XXAB 2VSIA 3QMKA 4WJ0A 1G9RA 1JPNA 2Y7AA 3B9QA 4ULWA 2R7TA 2ZXRA 2A69F 2Y4KA 3NKEA 1NU9C 1INJA 5FTVA 3JCUQ 5E3CA 1SF8A 3VYWA 1VGZA 3D98A 3DK5A 3DMDA 3I0IX 1D0XA 4EEMA 1ZHJA 4BJ5C 3OH2A 1FOAA 3S28A 2R7RA 1W77A 3EQLF 4BJTA 4HFFB 3W2VA 3Q4SA 4Y7UA 5C8RA 4CS9A 1M2VB 4DVYP 3RMWA 2PX3A 4YWQA 4Y7VA 3LS0A 4KNWA 3B0VC 2IYLD 4Y63A 1H5RB 3SX5A 3Q7LA 5CQNX 4X0RA 2E3DA 3AQBA 3EPVA 2Q4JA 1VGWA 5CMIA 4G0HA 4JURI 1SS9A 2WGZA 3K7DA 4FIXA 3OEOA 3U0YA 3OH3A 2AGDA 2ZXPA 5EGYA 4C2SA 2YEVA 3ECSA 3JT1A 2RJ7A 2W4MA 2I5EA 4DBQA 1G0RA 2Y3DA 1WT3A 3D8VA 3SXGA 4B6IA 1E5KA 4FQWA 1S4NA 1FXJA 4KXOA 1WSZA 3RIPA 4AYJA 3W2WA 3UR3C 2A6EF 2IXPA 3I0FA 3I0CA 1R82A 3LLIA 1TWHA 2L81A 3NKDA 1MMGA 5AJNA 2H7BA 3LEVA 4PFOA 2VS3A 1D0YA 1H7LA 2VS5A 1H7GA 2WVOA 4P6IC 2QY9A 4FX5A 1WT1A 1BR1A 3AG4C 2QKXA 4IRPA 3FHDA 2VXLA 1Z63A 1FGGA 1QWJA 2EIJC 2VFZA 4G7OF 2KW3C 1FZWA 3DJ4A 5BUOA 3SXAA 2FYCB 4HO9A 1S4OA 2XMEA 2WZGA 3T4RA 4M63A 1R7UA 1ZDFA 2RIZA 4JJFA 2ZXOA 1NG1A 1IZMA 3NYMA 1EYRA 1PZTA 3I4UA 3UGOA 3RH3A 3I0JA 4HO0A 1PCXA 3HL3A 1TR2A 4YT2A 5KYYA 1OCRC 1SMYF 4RDAA 4BG0A 2AECA 4EEGA 2V3CC 2A6HF 3DJUB 3FDQA 3SXEA 2YC5A 3T7OA 4YT8A 2DYSC 3UMIA 4Y62A 1G8OA 2G62A 1LZIA 4FRMA 4MYBA 1SZIA 2IXNA 4KC2A 1OCZC 3TZTA 3OA1A 2KQ9A 4HO6A 1MP5A 2A68F 2OCCC 2DYRC 3OWTA 4LLCA 1WT2A 3E25A 4G3SA 2KGOA 2V0HA 4KC1A 2M4EA 2ZXWC 1ZJ3A 1MC3A 1O7OA 1OCCC 3IOHA 4C3BA 1ZU5A 1IIMA 4HG6A 5L6VA 3EGDA 3V0NA 4CSAA 3I0KA 4JCHA 2WAWA 3Q7GA 3K1IC 4H4KC 2YHSA 3CKVA 1NMMB 3OH0A 2VK9A 1FGXA 3JSZA 4Y9XA 1WVCA 5KYUA 1PD0A 4O79A 1H7TA 3MX3A 2KJGA 3ZIBA 1GQ9A 3ZC4A 3TQDA 2OG2A 2VASA 2RJ6A 5CMHA 2P6WA 5CQPA 2QGIA 2J7PA 3HTKC 1H3MA 4A2NB 3SX3A 2FFVA 4CJ8A 3ZSUA 3DAFA 5KYYB 5D91A 1G95A 2RJ4A 2WVKA 1Z3IX 3T6JA 5IDTA 4AX2A 1O23B 5KYWA 1LZJA 5C4EA 3DJNB 4O6YA 1VH1A 4Y7FA 2EINC 4ASYA 1NF5B 4FCEA 3AG2C 3ITFA 1H7FA 2Y6PA 2JD3A 4CS8C 2E8BA 2XWLA 4Y64A 2V0KA 4B2WA 3IOIA 3OH4A 5C4FA 1W57A 1H5SD 3NGWA 4KRVA 2CGEA 2ICXA 4KPXA 5C3BA 1ZJ1A 1HM8A 3S27A 3ASOC 3CGXA 5CMGX 5E2QA 3ZLKA 4M2AA 2A8WA 3POLA 4XLNF 2J46A 2CW0F 2V0IA 4HOCA 4PFPA 1H4EA 1ZJPA 3USRA 4U5GA 2XWMA 4OD4A 3IOJA 3EGDB 1JYLA 3OGZA 1MNEA 3NDBB 4PJMA 3B0UX 1G2VA 3KMIA 5E3AA 1GX4A 3Q7UA 4BJ6A 5C3DA 3N24A 1H5SA 4CBEA 3X1OA 1R81A 2PGVA 2J0WA 1GWVA 3I0HA 1GWWA 4Y6NA 1VMAA 5DS5A 4OIOF 2EIKC 5KYUB 2D5RB 4JVSA 3PHF2 2DGJA 2J9VA 2W0WA 3V8YA 3V0PA 1S4PA 4EE4A 2AM3A 4LACB 2JCOA 3V0MA 4G3QA 2JCLA 1D1BA 2OEGA 2I5KA 4BJ1A 3GODA 2WZLA 2C03A 2CDQA 1KU2A 2XRHA 5I1FA 1TWGA 1VGTA 2YQHA 3D5NA 4FWVA 3ZF8A 1WT0A 1NQIB 4KC4A 4EE3A 1XZ6A 4HE8D 1R7TA 3PKPA 3V90A 4PK4A 1VH3A 3ASNC 3EZIA 5CQOA 1YP2A 1VICA 3L34A 3SNHA 2V0LA 5FTSA 4XWJA 4OINF 2FGYA 4FRLA 1FFTC 1ZYRF 2P72A 4KQLA 5B1BC 2PFDA 1LL3A 2RJ5A 3SX8A 5HSWA 3LAYA 2VXMA 1ZCTA 1G93A 4BQHA 4PJNA 3EJNA 4JZAA 1LVKA 4AK9A 1NHEB 4PJJA 4FROA 3RSBA 4D0TA 4CS9C 3CZ6A 3T6BA 5B1AC 2W9YA 1ZU4A 1BR4A 1VOMA 2MWQA 2X5SA 4QI0A 5T3WA 4AAWA 4JW1A 2V26A 4CVHA 4QI2A 1ZJ2A 1R80A 4R7PA 3FVYA 2VD4A 4JISA 4EBBA 3ABKC 3EHMA 1XHBA 4HCQA 2P6VA 2R7XA 4B3UA 1D1CA 3K1HA 3U2UA 1V55C 1OQMB 1FMWA 2CNWD 4ANJA 1M2OA 3HJCA 4XTKA 1H5SB 2BO8A 4ARWA 3ABLC 5T1DB 5IDSA 1ST6A 1GQCA 2NUTA 4KBLA 1TW1A 4U5CE 4U5EE 5EIYA 5L3QA 5HS2A 3E9VA 1RJ9A 3RYLA 1H7HA 4KNVA 1Z23A 2JCJA 2RIYA 3FWWA 4KNXA 3E70C 4NY3A 1R7YA 3I5PA 2J0BA 3V0QA 2XSEA 4LW6A 1JPJA 4B4BA 2FYDB 3JTJA 5C48A 2IXOA 4GEHA 3OC9A 3V7OA 4FRBA 2R7OA 4ZDQA 1JYKA 1FO8A 2CNWA 1FXOA 2A1DD 2XL4A 5C3AA 4D48A 5DDTA 1LL0A 3N0TA 4Y6UA 3T7NA 4NANA 3V8ZA 2X60A 2G3VA 1EZIA 2ZU7A 4FRDA 4FRPA 4ECMA 3ABMC 1ZCYA 4P00A 1FR9A 2WL8A 2C04A 3LNRA 2J0XA 3OKRA 2XMHA 3I0LA 3AG1C 2ZU8A 5CMJA 5KYNA 4HEAJ 5KYXA 3I0EA 1PZYB 2JCKA 1ZHZA 2WE9A 1VZXA 2Z15A 4HO3A 1H5TA 1QLEC 3MLGA 4MNDA 1D1AA 2QTVA 4YN0B 3R3IA 3U2WA 1TW5A 1FMVA 4CS7A 2VH3A 2I8BA 2W45A 2WVMA 2J7PD 5FCLA 2D7IA 4YS8A 2RJ1A 4D11A 4LW3A 4EEAA 3X2QC 1ZHWA 1G3LA 1HM0A 2Z87A 3FAJA 4YT5A 1O0RA 3EH2A 1HJJA 4EVWA 5C4DA 2Y4MA 1TWAA 2R7SA 2OI6A 2ZU9A 2VSHA 5C38A 4EWCA 3DZAA 3CKJA 4NALA 5CQMX 5FU8A 2Y4JA 2NUTB 1H4CA 4E1KA 4I3MA 4Q4ZF 2D0JA 1OCOC 2YCMA 3O3PA 4DOZA 4B5BA 2R7WA 2FFUA 2GGQA 3SXBA 3DAGA 3Q6NA 4J30B 4CJBA 4CSAC 2VB6A 1VPAA 1GX0A 3JUKA 4I1MA 3WG7C 4EEOA 3I0GA 2J9WA 5C4CA 5DVWA 3FOQA 3DM9B 3DM5A 1ZJ0A 2AM4A 2CU2A 2XWNA 5AJOA 3USQA 2XXAA 1INIA 1BR2A 