5D92A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
340
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 107
structure length 340
sequence length 342
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d92A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d92A01
4O6MA 5D92A 4O6NA 4MNDA 5D91A 4Q7CA
chains in the Genus database with same CATH superfamily
4XLNF 3C8GA 1S4NA 4IGGA 4EBKA 2PBEA 3VM6A 1V82A 4IRUA 4E17A 2W4BA 3Q7LA 2Y69C 4FRHA 1G23A 2L6FA 2VSIA 5KYWB 4EWCA 2FYAA 1Y4CA 3UGPA 2WVOA 4FRDA 5C4EA 1WN0A 2VD4A 1FO8A 3ZTMA 4B6IA 5CMGX 4U5DE 1PV3A 3S90A 5BXCA 2KGOA 4EE5A 3V0NA 4NTAA 4U5FE 3CZ6A 4N06A 4FIYA 5T3WA 1GM5A 2IOQA 2YZSA 3I0EA 3HNJA 2YRFA 5JLIA 1OXBA 3LEOA 2L9JA 4O7GA 5CI8A 2AM3A 1W57A 4BJTA 5C8RA 3CKOA 1SYQA 3E70C 3EGXB 3JUJA 2P61A 5DDVA 3L1MA 3OH2A 3OH1A 1EA8A 1S7ZA 2RJ4A 4HO6A 3DUVA 4F4BA 2Z86A 4LW6A 1D1BA 1K40A 1FRWA 2YL7A 1QVXA 1T01A 5C49A 3MX3A 1YZAA 3ZG1A 2FAPB 1A41A 3R7CA 2DGJA 1WT0A 4MIXA 4JC7A 4B2WA 2E8BA 2XL6A 1ST6A 5K0IA 3EH2A 3B29A 2IBFA 4XWJA 2OG2A 3E9VA 3IOJA 5CIVA 2Y4JA 4G7HF 1GS9A 2DYRC 1Y6DA 1UFBA 1H5RA 1ZJ0A 2LK4A 4DVYP 1NFOA 2LP4A 5L6SA 3U2WA 1LPEA 4KNWA 1RKEB 1OW8A 3QVZA 4G3QA 2MHRA 4FRAA 4WJ0A 1MQVA 1VZXA 1ZI4A 1ZW2A 2Q9CA 1XZPA 2O9XA 1FG5N 1H5SB 3X1OA 3IQTA 3GWLA 2J9UA 1YP3A 1HJLA 2XL8A 1OCOC 1S4PA 4UEGA 1LZ7A 1AUEA 2I5EA 1PD1A 3F47A 3C8GB 3IOHA 4JVSA 1WVCA 2Q9BA 4HFFB 3DM9B 4G3SA 3OH0A 4EIYA 3QVYA 3BCVA 2YQCA 3EZIA 3SX7A 2R7TA 2F22A 2OCCC 2A6EF 3C8GD 1BR2A 3JT1A 3NRHA 4O6MA 1TWGA 1VH3A 1V4AA 4C2SA 3EHNA 1WT1A 3V0QA 3DE9A 5AJNA 3WODF 1MP4A 1TKNA 3CU0A 4DBRA 3NGWA 3V90A 3FWWA 2A8WA 3QMKA 4D0ZA 3RF3A 3CAXA 4MVRA 1Z63A 3O55A 2YCMA 1AVOB 2HJMA 1M2VA 3U3BA 2JD3A 3SX8A 4JTAB 4MQ9F 2AM4A 3W8IA 1TWAA 3V8ZA 5C4DA 2IXNA 3F1CA 2XLVA 2XLMA 3ECSA 4CSAA 2R25A 4LDKA 1YYJA 1GX4A 4NANA 4EHPA 2PX3A 2FFUA 1U89A 2XMHA 2NSGA 4C3EA 5EIYA 4DXWA 4Z9IA 1NG1A 3T6JA 5JP7A 3U2XA 1WWPA 2ZXRA 