4ZLDA 2HV6A 3AQCA 3OAMA 3O6XA 2J9UA 4E7ZA 4K0DA 3UGPA 2UX8A 5C1GA 4B4GA 4DE7A 2IOQA 3EGXA 3EFOA 3S0XA 4OIQF 2YZSA 1K4VA 4ASJA 5T3TA 3NYJA 4B4MA 4OIPF 3BCVA 2HV7A 2YQCA 4B2XA 3L0IA 4GYTA 1JV3A 3CSKA 2MYSA 4J32B 4O6MA 2WEEA 3CKOA 3E26A 5KYXB 2PGYA 5AJPA 1LKXA 3SX7A 4I1OB 1G97A 2AE7A 5EHHA 1FR8A 3RFYA 5EJZA 1ZHYA 2Y3BA 4F4BA 4DDZA 3S29A 3SXDA 5EJ1A 3GUEA 5DQTA 1HM9A 4BEJA 3I5QA 3HLZA 1YROB 2APCA 2DPWA 3V91A 5FV9A 1HJLA 1VGUA 2RJ8A 3T7MA 2O9XA 3CKNA 2O1HA 2R7QA 1G23A 3EH1A 3F47A 5CMFX 1JV1A 1TVYA 4AYLA 4NAKA 3U0XA 2P73A 3ZG1A 2X51A 1OMZA 3SEOA 2BO6A 4C3EA 4IRQA 2YQSA 4IAOA 3K66A 4C3DA 2Q9CA 5L6SA 2YC3A 1N1CA 3LLKA 1R7VA 2H7OA 2Q9BA 4BJ6C 2FFHA 3LJBA 1M56C 1FWYA 1H5SC 1YP3A 3CKQA 2RIXA 3W8HA 3CQZA 2J45A 4AE4A 4ZLCA 4BJ5A 2ZPAA 5B3SC 2Q9AA 5DS6A 5KYWB 4XWIA 1J8YF 1NZEA 2IXMA 2P7VA 2LSEA 1H4DA 4KNRA 4P02A 1QZXA 4K7BA 3LW6A 4BMAA 4U5FE 3EGXB 1FO9A 4M2BA 3EFOB 2Y3GA 3W8IA 1FRWA 4MIXA 2QH5A 4IWBA 3B0PA 2Y3HA 5DQZA 4FREA 3PKQA 3KL4A 4FCUA 3JYHA 4EE5A 4U5DE 1NU7D 2R7VA 3Q80A 1FFHA 5C1LA 4QDLA 2GGOA 1MMNA 2Y4LA 3U2VA 2O1GA 1V82A 4HO2A 3F1YA 1Z6AA 4UEGA 1V54C 3V0OA 1NKHB 1FTSA 2Y69C 4HO5A 2YQJA 5DS4A 4O6NA 2FYBA 3K6BA 4J18A 3IEEA 1MP3A 4KC9A 3TD7A 1GA8A 3F46A 1ZJOA 4Q7CA 2X5ZA 4FRAA 1ZCUA 2D7RA 3SPTA 3SP1A 1MP4A 1VYKA 3PNNA 4Y7TA 3O39A 4M28A 5J49A 4HFKB 2X65A 4D0ZA 1J8MF 4LLEA 4E7SA 1LZ0A 4YJWA 4DECA 1LL2A 4OIRF 1HV9A 5DLJA 4FRQA 2NG1A 4Q5SF 3KH2A 4YT4A 2PA4A 2PP4A 1H7QA 1KWSA 3ST8A 4HO4A 3N2ZB 2GFHA 1O87A 1LZ7A 1ZDGA 3PMRA 1V83A 4AE4B 3UMHA 1Z5ZA 1IINA 1W55A 4G7HF 2AESA 2W4BA 2BO7A 1VZTA 1TKNA 3ZGGA 4G87A 2EIMC 1ZI4A 5C4BA 3JRTA 3NYLA 1TZFA 2I7BA 3U2XA 1WGWA 3K8DA 3EZHA 4MQ9F 2OI5A 1VZUA 3F1CA 1ZIZA 3EG9A 1VM8A 4OD5A 5DDVA 4G7ZF 2PX7A 3U2TA 2G3KA 2Q3TA 4XLPF 5C36A 4DVZA 2RJ0A 1JVDA 4NAIA 3QZCA 4KI2A 2NUPA 3JUJA 3M1CB 1V84A 1JVGA 5C49A 1ZI5A 3OH1A 5FUHA 2MZBA 1IW7F 4K6RA 1MNDA 1S7ZA 3SYNA 1G1LA 3H65A 5L3VA 2OEFA 2WB7A 5E33A 2EILC 4IJJA 5CI9A 2VS4A 1D0ZA 1MMDA 2E87A 5JQQA 1ZHTA 1OKKD 4O7GA 2L9JA 5C1HA 2KNHA 4B42A 3K33A 4FESA 5CQLX 3RMVA 1ZI3A 3DXJF 1Z90A 1RJ9B 3VAYA 1G8XA 2FY7A 1TWCA 2RJ9A 3KKBA 1M57C 1QGSA 4IRUA 3LESA 2W0VA 4JD0A 3V0LA 4KT7A 4CJCA 4FRHA 4D11C 3UMKA 4G3PA 2PX0A 3N9WA 4C7OA 3EE5A 3ZGFA 3CU0A 4HO8A 4U5HA 1OKKA 3NRHA 5D92A 5IY5C 2WVNA 4RD9A 2OI7A 1O5HA 2BO4A 4GBPA 1NWGB 4I44A 4KPZA 1YP4A 3BRKX 2R7UA 3GANA 2Y39A 3KIAA 5BXCA 3EHNA 1LVWA 1ON8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MND A;  4O6M A;  4O6N A;  4Q7C A;  5D92 A;  5D91 A; 
#chains in the Genus database with same CATH topology
 3RQG A;  4A4A A;  5IFY A;  1VK5 A;  3QW1 A;  3ZQV A;  3POV A;  1LS4 A;  4H54 A;  1ZHX A;  2WVQ A;  3NG1 A;  2EPL X;  2NSG A;  1QGQ A;  4W8K A;  3S9O A;  2A0U A;  4XEK A;  1I52 A;  1YDI A;  4Y7G A;  4E0I A;  4ULV A;  3DD7 A;  1LE2 A;  3I0D A;  5FYE A;  4DBR A;  5F5F A;  1K04 A;  4FIY A;  1NFO A;  1Q0F A;  2YES A;  256B A;  2B0J A;  3K8E A;  3ZLL A;  3WOD F;  3QVB A;  1MMA A;  1VYI A;  3QMK A;  2LIG A;  4WJ0 A;  2HMQ A;  1G9R A;  3B9Q A;  1VLS A;  2R7T A;  3J06 A;  1D0X A;  1ZW2 A;  3OH2 A;  1EQ1 A;  1W77 A;  5C8R A;  4CS9 A;  4Y7V A;  1YLM A;  3B0V C;  3JTL O;  3U3F A;  3SX5 A;  1Q0K A;  2E3D A;  3AQB A;  4N4W A;  3U0Y A;  3ATP A;  3OH3 A;  2ZXP A;  2RJ7 A;  4DBQ A;  1G0R A;  1H9T A;  2YL7 A;  4B6I A;  1YVI A;  1YAR O;  4AYJ A;  3W2W A;  2TMV P;  1DOW A;  1R82 A;  1TWH A;  1A7V A;  5AJN A;  2ZD9 A;  2VS5 A;  1H7G A;  5A6K A;  1WT1 A;  3AG4 C;  3FHD A;  1FGG A;  2EIJ C;  3DJ4 A;  5A6A A;  4EIY A;  1HMO A;  2XME A;  5F28 E;  1ZDF A;  2YL3 A;  1PZT A;  1IZM A;  3GWN A;  2P61 A;  3I4U A;  3UGO A;  1TR2 A;  4CJO A;  4RDA A;  4BG0 A;  3DJU B;  3AOU A;  2YC5 A;  1BBH A;  4Y62 A;  1G8O A;  4MYB A;  2IXN A;  1OCZ C;  4HO6 A;  4K1O A;  2J9B A;  2A68 F;  3E25 A;  2DYR C;  3OWT A;  1WT2 A;  3U8P A;  2V0H A;  4G3S A;  2L7A A;  2ZXW C;  1ZJ3 A;  3TJ5 A;  1IIM A;  4JTD B;  2GWW A;  4MVU A;  2XLD A;  2WAW A;  3I0K A;  4H4K C;  3CKV A;  3OH0 A;  1FGX A;  1FNT c;  2R9R B;  1PD0 A;  1PV3 A;  2NSF A;  3TQD A;  2OG2 A;  4A2N B;  2FFV A;  4CJ8 A;  1YZC A;  5KYY B;  5D91 A;  2Q4F A;  2YKZ A;  1WN0 A;  3RF3 A;  5C4E A;  1SR2 A;  1VH1 A;  4Y7F A;  2EIN C;  1H7F A;  2R25 A;  3OH4 A;  2CGE A;  1ZJ1 A;  1HM8 A;  3ASO C;  2A8W A;  1R5I D;  3IQT A;  1ZJP A;  4U5G A;  2XWM A;  4OD4 A;  3IOJ A;  3IQC A;  1MNE A;  2XL8 A;  4PJM A;  1E2X A;  2HUJ A;  2P0N A;  4BJ6 A;  1E84 A;  1AEP A;  1GWV A;  3I0H A;  5KYU B;  1NLX A;  2J9V A;  4EE4 A;  1S4P A;  1I4Y A;  2JCL A;  1D1B A;  2OEG A;  1KU2 A;  3TJ6 A;  4FWV A;  3ZF8 A;  1WT0 A;  1NQI B;  4KC4 A;  3ASN C;  3EZI A;  5FTS A;  4MVR A;  2QLA A;  4IB4 A;  5L0F A;  3A11 A;  4DJ9 A;  1NHE B;  3US6 A;  2VCC A;  3CZ6 A;  1BR4 A;  4AL1 A;  2QUP A;  4AAW A;  4CVH A;  1V55 C;  1OQM B;  2CNW D;  1M2O A;  3HJC A;  3H2U A;  4ARW A;  3QW0 A;  5IDS A;  1WTY A;  1TW1 A;  3TK0 A;  3G4X A;  1RJ9 A;  2JCJ A;  3FWW A;  4KNX A;  3E70 C;  1JPJ A;  3C8G B;  1TFO B;  1OQC A;  1JYK A;  1FO8 A;  2CNW A;  2AWC A;  5C3A A;  1HW2 A;  2YRF A;  4NTB A;  4FRP A;  3B29 A;  5HV9 A;  5K0I A;  3LNR A;  1XWJ A;  4E17 A;  2XMH A;  5KYN A;  3I0E A;  1QVX A;  3JZ0 A;  4HO3 A;  3FMS A;  3QTH A;  3U2W A;  5JUA A;  4EEA A;  2J7P D;  4YS8 A;  4Z9J A;  2Z87 A;  4YT5 A;  1HJJ A;  4ER9 A;  5C38 A;  4EWC A;  1OW7 A;  5FU8 A;  2NUT B;  1RMV A;  4I3M A;  3RQE A;  3Q6N A;  1T6U A;  1GX0 A;  2J9W A;  3FOQ A;  2AM4 A;  2XWN A;  2HKV A;  5L0D A;  2OEX A;  2XXA A;  1BR2 A;  3AQC A;  3O6X A;  4B4G A;  3UGP A;  3EGX A;  4EBJ A;  5BQH A;  3S0X A;  4OIQ F;  2YZS A;  4ASJ A;  3SXM A;  3BCV A;  3L1M A;  4GYT A;  2MYS A;  4P9F A;  2PGY A;  5EJZ A;  2BC5 A;  3S29 A;  2YL1 A;  1HM9 A;  2DPW A;  1GGQ A;  2RJ8 A;  3IQ6 A;  4EUK B;  3CKN A;  2O1H A;  1E83 A;  2EPO A;  4AYL A;  3AGU A;  4IAO A;  1N1C A;  3JRM O;  1CGN A;  5JLI A;  1YP3 A;  3CKQ A;  4ZLC A;  2J45 A;  5B3S C;  2ZPA A;  4K7B A;  1FO9 A;  1Y6D A;  1T6Q A;  3V5X A;  3NMK A;  2HSB A;  4FRE A;  3PKQ A;  3KL4 A;  4FCU A;  2LCH A;  1MMN A;  1NSG B;  2Y4L A;  3U2V A;  2OU6 A;  3MYI A;  4WGZ A;  2YQJ A;  3K6B A;  4J18 A;  3TD7 A;  2X5Z A;  3SPT A;  3SP1 A;  5J49 A;  1VYK A;  4HFK B;  3U9M A;  4YJW A;  5CIV A;  4OIR F;  5DLJ A;  3AGT A;  1I4Z A;  2PA4 A;  1KWS A;  1LZ7 A;  4B5B A;  1V83 A;  4AE4 B;  4KC1 A;  1Z5Z A;  1IIN A;  3ZGG A;  3G4Z A;  5C4B A;  2I15 A;  1EI7 A;  4MQ9 F;  1WOL A;  4OD5 A;  2G3K A;  4DVZ A;  2RJ0 A;  3JUJ A;  4JC7 A;  3VF0 A;  3OH1 A;  1C03 A;  1G1L A;  2WB7 A;  5E33 A;  2EIL C;  3KYI A;  2RD9 A;  3K1I A;  3SXY A;  4NTA A;  4FES A;  4D4X A;  1QQ3 A;  5CQL X;  4UDV A;  1RJ9 B;  4LDR A;  1TWC A;  1QGS A;  1XZQ A;  4D11 C;  3UMK A;  1FAP B;  3IQ5 A;  5IY5 C;  2BO4 A;  1YP4 A;  2ETS A;  2R7U A;  3KIA A;  1H9G A;  4YL3 A;  3TOM A;  3EG9 B;  3SZR A;  2AM5 A;  4N06 A;  2V0J A;  2KK1 A;  2XM0 A;  1HW1 A;  2NUP B;  2PF4 E;  4BPM A;  1LS1 A;  4IAR A;  4M4K A;  1YZA A;  2WZF A;  1SYQ A;  5CI8 A;  1ZI1 A;  3AG3 C;  3DUV A;  2Z86 A;  2FAP B;  1Z7Q c;  2BE5 F;  4LER A;  2EPN A;  4JJG A;  4L41 C;  4PJL A;  4C7O B;  2WVL A;  2XXA B;  2Y7A A;  1YYX A;  3S90 A;  4XPW A;  5L0I A;  5E3C A;  1SF8 A;  3VYW A;  1ZHJ A;  4BJ5 C;  1TQG A;  1FOA A;  2R7R A;  3EQL F;  4HFF B;  3W2V A;  3Q4S A;  5AGF A;  1M2V B;  1LI7 A;  1NBB A;  1H5R B;  3Q7L A;  4X0R A;  3U0C A;  1VGW A;  3M4B A;  4JUR I;  3K7D A;  2AGD A;  3ECS A;  4YK5 A;  3SXG A;  2R05 A;  1C17 M;  1S4N A;  1FXJ A;  4KXO A;  1VLT A;  2H7B A;  4JTA B;  2ASR A;  3IHU A;  2QY9 A;  1BR1 A;  4E18 A;  2VXL A;  2OJQ A;  3RQF A;  4G7O F;  2KW3 C;  1FZW A;  5BUO A;  4PR9 A;  1S4O A;  2HS5 A;  4M63 A;  1R7U A;  2RIZ A;  4JJF A;  3NYM A;  4HO0 A;  1QPU A;  1PCX A;  3HL3 A;  4YT2 A;  5KYY A;  1SMY F;  1V4A A;  2A6H F;  1OXK A;  3SXE A;  2LQG A;  4YT8 A;  3UMI A;  1EA8 A;  1ZVZ A;  2KGO A;  1OCC C;  1ZU5 A;  4JCH A;  2M64 A;  2YHS A;  1NMM B;  2VK9 A;  3JSZ A;  1WVC A;  5KYU A;  2KJG A;  3ZIB A;  1GQ9 A;  1APC A;  3ZC4 A;  4N6H A;  2P6W A;  4YL0 A;  5CQP A;  1H3M A;  3HTK C;  2RJ4 A;  3M4C A;  1Z3I X;  3T6J A;  5IDT A;  5KYW A;  1UG7 A;  4O6Y A;  1KNY A;  4ASY A;  2AWY A;  4FCE A;  3AG2 C;  3ITF A;  2Y6P A;  3BRJ A;  4CS8 C;  2V0K A;  2YQY A;  3IOI A;  1KTM A;  4KPX A;  2LFF A;  1WAT A;  3S27 A;  3CGX A;  5CMG X;  4PFP A;  2YLG A;  1H4E A;  3USR A;  3C8G D;  3EGD B;  3L8J A;  3B0U X;  5E3A A;  3Q7U A;  5C3D A;  3W4Y A;  1Q0M A;  1H7I A;  4Y7U A;  1VMA A;  4OIO F;  2EIK C;  3FXH A;  2DGJ A;  3V8Y A;  