1GQAA 3UMKA 4KC4A 3ZGFA 3KYJA 1INIA 1FMVA 3ZDLA 5IDSA 2D0JA 4MW3A 1H5RB 3RVYA 4OIQF 1R7XA 4G0HA 3M4CA 3TOLA 2I7BA 2ZXOA 5F5HA 1LM3B 4HO0A 2LCHA 2L7AA 4EEGA 2AM5A 3TOMA 5L6VA 3DJNB 5HV9A 4GQHA 4LLEA 2L81A 2DYSC 2Z15A 3V8YA 1GQCA 4MNDA 2VSHA 1Z6AA 2NG1A 3EH1A 3TD7A 1EQ1A 1ZI5A 1NWGB 1UG7A 5C4CA 4KPZA 5B1AC 2G3KA 1FTSA 4WABA 2RJ9A 1YZCA 1ZHWA 2AECA 1DOWA 2WVLA 4U5HA 2R7QA 2NUTA 1V84A 5KYUA 4FRQA 4Q7CA 1ZJ2A 2YQHA 4JTCB 4BMAA 1V74B 4BQHA 3OC9A 2JPUA 3CGXA 2I8BA 1NU9C 1TR2A 4XPXA 3RQFA 2XLHA 3SXYA 2AE7A 3AQBA 2DI3A 2XWLA 4J7TA 4E18A 3H2VA 1YP4A 4Y63A 1H7TA 2M4EA 5COGA 2WVKA 4B2XA 4P6IC 4U5BE 3RQGA 3RVZA 3J06A 1M2VB 3LS1A 1RJ9A 3SXBA 3KL4A 1YLMA 5DS5A 2LSEA 5HSWA 4CIHA 4KBLA 3V0OA 3LUTB 3GORA 2RJ8A 3AG2C 4EEAA 3EPVA 4EUKB 4G78A 3HNLA 4KT7A 2IXPA 1HM0A 1NBBA 4HEAJ 1R4TA 3I0CA 4OIRF 4FRBA 3QW0A 3T6BA 3SXMA 3IOIA 1JPJA 2AWCA 1MNDA 2GDCA 2GAQA 3IQ5A 5BQHA 2L6GA 4E7ZA 1M57C 3U2LA 3POVA 4AYLA 5C3AA 2KQ9A 4Y7FA 1H7HA 2WZFA 4G7ZF 2C04A 2Y4KA 2QGIA 4D4XA 4B4GA 4O79A 2XXAA 1FGGA 4IB4A 1CPRA 3AOUA 1GWWA 3RH3A 2V0HA 4M4KA 1JVGA 4CJ8A 2Q9AA 1H3MA 1M56C 4FESA 3FOOA 4WGZA 4ANJA 5L0GA 2VS4A 2HS5A 1O5HA 4U9DA 4ZLCA 4CBEA 2VS3A 2I5KA 3E25A 1FWYA 3V5XA 3A11A 3BRKX 5FU0A 3SXGA 3U0CA 1WT2A 4NTFA 1H9TA 3GM2A 4BJ1A 1TWHA 2Y3BA 3AJMA 1CGOA 1FR0A 4ULWA 4U5CE 5DVWA 3ST8A 3VF0A 1QWJA 1I4YA 1OKKD 1H7EA 1NLXA 5I1FA 1OCRC 4CDYA 1N1CA 4XPWA 2NUTB 4ASYA 2P6WA 5KYUB 1G95A 3B9QA 4N4WA 4CIPA 2WZLA 1WT3A 3B0PA 1VB5A 1H7FA 4CS9A 5AGFA 4NY3A 5JUAA 2Y39A 4ZLDA 4BG0A 4QI0A 1BBHA 5FV9A 4P00A 2RSEB 3V91A 5D92A 5IFYA 2Y4MA 5AC5A 5BQIA 3TZTA 5C4FA 2HZ8A 3T9OA 2R7RA 1RJ9B 2J7PA 4HO2A 1PD0A 2LFDA 4OIOF 4W8PA 2DPWA 3V0MA 4JW1A 4ER9A 3U3FA 4KNVA 4X0RA 1FFTC 4CJOA 5C47A 3KYIA 4JISA 3FAJA 2QKXA 2A69F 4NTBA 2WVNA 3DMDA 1JAFA 5JS5A 5FTVA 3U2VA 4EE4A 2YWAA 3HL3A 1VLSA 1TFKB 2AESA 1KWSA 3JUKA 1YVIA 5JQQA 1NZEA 4JIOA 4IAOA 4Q5SF 3I4UA 3L8IA 4PACA 1QGQA 4PJMA 2Q3TA 1PCXA 2PX0A 2J0BA 3ZTZA 2VB6A 3I0JA 3ZSUA 4ASJA 4JCZA 4JTDB 4UDVA 2XXAB 1ORSC 1TFOB 3T4RA 1ON8A 1VGTA 2QH5A 3GEIA 2GGQA 3JRMO 3SX5A 5IY5C 1KNYA 5DS6A 1XZQA 4HO3A 4XWIA 4KQLA 2J9BA 1D0YA 1E5KA 3M79A 3K1HA 5CMJA 3FOPA 2OEVA 3PKQA 3HJCA 4A2NB 3MLGA 3SP1A 2FYCB 2Q4FA 4LW3A 4Y7UA 1T9KA 1QZXA 3NYJA 2RIYA 1ZI1A 4FREA 2OOCA 5C1GA 3U5SA 1PZYB 2X5ZA 1ZJPA 4AL0A 3N24A 3LS0A 3Q6MA 2ICYA 3HLZA 3NKEA 4EKWA 2W4MA 4A4AA 2VXLA 4PJNA 3RQEA 4MYBA 2ASRA 1INJA 2AWYA 3JTJA 3S0XA 2R05A 4YK5A 3U9MA 1QKRA 2CCYA 1R82A 2YLDA 4W8KA 1VYIA 1ZCUA 1RKCA 2WZGA 5BQGA 3LW6A 1OCCC 1E86A 3PCVA 3SEOA 4MW8A 2XSEA 1MMDA 2OI5A 4G7OF 1JRAA 1E84A 2EIKC 4FRLA 2B0JA 1JOGA 1K4VA 2H7OA 2ICXA 3V5ZA 3DAFA 1ZVZA 4CS8C 2DB4A 1Q0KA 1B68A 1ZJOA 1J8MF 1G4WR 4Y7GA 4IARA 1HMOA 5EGYA 4FQWA 1OMZA 1R7YA 1XZ6A 2D5RB 2J7PD 5KYXA 3F1YA 4D11C 4BEJA 3SPTA 1APCA 3X2QC 3PNNA 3UR3C 4DE7A 5F28E 3D5NA 2PNOA 1M2OA 2HV6A 2QTVA 4Y62A 4ULVA 1WOLA 3EJNA 3ASNC 3LNMB 1K05A 2AVKA 4HE8D 4YJWA 1DOVA 2YC5A 2EPKX 4Z9HA 4DRJB 1O23B 4JEAA 1ZDGA 1MMGA 2OU6A 3OA1A 4M2BA 1NHEB 1OXKA 5JT4A 2BL2A 2CGEA 4MVSA 2X0CA 2PGYA 4YS8A 3HNKA 1H5SD 1I5NA 1I4ZA 3UMIA 2ETSA 3MYFA 1GGQA 1TW1A 3QTHA 4JEBA 4NALA 3MBGA 3NYMA 3SXKA 1IW7F 5B1BC 1H7GA 3KMIA 4N6HA 1ZHXA 3ZLLA 2BC5A 4FIXA 3GEEA 5E33A 3NMKA 2YLGA 2YQSA 4MVUA 1O7QA 2H8AA 5A69A 1WASA 4M28A 3O39A 2X60A 4DDZA 2LFFA 1K04A 1T5OA 2WEEA 4E7SA 3I5PA 1LKXA 3RIPA 1C03A 2ZXPA 3D98A 3VRCA 1LVKA 2JCOA 2IXMA 5JRAA 2G62A 2C0NA 1E83A 3MYIA 2OI6A 2R7WA 3DAGA 4K6RA 1Q0FA 2IM8A 1CGME 5L0IA 1ZJ3A 3OH4A 2QE9A 1NKHB 2AP3A 2EIMC 4EEOA 5KYXB 2FYDB 2JX0A 4N6CA 2A6HF 3S9OA 1MNEA 3R3IA 4KI2A 3JSZA 1F1MA 1WGWA 1W77A 2H7BA 1HMDA 4XPYA 4KC2A 4Y9XA 3G4XA 3Q7UA 2V26A 4IRQA 2E87A 1H7IA 3DI5A 3ZC4A 2HUJA 5L0JA 4YN0B 3U2MA 4B5BA 2X51A 2HSQA 2YQYA 1LE2A 1C17M 1G93A 1TVYA 1S4OA 3N9WA 3T7OA 4HOCA 3F46A 4LDQA 2LIGA 2GWWA 3DD7A 5T1DB 2HMQA 1KTMA 3I0DA 3RFYA 2A0BA 1HW1A 3SXAA 3M15A 4XTKA 2NSFA 5CMHA 1E85A 