3V0P A;  3V0M A;  4G3Q A;  1OW8 A;  4BJ1 A;  2C03 A;  3C8G A;  2CDQ A;  1YJG A;  1TWG A;  3D5N A;  2YQH A;  4EE3 A;  4HE8 D;  3S84 A;  1R7T A;  3PKP A;  2CYD A;  5JP7 A;  4U9D A;  3L34 A;  2V0L A;  2A0B A;  1FFT C;  1H6G A;  4KQL A;  1LL3 A;  2PFD A;  5B1B C;  5JS5 A;  5HSW A;  1ZCT A;  2VCA A;  1G93 A;  4AK9 A;  4PJJ A;  4FRO A;  1AVO B;  4YL1 A;  3ZQY A;  4CJG A;  2X5S A;  5T3W A;  2V26 A;  1R80 A;  3FVY A;  3EHM A;  2R7X A;  1D1C A;  3K1H A;  3RVZ A;  1FMW A;  3QVZ A;  4XTK A;  1ST6 A;  4P9T A;  2NUT A;  5HS2 A;  3E9V A;  1HMD A;  4KNV A;  2RIY A;  1RXQ A;  4NY3 A;  5C48 A;  1TFK B;  2FYD B;  4GEH A;  1JRA A;  4FRB A;  1FXO A;  4D48 A;  5DDT A;  4G78 A;  1LL0 A;  3V8Z A;  3M15 A;  4JCZ A;  2C04 A;  5BQG A;  3O10 A;  3I0L A;  3AG1 C;  4HEA J;  1PZY B;  1ZHZ A;  1QLE C;  3MLG A;  3QVY A;  2QTV A;  4MND A;  2YWA A;  1FMV A;  5JRA A;  2D7I A;  4EVW A;  5C4D A;  2AVK A;  2R7S A;  2ZU9 A;  4NAL A;  1WAS A;  3SXK A;  4E1K A;  4Q4Z F;  2YCM A;  1CGM E;  2R7W A;  3SXB A;  4CJB A;  4CSA C;  4EEO A;  3I0G A;  1RKE B;  5DVW A;  3DM5 A;  1INI A;  4ZLD A;  3IPM O;  4E7Z A;  2UX8 A;  4BEM J;  2L6H A;  2IOQ A;  2HZ8 A;  1CPR A;  3NYJ A;  3L0I A;  1JV3 A;  5JVE A;  4J32 B;  1LKX A;  3DE9 A;  3RFY A;  5DQT A;  2APC A;  4Z9I A;  3V91 A;  3HNJ A;  1HJL A;  3U2L A;  3U9J A;  1VTM P;  5CMF X;  5FZT A;  1JV1 A;  4NAK A;  2P73 A;  2X51 A;  4C3E A;  2MHR A;  4J7T A;  4IRQ A;  2YQS A;  3K66 A;  4C3D A;  2NPU A;  3LLK A;  4IAQ A;  4ONS A;  1R7V A;  2H7O A;  2IBF A;  1FWY A;  3LJB A;  1H5S C;  1A7D A;  4AE4 A;  5DS6 A;  5KYW B;  1J8Y F;  2IXM A;  2P7V A;  1H4D A;  1ORS C;  4P02 A;  1QZX A;  3LW6 A;  4U5F E;  3FOP A;  3W8I A;  4MIX A;  4IWB A;  3B0P A;  5DQZ A;  2H8A A;  2BL2 A;  2LD6 A;  4EE5 A;  1I5N A;  4U5D E;  3Q80 A;  1FFH A;  1U0B B;  2GA0 A;  1NKH B;  2Y69 C;  5L0J A;  3IEE A;  4KC9 A;  1GA8 A;  4Q7C A;  1ZCU A;  2D7R A;  1MP4 A;  4M28 A;  2X65 A;  1J8M F;  4LLE A;  3HNI A;  3C63 A;  2NG1 A;  1F1M A;  2GFH A;  4DE7 A;  1TKN A;  1ZI4 A;  2R03 A;  3DI5 A;  3JRT A;  3RW0 A;  2I7B A;  2OI5 A;  1VZU A;  1ZIZ A;  3EG9 A;  2YL0 A;  1ZZP A;  4XLP F;  4KI2 A;  2NUP A;  1E85 A;  1JVG A;  5C49 A;  1ZI5 A;  5FUH A;  1IW7 F;  3VRC A;  1FR0 A;  3SYN A;  3H65 A;  2OEF A;  2L6F A;  2XS8 A;  5CI9 A;  1D0Z A;  2E87 A;  1ZHT A;  1OKK D;  2KNH A;  3K33 A;  4NC3 A;  2FY7 A;  3KKB A;  1M57 C;  2W0V A;  3LES A;  4G3P A;  2PX0 A;  3SXZ A;  4C7O A;  3ZGF A;  4HO8 A;  4U5H A;  1OKK A;  2LFD A;  2OI7 A;  4RD9 A;  4I44 A;  4KPZ A;  2PNO A;  3GAN A;  3EHN A;  1LVW A;  3UNG C;  2RIT A;  5C47 A;  2QNL A;  1M2V A;  1PD1 A;  4JE9 A;  3ZVR A;  1H5R A;  2H7V C;  2NXV A;  2C0N A;  4MTO A;  1ZCV A;  1YYJ A;  2FYA A;  3SXC A;  1W2W A;  5F5H A;  2UUI A;  4RBN A;  2O1F A;  4AC3 A;  1H7E A;  4XQ1 A;  5A6B D;  1QG8 A;  3R7C A;  1JPN A;  4ULW A;  2ZXR A;  2A69 F;  5TJ5 E;  5A6B A;  1NU9 C;  2L6G A;  1INJ A;  5FTV A;  1VGZ A;  3D98 A;  3DWW A;  1L3P A;  4JTC B;  4DVY P;  4JRZ A;  5CQN X;  2ICW G;  3EPV A;  3LEO A;  4G0H A;  2WGZ A;  3LNM B;  4C2S A;  2YEV A;  3KYJ A;  3JT1 A;  4IGG A;  2W4M A;  2Y3D A;  5L0C A;  1WT3 A;  3D8V A;  4FQW A;  1XZP A;  1S05 A;  2A6E F;  3I0F A;  4LDQ A;  4Z9H A;  3I0C A;  2L81 A;  3NKD A;  4CDV A;  1MMG A;  1GM5 A;  1D0Y A;  1H7L A;  4FX5 A;  1T9K A;  2QKX A;  4IRP A;  1Z63 A;  2XLM A;  1QWJ A;  2VFZ A;  2FYC B;  4HO9 A;  1NG1 A;  3TUL A;  2AEC A;  4DXW A;  3T7O A;  2DYS C;  2G62 A;  1JR8 A;  1LZI A;  4FRM A;  2LP4 A;  1SZI A;  2HJ3 A;  3OA1 A;  2OCC C;  2M4E A;  1O7O A;  3IOH A;  1M6T A;  3EGD A;  3V0N A;  1BZ4 A;  3Q7G A;  4Y9X A;  4DRH B;  4O79 A;  1GS9 A;  1EKY A;  2RJ6 A;  5CMH A;  5A69 A;  2QGI A;  4L6R A;  3ZSU A;  1G95 A;  4MW3 A;  4AX2 A;  3DKA A;  3DJN B;  1NF5 B;  1A7E A;  2XWL A;  4B2W A;  3O55 A;  3WAQ A;  1W57 A;  3B71 A;  4KRV A;  1U6H A;  5E2Q A;  3ZLK A;  3POL A;  4XLN F;  2J46 A;  2CW0 F;  5A6J A;  3OGZ A;  1JYL A;  2XM4 A;  3NDB B;  1G2V A;  5L0G A;  3N24 A;  3C7J A;  3X1O A;  1R81 A;  2KC3 A;  4MTG A;  5DS5 A;  4JVS A;  1A41 A;  4LAC B;  2AM3 A;  2JCO A;  3R2P A;  3GOD A;  2WZL A;  3ZWI A;  2XRH A;  1VGT A;  3V90 A;  4PK4 A;  1VH3 A;  1OR2 A;  5CQO A;  1YP2 A;  4CDA A;  1VIC A;  3SNH A;  2KSF A;  4LDK A;  2F22 A;  4OIN F;  5JT4 A;  2P72 A;  2RJ5 A;  2AP3 A;  3GM1 A;  4R32 A;  4BQH A;  4PJN A;  3EJN A;  1LVK A;  3RSB A;  4D0T A;  4CS9 C;  3T6B A;  2W9Y A;  1B68 A;  3CAX A;  3GEI A;  4QI0 A;  4JW1 A;  4QI2 A;  1ZJ2 A;  4JIS A;  4HCQ A;  4B3U A;  4ANJ A;  1QSP A;  1H5S B;  2BO8 A;  3ABL C;  5T1D B;  1GQC A;  1G4U S;  4U5C E;  3RYL A;  4NCQ A;  3V0Q A;  1R7Y A;  3I5P A;  4W8P A;  4B4B A;  2XSE A;  2IXO A;  5GPG B;  2R7O A;  3VM6 A;  1RKE A;  2A1D D;  4NAN A;  3U5S A;  1OR3 A;  4FRD A;  1L7C A;  1FR9 A;  2J0X A;  3OKR A;  1YA9 A;  2ZU8 A;  2UUH A;  5CMJ A;  2Z15 A;  1H5T A;  1LI5 A;  2XLH A;  4YN0 B;  1D1A A;  3MBG A;  2VH3 A;  2I8B A;  2W45 A;  2WVM A;  2HMZ A;  4D11 A;  1G3L A;  1HM0 A;  3FAJ A;  1HY5 A;  1O0R A;  1TWA A;  2OI6 A;  3CKJ A;  1HE1 A;  2B0H A;  3G50 A;  1H4C A;  2D0J A;  5AC5 A;  3C62 A;  2FFU A;  2GGQ A;  3U8V A;  2OEV A;  2VB6 A;  3JUK A;  3GM3 A;  3DM9 B;  1ZJ0 A;  5AJO A;  3OAM A;  2HV6 A;  5C1G A;  4K0D A;  2GDC A;  4CIP A;  1K4V A;  5COM A;  4B4M A;  4OIP F;  2HV7 A;  4B2X A;  3CSK A;  3CKO A;  3SX7 A;  5KYX B;  4I1O B;  2AE7 A;  5EHH A;  1FR8 A;  3KPH A;  1ZHY A;  4DDZ A;  3HNL A;  3SXD A;  3GUE A;  4BEJ A;  5FV9 A;  1YRO B;  3M79 A;  2O9X A;  1K05 A;  3FAP B;  1G23 A;  3F47 A;  1AUE A;  1TVY A;  3ZG1 A;  3SEO A;  4JIO A;  4D4N A;  3AJM A;  2Q9C A;  5L6S A;  4XPX A;  2YC3 A;  2AU5 A;  4BJ6 C;  2FFH A;  2HSQ A;  2P1A A;  2RIX A;  3W8H A;  4XWI A;  4BJ5 A;  2Q9A A;  1NZE A;  4KNR A;  2LSE A;  4BMA A;  3EFO B;  2QH5 A;  2R7V A;  1NU7 D;  2XLW A;  4WGY A;  4QDL A;  2GGO A;  4HO2 A;  3MFN A;  3F1Y A;  1Z6A A;  4UEG A;  1V54 C;  3V0O A;  1FTS A;  5DS4 A;  4O6N A;  1MP3 A;  1ZJO A;  4FRA A;  3F46 A;  2OOC A;  3PNN A;  4Y7T A;  1LZ0 A;  4DEC A;  3HNK A;  1HV9 A;  4YT4 A;  2PP4 A;  1U89 A;  3N2Z B;  1O87 A;  3PMR A;  2AES A;  4JEA A;  4G7H F;  2BO7 A;  1VZT A;  4G87 A;  1A0B A;  2EIM C;  5C36 A;  3NYL A;  1TZF A;  1WGW A;  3EZH A;  2EPM X;  1VM8 A;  5DDV A;  1O3U A;  1JVD A;  4NAI A;  1JAF A;  2MZB A;  1RCP A;  1MND A;  5L3V A;  3A9C A;  4IJJ A;  2VS4 A;  3ZTM A;  1MMD A;  2L9J A;  3DXJ F;  1Z90 A;  3VAY A;  1G8X A;  2RJ9 A;  4JD0 A;  4CJC A;  4FRH A;  3CU0 A;  2J8W A;  3BRK X;  5BXC A;  4NQF A;  4CS8 A;  2XLO A;  2ICY A;  1FG5 N;  4CIH A;  1H5T B;  2A8U A;  3Q6M A;  3LS1 A;  1O7Q A;  4XEF A;  3RKO F;  1BDJ B;  4JEB A;  2AH9 A;  1ON6 A;  2J0A A;  3RVY A;  4U5B E;  3TOL A;  5FU0 A;  4MS2 A;  1OMX A;  2DB4 A;  1R7X A;  4PAC A;  3R2W A;  3PCV A;  2VSI A;  2VCB A;  2DI3 A;  3NMJ A;  1K40 A;  1ZW3 A;  2Y4K A;  3V5Z A;  1CPQ A;  1VB5 A;  3NKE A;  3JCU Q;  5B3I A;  3JSE O;  3DK5 A;  4AL0 A;  3DMD A;  3I0I X;  4EEM A;  3S28 A;  4JKV A;  4BJT A;  3RMW A;  2PX3 A;  4YWQ A;  3LS0 A;  4KNW A;  2IYL D;  3DE8 A;  4Y63 A;  2Q4J A;  2OJE D;  5CMI A;  2Q7R A;  5COG A;  1SS9 A;  4FIX A;  3OEO A;  1T6I A;  5EGY A;  2I5E A;  1E5K A;  1Q0D A;  2JPU A;  1WSZ A;  3RIP A;  3TQO A;  3UR3 C;  4E0H A;  2IXP A;  4EHP A;  3LLI A;  3LEV A;  4PFO A;  2VS3 A;  1YA7 O;  2WVO A;  4P6I C;  3GM2 A;  4N6C A;  4CDY A;  3SXA A;  2WZG A;  3T4R A;  2ZXO A;  3I0J A;  1EYR A;  3RH3 A;  1DOV A;  3U3B A;  1OCR C;  3NMI A;  4EEG A;  2V3C C;  3FDQ A;  3CEX A;  2LK4 A;  4MVO A;  2YLD A;  4KC2 A;  3TZT A;  2KQ9 A;  1MP5 A;  4LLC A;  1T5O A;  1MQV A;  3H2V A;  3BEH A;  1MC3 A;  1LE4 A;  4C3B A;  4HG6 A;  5L6V A;  4CSA A;  3K1I C;  4MVQ A;  5L0H A;  1H7T A;  3MX3 A;  1JOG A;  2VAS A;  3HKK A;  2J7P A;  4MW8 A;  3SX3 A;  1Q0G A;  3DAF A;  2WVK A;  1O23 B;  1LZJ A;  2JD3 A;  4CX9 A;  2E8B A;  4Y64 A;  4XPY A;  5C4F A;  1H5S D;  3NGW A;  2ICX A;  5C3B A;  4MVM A;  4EBK A;  4M2A A;  2V0I A;  4HOC A;  2Q00 A;  3T9O A;  4EKW A;  3KMI A;  1GX4 A;  3GEH A;  1H5S A;  4CBE A;  2PGV A;  2J0W A;  2PBE A;  1GWW A;  4Y6N A;  2W0W A;  3PHF 2;  2D5R B;  1NFN A;  2I5K A;  5I1F A;  3C18 A;  4MTF A;  1XZ6 A;  4XWJ A;  1UFB A;  2EPK X;  2FGY A;  4J7Y A;  4FRL A;  1ZYR F;  2RSE B;  3SX8 A;  2VXM A;  3LAY A;  2XL6 A;  4JZA A;  5B1A C;  1ZU4 A;  3GWL A;  1VOM A;  2MWQ A;  2HJM A;  4R7P A;  2VD4 A;  4EBB A;  3ABK C;  1XHB A;  5AC4 A;  2P6V A;  2HFI A;  2OKU A;  1T01 A;  3U2U A;  1LM3 B;  4KBL A;  4U5E E;  5EIY