1NMMB 5AJPA 5DLJA 2IXOA 1A7VA 4E0IA 2XM0A 4OD5A 2V3CC 4NAKA 4DECA 3E26A 2VC9A 2EIJC 2XLDA 2XWNA 2XLWA 3WG7C 1Q0GA 1MP5A 4DOZA 1FOAA 2R7OA 1VZUA 4OD4A 1YJGA 3JYHA 3UGOA 2W45A 1FFHA 1OCZC 2Y7AA 2V0JA 2HSBA 4BJ5C 1RXQA 2JCKA 2QUPA 5EJZA 4XEVA 5DQZA 2LD6A 5B3SC 5BUOA 3LLIA 2ZU9A 4XEFA 4QDLA 5B3IA 3CKQA 2VS5A 3T6GB 2H7VC 1RCPA 2OEFA 1ZHTA 1GA8A 3POLA 4HO4A 3CKVA 4J7YA 4H54A 1A7DA 2XS8A 3RMVA 1NFNA 2PFDA 2TMVP 2Q4JA 3K1IC 1LZJA 1OW7A 2FFHA 1HE1A 1ZHJA 2BO4A 1I52A 2D7IA 1LVWA 5DDTA 3ZQVA 1R80A 2J0AA 3EFOA 2YEVA 1G3LA 1G4US 1H4DA 1R81A 1MP3A 2A0UA 3USQA 4M63A 1YROB 1OQMB 1R7TA 1H5TA 2RIZA 2ZD9A 1HM8A 4U5GA 4CX9A 3GUEA 2WE9A 2J0XA 3I5QA 4JCHA 4H4KC 2WB7A 2OEGA 2GGOA 3KIAA 1Q0DA 2RJ1A 3I0KA 4HO9A 2P0NA 4BJ6C 2XLEA 3GANA 2D7RA 1HW2A 4L41C 3G50A 1JV3A 5IDTA 2VASA 2R7SA 1ZYRF 4IAQA 1Q0MA 2A1DD 1QLEC 4CVHA 1T6IA 2YVKA 5KYYA 4K7BA 4FAPB 1BDJB 4BJ5A 2W9YA 5A6BA 2V0KA 2P7VA 1VGZA 3K66A 3V5YA 1J8YF 3EHMA 1ZJ1A 2CYDA 1VYKA 2KC3A 5FYEA 1H7QA 4RBNA 3JRTA 2ICWG 3USRA 1H5SC 1VZTA 1YAUO 3T7MA 5A6JA 1FZWA 1TWCA 2E3DA 3G4ZA 1LE4A 5J49A 1U0BB 1MC3A 1GX0A 1MMNA 5COMA 1O0RA 3NYLA 2MWQA 1YDIA 2VK9A 3DXJF 2PGVA 1ORYA 2EPMX 3V0PA 3PMRA 2V0IA 3TQDA 2UUIA 1JR8A 4MVZA 2J9VA 1AEPA 4MTOA 3RMWA 1O87A 4AC3A 4WGYA 3DJ4A 1C02A 1H7LA 3FOQA 1SMYF 1EZIA 1L7CA 5EJ1A 5L0HA 3Q80A 2O1FA 4Y64A 2EINC 4JJGA 3SXEA 2KSFA 2EILC 2OEXA 2O1HA 3L8JA 3ABMC 2RJ7A 3Q4SA 3JYYA 3WAQA 1VM8A 2KNHA 4PFPA 1VMAA 4Q4ZF 1TW5A 1LI7A 5A6AA 2UX8A 2YL3A 3TK0A 1ZW3A 4JZAA 3DKAA 5GPGB 5CQLX 3O10A 1MMAA 1LZIA 3ZVRA 4JE9A 3SXDA 2JCJA 3EFOB 3V7OA 2YQJA 2Y3HA 4NC3A 4C3BA 3UMHA 2XS1A 4KNRA 1H5TB 1ZIZA 2Q7RA 2OJQA 4FCUA 2VXMA 3DM5A 1QPUA 2W0WA 4GEHA 3B0UX 2XWMA 3AG3C 1Z7Qc 5L0DA 4XQ1A 1SS9A 1RMVA 4FX5A 2P72A 2HKVA 3IPMO 3U0XA 4PR9A 4NAIA 1V83A 3L34A 2PA4A 2I15A 3U0YA 5C4BA 1FXOA 3B0VC 2XRHA 3EGDA 2BE5F 3I0FA 4EBBA 4YT4A 2QY9A 4FRMA 1FR8A 4B3UA 4ARWA 3DE8A 3N2ZB 3N0TA 2XM4A 3Q6NA 3U2UA 3GODA 