A;  5L3Q A;  1H7H A;  3GEE A;  1Z23 A;  3U2M A;  2J0B A;  4LW6 A;  3JTJ A;  3FOO A;  3OC9 A;  3T6G B;  3V7O A;  4ZDQ A;  2XL4 A;  3N0T A;  4Y6U A;  1OXB A;  3T7N A;  2X60 A;  2G3V A;  1EZI A;  2ZU7 A;  4ECM A;  3ABM C;  2IM8 A;  1ZCY A;  4P00 A;  2WL8 A;  1YAU O;  5KYX A;  1QKR A;  2JCK A;  2WE9 A;  1VZX A;  1ORY A;  5JSL A;  3R3I A;  1TW5 A;  4CS7 A;  4XEV A;  2XLV A;  5FCL A;  2RJ1 A;  4LW3 A;  3X2Q C;  1ZHW A;  1OW6 A;  3GOR A;  3EH2 A;  2Y4M A;  4DRI B;  2VSH A;  3DZA A;  5CQM X;  2Y4J A;  1OCO C;  3O3P A;  4DOZ A;  3DAG A;  4J30 B;  2GAQ A;  1VPA A;  5EK0 A;  3ZDL A;  4I1M A;  3WG7 C;  5C4C A;  3USQ A;  2CU2 A;  2J9U A;  1CGO A;  3EFO A;  2VC9 A;  2CCY A;  1GQA A;  5T3T A;  3PDM P;  2YQC A;  1JMW A;  4O6M A;  2WEE A;  3E26 A;  5AJP A;  3JYY A;  1G97 A;  2Y3B A;  4F4B A;  5COF A;  5EJ1 A;  3I5Q A;  3HLZ A;  1VGU A;  3T7M A;  2XS1 A;  2R7Q A;  3EH1 A;  3WHN A;  3U0X A;  1OMZ A;  2BO6 A;  4GQH A;  4WAB A;  2Q9B A;  1M56 C;  4U9E A;  1V74 B;  1ORJ A;  3CQZ A;  1E86 A;  4NTF A;  2OQM A;  3EGX B;  4M2B A;  2Y3G A;  1FRW A;  3V5Y A;  2Y3H A;  4FAP B;  2D4U A;  3JYH A;  4MVZ A;  5BQI A;  2JX0 A;  2O1G A;  1Y4C A;  1V82 A;  1LIH A;  1R4T A;  4HO5 A;  2FYB A;  5C1L A;  1C02 A;  3O39 A;  4MVS A;  4D0Z A;  4E7S A;  2X0C A;  2YVK A;  1LL2 A;  4FRQ A;  4Q5S F;  3KH2 A;  1H7Q A;  3ST8 A;  4HO4 A;  2R02 A;  1RKC A;  1ZDG A;  3UMH A;  1W55 A;  2W4B A;  4DRJ B;  1G4W R;  3U2X A;  2QE9 A;  3K8D A;  2YLI A;  3F1C A;  1G5Z A;  4G7Z F;  2PX7 A;  3U2T A;  2Q3T A;  3QZC A;  3M1C B;  1V84 A;  1WWP A;  4K6R A;  1S7Z A;  3C8Z A;  5JQQ A;  4O7G A;  5C1H A;  3MYF A;  2XLE A;  4B42 A;  3L8I A;  3RMV A;  1ZI3 A;  3V0L A;  4IRU A;  3LUT B;  4KT7 A;  3N9W A;  3EE5 A;  1LPE A;  3NRH A;  5D92 A;  2KYH A;  3ZTZ A;  2WVN A;  1O5H A;  4GBP A;  1NWG B;  2Y39 A;  1HE9 A;  1ON8 A; 
#chains in the Genus database with same CATH homology
 5IFY A;  1VK5 A;  3EG9 B;  3SZR A;  3UNG C;  2AM5 A;  4CS8 A;  3POV A;  4N06 A;  2RIT A;  2ICY A;  2V0J A;  1FG5 N;  5C47 A;  1ZHX A;  4CIH A;  1H5T B;  2A8U A;  2NUP B;  2WVQ A;  2PF4 E;  3NG1 A;  1LS1 A;  1M2V A;  4M4K A;  1QGQ A;  2WZF A;  1PD1 A;  4W8K A;  3ZVR A;  1H5R A;  2H7V C;  2NXV A;  3Q6M A;  2C0N A;  1I52 A;  1ZCV A;  3LS1 A;  1O7Q A;  2FYA A;  4Y7G A;  3RKO F;  5CI8 A;  1ZI1 A;  3SXC A;  3DD7 A;  1W2W A;  2AH9 A;  5F5H A;  1ON6 A;  3AG3 C;  3I0D A;  5FYE A;  4DBR A;  5F5F A;  2J0A A;  4FIY A;  4RBN A;  3DUV A;  2Z86 A;  2O1F A;  4AC3 A;  1H7E A;  2YES A;  2BE5 F;  4U5B E;  4LER A;  2B0J A;  3K8E A;  4JJG A;  3ZLL A;  4L41 C;  3WOD F;  5FU0 A;  3QVB A;  4PJL A;  4C7O B;  1MMA A;  1OMX A;  1QG8 A;  1R7X A;  2WVL A;  1VYI A;  3R2W A;  2XXA B;  2VSI A;  3QMK A;  4WJ0 A;  1G9R A;  1JPN A;  2Y7A A;  3B9Q A;  4ULW A;  2R7T A;  2ZXR A;  2A69 F;  2Y4K A;  3NKE A;  1NU9 C;  1INJ A;  5FTV A;  3JCU Q;  5E3C A;  1SF8 A;  3VYW A;  1VGZ A;  3D98 A;  3DK5 A;  3DMD A;  3I0I X;  1D0X A;  4EEM A;  1ZHJ A;  4BJ5 C;  3OH2 A;  1FOA A;  3S28 A;  2R7R A;  1W77 A;  3EQL F;  4BJT A;  4HFF B;  3W2V A;  3Q4S A;  4Y7U A;  5C8R A;  4CS9 A;  1M2V B;  4DVY P;  3RMW A;  2PX3 A;  4YWQ A;  4Y7V A;  3LS0 A;  4KNW A;  3B0V C;  2IYL D;  4Y63 A;  1H5R B;  3SX5 A;  3Q7L A;  5CQN X;  4X0R A;  2E3D A;  3AQB A;  3EPV A;  2Q4J A;  1VGW A;  5CMI A;  4G0H A;  4JUR I;  1SS9 A;  2WGZ A;  3K7D A;  4FIX A;  3OEO A;  3U0Y A;  3OH3 A;  2AGD A;  2ZXP A;  5EGY A;  4C2S A;  2YEV A;  3ECS A;  3JT1 A;  2RJ7 A;  2W4M A;  2I5E A;  4DBQ A;  1G0R A;  2Y3D A;  1WT3 A;  3D8V A;  3SXG A;  4B6I A;  1E5K A;  4FQW A;  1S4N A;  1FXJ A;  4KXO A;  1WSZ A;  3RIP A;  4AYJ A;  3W2W A;  3UR3 C;  2A6E F;  2IXP A;  3I0F A;  3I0C A;  1R82 A;  3LLI A;  1TWH A;  2L81 A;  3NKD A;  1MMG A;  5AJN A;  2H7B A;  3LEV A;  4PFO A;  2VS3 A;  1D0Y A;  1H7L A;  2VS5 A;  1H7G A;  2WVO A;  4P6I C;  2QY9 A;  4FX5 A;  1WT1 A;  1BR1 A;  3AG4 C;  2QKX A;  4IRP A;  3FHD A;  2VXL A;  1Z63 A;  1FGG A;  1QWJ A;  2EIJ C;  2VFZ A;  4G7O F;  2KW3 C;  1FZW A;  3DJ4 A;  5BUO A;  3SXA A;  2FYC B;  4HO9 A;  1S4O A;  2XME A;  2WZG A;  3T4R A;  4M63 A;  1R7U A;  1ZDF A;  2RIZ A;  4JJF A;  2ZXO A;  1NG1 A;  1IZM A;  3NYM A;  1EYR A;  1PZT A;  3I4U A;  3UGO A;  3RH3 A;  3I0J A;  4HO0 A;  1PCX A;  3HL3 A;  1TR2 A;  4YT2 A;  5KYY A;  1OCR C;  1SMY F;  4RDA A;  4BG0 A;  2AEC A;  4EEG A;  2V3C C;  2A6H F;  3DJU B;  3FDQ A;  3SXE A;  2YC5 A;  3T7O A;  4YT8 A;  2DYS C;  3UMI A;  4Y62 A;  1G8O A;  2G62 A;  1LZI A;  4FRM A;  4MYB A;  1SZI A;  2IXN A;  4KC2 A;  1OCZ C;  3TZT A;  3OA1 A;  2KQ9 A;  4HO6 A;  1MP5 A;  2A68 F;  2OCC C;  2DYR C;  3OWT A;  4LLC A;  1WT2 A;  3E25 A;  4G3S A;  2KGO A;  2V0H A;  4KC1 A;  2M4E A;  2ZXW C;  1ZJ3 A;  1MC3 A;  1O7O A;  1OCC C;  3IOH A;  4C3B A;  1ZU5 A;  1IIM A;  4HG6 A;  5L6V A;  3EGD A;  3V0N A;  4CSA A;  3I0K A;  4JCH A;  2WAW A;  3Q7G A;  3K1I C;  4H4K C;  2YHS A;  3CKV A;  1NMM B;  3OH0 A;  2VK9 A;  1FGX A;  3JSZ A;  4Y9X A;  1WVC A;  5KYU A;  1PD0 A;  4O79 A;  1H7T A;  3MX3 A;  2KJG A;  3ZIB A;  1GQ9 A;  3ZC4 A;  3TQD A;  2OG2 A;  2VAS A;  2RJ6 A;  5CMH A;  2P6W A;  5CQP A;  2QGI A;  2J7P A;  3HTK C;  1H3M A;  4A2N B;  3SX3 A;  2FFV A;  4CJ8 A;  3ZSU A;  3DAF A;  5KYY B;  5D91 A;  1G95 A;  2RJ4 A;  2WVK A;  1Z3I X;  3T6J A;  5IDT A;  4AX2 A;  1O23 B;  5KYW A;  1LZJ A;  5C4E A;  3DJN B;  4O6Y A;  1VH1 A;  4Y7F A;  2EIN C;  4ASY A;  1NF5 B;  4FCE A;  3AG2 C;  3ITF A;  1H7F A;  2Y6P A;  2JD3 A;  4CS8 C;  2E8B A;  2XWL A;  4Y64 A;  2V0K A;  4B2W A;  3IOI A;  3OH4 A;  5C4F A;  1W57 A;  1H5S D;  3NGW A;  4KRV A;  2CGE A;  2ICX A;  4KPX A;  5C3B A;  1ZJ1 A;  1HM8 A;  3S27 A;  3ASO C;  3CGX A;  5CMG X;  5E2Q A;  3ZLK A;  4M2A A;  2A8W A;  3POL A;  4XLN F;  2J46 A;  2CW0 F;  2V0I A;  4HOC A;  4PFP A;  1H4E A;  1ZJP A;  3USR A;  4U5G A;  2XWM A;  4OD4 A;  3IOJ A;  3EGD B;  1JYL A;  3OGZ A;  1MNE A;  3NDB B;  4PJM A;  3B0U X;  1G2V A;  3KMI A;  5E3A A;  1GX4 A;  3Q7U A;  4BJ6 A;  5C3D A;  3N24 A;  1H5S A;  4CBE A;  3X1O A;  1R81 A;  2PGV A;  2J0W A;  1GWV A;  3I0H A;  1GWW A;  4Y6N A;  1VMA A;  5DS5 A;  4OIO F;  2EIK C;  5KYU B;  2D5R B;  4JVS A;  3PHF 2;  2DGJ A;  2J9V A;  2W0W A;  3V8Y A;  3V0P A;  1S4P A;  4EE4 A;  2AM3 A;  4LAC B;  2JCO A;  3V0M A;  4G3Q A;  2JCL A;  1D1B A;  2OEG A;  2I5K A;  4BJ1 A;  3GOD A;  2WZL A;  2C03 A;  2CDQ A;  1KU2 A;  2XRH A;  5I1F A;  1TWG A;  1VGT A;  2YQH A;  3D5N A;  4FWV A;  3ZF8 A;  1WT0 A;  1NQI B;  4KC4 A;  4EE3 A;  1XZ6 A;  4HE8 D;  1R7T A;  3PKP A;  3V90 A;  4PK4 A;  1VH3 A;  3ASN C;  3EZI A;  5CQO A;  1YP2 A;  1VIC A;  3L34 A;  3SNH A;  2V0L A;  5FTS A;  4XWJ A;  4OIN F;  2FGY A;  4FRL A;  1FFT C;  1ZYR F;  2P72 A;  4KQL A;  5B1B C;  2PFD A;  1LL3 A;  2RJ5 A;  3SX8 A;  5HSW A;  3LAY A;  2VXM A;  1ZCT A;  1G93 A;  4BQH A;  4PJN A;  3EJN A;  4JZA A;  1LVK A;  4AK9 A;  1NHE B;  4PJJ A;  4FRO A;  3RSB A;  4D0T A;  4CS9 C;  3CZ6 A;  3T6B A;  5B1A C;  2W9Y A;  1ZU4 A;  1BR4 A;  1VOM A;  2MWQ A;  2X5S A;  4QI0 A;  5T3W A;  4AAW A;  4JW1 A;  2V26 A;  4CVH A;  4QI2 A;  1ZJ2 A;  1R80 A;  4R7P A;  3FVY A;  2VD4 A;  4JIS A;  4EBB A;  3ABK C;  3EHM A;  1XHB A;  4HCQ A;  2P6V A;  2R7X A;  4B3U A;  1D1C A;  3K1H A;  3U2U A;  1V55 C;  1OQM B;  1FMW A;  2CNW D;  4ANJ A;  1M2O A;  3HJC A;  4XTK A;  1H5S B;  2BO8 A;  4ARW A;  3ABL C;  5T1D B;  5IDS A;  1ST6 A;  1GQC A;  2NUT A;  4KBL A;  1TW1 A;  4U5C E;  4U5E E;  5EIY A;  5L3Q A;  5HS2 A;  3E9V A;  1RJ9 A;  3RYL A;  1H7H A;  4KNV A;  1Z23 A;  2JCJ A;  2RIY A;  3FWW A;  4KNX A;  3E70 C;  4NY3 A;  1R7Y A;  3I5P A;  2J0B A;  3V0Q A;  2XSE A;  4LW6 A;  1JPJ A;  4B4B A;  2FYD B;  3JTJ A;  5C48 A;  2IXO A;  4GEH A;  3OC9 A;  3V7O A;  4FRB A;  2R7O A;  4ZDQ A;  1JYK A;  1FO8 A;  2CNW A;  1FXO A;  2A1D D;  2XL4 A;  5C3A A;  4D48 A;  5DDT A;  1LL0 A;  3N0T A;  4Y6U A;  3T7N A;  4NAN A;  3V8Z A;  2X60 A;  2G3V A;  1EZI A;  2ZU7 A;  4FRD A;  4FRP A;  4ECM A;  3ABM C;  1ZCY A;  4P00 A;  1FR9 A;  2WL8 A;  2C04 A;  3LNR A;  2J0X A;  3OKR A;  2XMH A;  3I0L A;  3AG1 C;  2ZU8 A;  5CMJ A;  5KYN A;  4HEA J;  5KYX A;  3I0E A;  1PZY B;  2JCK A;  1ZHZ A;  2WE9 A;  1VZX A;  2Z15 A;  4HO3 A;  1H5T A;  1QLE C;  3MLG A;  4MND A;  1D1A A;  2QTV A;  4YN0 B;  3R3I A;  3U2W A;  1TW5 A;  1FMV A;  4CS7 A;  2VH3 A;  2I8B A;  2W45 A;  2WVM A;  2J7P D;  5FCL A;  2D7I A;  4YS8 A;  2RJ1 A;  4D11 A;  4LW3 A;  4EEA A;  3X2Q C;  1ZHW A;  1G3L A;  1HM0 A;  2Z87 A;  3FAJ A;  4YT5 A;  1O0R A;  3EH2 A;  1HJJ A;  4EVW A;  5C4D A;  2Y4M A;  1TWA A;  2R7S A;  2OI6 A;  2ZU9 A;  2VSH A;  5C38 A;  4EWC A;  3DZA A;  3CKJ A;  4NAL A;  5CQM X;  5FU8 A;  2Y4J A;  2NUT B;  1H4C A;  4E1K A;  4I3M A;  4Q4Z F;  2D0J A;  1OCO C;  2YCM A;  3O3P A;  4DOZ A;  4B5B A;  2R7W A;  2FFU A;  2GGQ A;  3SXB A;  3DAG A;  3Q6N A;  4J30 B;  4CJB A;  4CSA C;  2VB6 A;  1VPA A;  1GX0 A;  3JUK A;  4I1M A;  3WG7 C;  4EEO A;  3I0G A;  2J9W A;  5C4C A;  5DVW A;  3FOQ A;  3DM9 B;  3DM5 A;  1ZJ0 A;  2AM4 A;  2CU2 A;  2XWN A;  5AJO A;  3USQ A;  2XXA A;  1INI A;  1BR2 A;  4ZLD A;  2HV6 A;  3AQC A;  3OAM A;  3O6X A;  2J9U A;  4E7Z A;  4K0D A;  3UGP A;  2UX8 A;  5C1G A;  4B4G A;  4DE7 A;  2IOQ A;  3EGX A;  3EFO A;  3S0X A;  4OIQ F;  2YZS A;  1K4V A;  4ASJ A;  5T3T A;  3NYJ A;  4B4M A;  4OIP F;  3BCV A;  2HV7 A;  2YQC A;  4B2X A;  3L0I A;  4GYT A;  1JV3 A;  3CSK A;  2MYS A;  4J32 B;  4O6M A;  2WEE A;  3CKO A;  3E26 A;  5KYX B;  2PGY A;  5AJP A;  1LKX A;  3SX7 A;  4I1O B;  1G97 A;  2AE7 A;  5EHH A;  1FR8 A;  3RFY A;  5EJZ A;  1ZHY A;  2Y3B A;  4F4B A;  4DDZ A;  3S29 A;  3SXD A;  5EJ1 A;  3GUE A;  5DQT A;  1HM9 A;  4BEJ A;  3I5Q A;  3HLZ A;  1YRO B;  2APC A;  2DPW A;  3V91 A;  5FV9 A;  1HJL A;  1VGU A;  2RJ8 A;  3T7M A;  2O9X A;  3CKN A;  2O1H A;  2R7Q A;  1G23 A;  3EH1 A;  3F47 A;  5CMF X;  1JV1 A;  1TVY A;  4AYL A;  4NAK A;  3U0X A;  2P73 A;  3ZG1 A;  2X51 A;  1OMZ A;  3SEO A;  2BO6 A;  4C3E A;  4IRQ A;  2YQS A;  4IAO A;  3K66 A;  4C3D A;  2Q9C A;  5L6S A;  2YC3 A;  1N1C A;  3LLK A;  1R7V A;  2H7O A;  2Q9B A;  4BJ6 C;  2FFH A;  3LJB A;  1M56 C;  1FWY A;  1H5S C;  1YP3 A;  3CKQ A;  2RIX A;  3W8H A;  3CQZ A;  2J45 A;  4AE4 A;  4ZLC A;  4BJ5 A;  2ZPA A;  5B3S C;  2Q9A A;  5DS6 A;  5KYW B;  4XWI A;  1J8Y F;  1NZE A;  2IXM A;  2P7V A;  2LSE A;  1H4D A;  4KNR A;  4P02 A;  1QZX A;  4K7B A;  3LW6 A;  4BMA A;  4U5F E;  3EGX B;  1FO9 A;  4M2B A;  3EFO B;  2Y3G A;  3W8I A;  1FRW A;  4MIX A;  2QH5 A;  4IWB A;  3B0P A;  2Y3H A;  5DQZ A;  4FRE A;  3PKQ A;  3KL4 A;  4FCU A;  3JYH A;  4EE5 A;  4U5D E;  1NU7 D;  2R7V A;  3Q80 A;  1FFH A;  5C1L A;  4QDL A;  2GGO A;  1MMN A;  2Y4L A;  3U2V A;  2O1G A;  1V82 A;  4HO2 A;  3F1Y A;  1Z6A A;  4UEG A;  1V54 C;  3V0O A;  1NKH B;  1FTS A;  2Y69 C;  4HO5 A;  2YQJ A;  5DS4 A;  4O6N A;  2FYB A;  3K6B A;  4J18 A;  3IEE A;  1MP3 A;  4KC9 A;  3TD7 A;  1GA8 A;  3F46 A;  1ZJO A;  4Q7C A;  2X5Z A;  4FRA A;  1ZCU A;  2D7R A;  3SPT A;  3SP1 A;  1MP4 A;  1VYK A;  3PNN A;  4Y7T A;  3O39 A;  4M28 A;  5J49 A;  4HFK B;  2X65 A;  4D0Z A;  1J8M F;  4LLE A;  4E7S A;  1LZ0 A;  4YJW A;  4DEC A;  1LL2 A;  4OIR F;  1HV9 A;  5DLJ A;  4FRQ A;  2NG1 A;  4Q5S F;  3KH2 A;  4YT4 A;  2PA4 A;  2PP4 A;  1H7Q A;  1KWS A;  3ST8 A;  4HO4 A;  3N2Z B;  2GFH A;  1O87 A;  1LZ7 A;  1ZDG A;  3PMR A;  1V83 A;  4AE4 B;  3UMH A;  1Z5Z A;  1IIN A;  1W55 A;  4G7H F;  2AES A;  2W4B A;  2BO7 A;  1VZT A;  1TKN A;  3ZGG A;  4G87 A;  2EIM C;  1ZI4 A;  5C4B A;  3JRT A;  3NYL A;  1TZF A;  2I7B A;  3U2X A;  1WGW A;  3K8D A;  3EZH A;  4MQ9 F;  2OI5 A;  1VZU A;  3F1C A;  1ZIZ A;  3EG9 A;  1VM8 A;  4OD5 A;  5DDV A;  4G7Z F;  2PX7 A;  3U2T A;  2G3K A;  2Q3T A;  4XLP F;  5C36 A;  4DVZ A;  2RJ0 A;  1JVD A;  4NAI A;  3QZC A;  4KI2 A;  2NUP A;  3JUJ A;  3M1C B;  1V84 A;  1JVG A;  5C49 A;  1ZI5 A;  3OH1 A;  5FUH A;  2MZB A;  1IW7 F;  4K6R A;  1MND A;  1S7Z A;  3SYN A;  1G1L A;  3H65 A;  5L3V A;  2OEF A;  2WB7 A;  5E33 A;  2EIL C;  4IJJ A;  5CI9 A;  2VS4 A;  1D0Z A;  1MMD A;  2E87 A;  5JQQ A;  1ZHT A;  1OKK D;  4O7G A;  2L9J A;  5C1H A;  2KNH A;  4B42 A;  3K33 A;  4FES A;  5CQL X;  3RMV A;  1ZI3 A;  3DXJ F;  1Z90 A;  1RJ9 B;  3VAY A;  1G8X A;  2FY7 A;  1TWC A;  2RJ9 A;  3KKB A;  1M57 C;  1QGS A;  4IRU A;  3LES A;  2W0V A;  4JD0 A;  3V0L A;  4KT7 A;  4CJC A;  4FRH A;  4D11 C;  3UMK A;  4G3P A;  2PX0 A;  3N9W A;  4C7O A;  3EE5 A;  3ZGF A;  3CU0 A;  4HO8 A;  4U5H A;  1OKK A;  3NRH A;  5D92 A;  5IY5 C;  2WVN A;  4RD9 A;  2OI7 A;  1O5H A;  2BO4 A;  4GBP A;  1NWG B;  4I44 A;  4KPZ A;  1YP4 A;  3BRK X;  2R7U A;  3GAN A;  2Y39 A;  3KIA A;  5BXC A;  3EHN A;  1LVW A;  1ON8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...