2YLIA 5KYYB 2NUPA 5E3CA 4DJ9A 1R7UA 4J18A 4MS2A 2FY7A 4C7OA 2R03A 5KYNA 1G0RA 1FO9A 4EE3A 2QNLA 1R5ID 2GFHA 3GEHA 3NG1A 4B4BA 2FFVA 3BRJA 3L0IA 1G5ZA 2J9WA 4GBPA 3JZ0A 2WL8A 2WVMA 2APCA 3R2WA 1BR4A 3RW0A 3RSBA 5A6BD 1D1CA 3I0HA 4Y6UA 2CU2A 5EHHA 3VAYA 4LACB 1BZ4A 4HO8A 3EE5A 4I1MA 1SR2A 2J0WA 3ZIBA 1O7OA 1VPAA 2P6VA 4C3DA 1NSGB 4B4MA 4EBJA 3AGUA 2BO7A 5C36A 4AAWA 5DS4A 4CJBA 2OJED 3LNRA 4RDAA 1IZMA 3PHF2 3M1CB 2GA0A 3NKDA 4Y7VA 3IEEA 2X65A 3TULA 5DQTA 4DRIB 1H4EA 4EVWA 1VK5A 2KJGA 1Z23A 5L0FA 1ZDFA 5C3BA 2BO8A 3GM1A 3U8PA 2HJ3A 1JYKA 1LS1A 3RKOF 3ITFA 3TQOA 2UUHA 1JVDA 1R7VA 1FMWA 3W2VA 1QGSA 4CSAC 3SXCA 3R2PA 4AK9A 5CI9A 3W2WA 1JYLA 1ZI3A 4CS7A 2EPNA 1TZFA 4AX2A 4E0HA 4KPXA 4JURI 3K33A 4QI2A 4U9EA 4NCQA 1G8XA 4G3PA 3DWWA 4AYJA 3VYWA 4KNXA 1L3PA 2JCLA 3EGDB 1CPQA 2XMEA 3FMSA 1LL2A 3QW1A 1ON6A 1WSZA 5D91A 2ZU8A 4ECMA 3OEOA 3EZHA 3OKRA 3IQ6A 1LIHA 1OR2A 4CS8A 4P9FA 4JRZA 5COFA 3OAMA 3KH2A 1O3UA 1NU7D 2NUPB 3OH3A 2Y3DA 2Q00A 3Q7GA 2HV7A 4C7OB 4IWBA 3H2UA 4IJJA 4DRHB 4AL1A 1NQIB 4R32A 4XLPF 5FU8A 4D11A 4YT8A 2HMZA 1H6GA 1FNTc 1LZ0A 4Y6NA 3ATPA 4P02A 1Z3IX 2L6HA 3CQZA 2P1AA 1YARO 3K7DA 3TJ6A 3O3PA 4PJJA 4E1KA 1A7EA 3K8DA 2Y6PA 1Z5ZA 2RD9A 2Z87A 2YKZA 1XWJA 3S29A 2MYSA 2OKUA 2OQMA 2FYBA 4M2AA 3AG1C 4AE4A 1JV1A 3NMIA 4CDAA 4B42A 4U5EE 2BO6A 1YA7O 2B0HA 1V54C 1SF8A 256BA 3DJUB 2CW0F 3SXZA 5JSLA 1D1AA 2J45A 3GWNA 4O6NA 3KKBA 5EK0A 3FDQA 2KK1A 1XHBA 4YL1A 2CNWA 3DK5A 3TJ5A 3LESA 5C38A 5CQNX 1D0XA 4LERA 1ORJA 1WTYA 3CKNA 3M4BA 3NDBB 3I0LA 3O6XA 4PK4A 5CQMX 1ZCVA 4CDVA 1VGWA 2YHSA 3C62A 3AGTA 3HKKA 5CMIA 4JD0A 1FXJA 4MTFA 1GQ9A 3B71A 4PFOA 1OKKA 2RIXA 3ABKC 1QQ3A 1G2VA 2VCCA 3ABLC 1VTMP 1G8OA 4DBQA 3PKPA 1ZHYA 1VICA 4JJFA 3ZGGA 1KU2A 1IIMA 2RJ6A 2A68F 4I1OB 2W0VA 1ZHZA 3LJBA 2A8UA 2R7UA 3NMJA 1VOMA 3K6BA 3ZQYA 5FUHA 1LS4A 3AG4C 3KPHA 2YL1A 2EPLX 3EG9A 3QZCA 3U9JA 4YL3A 5F5FA 2VFZA 4JKVA 4PJLA 1G9RA 1BR1A 2M64A 1Z90A 3LAYA 2CDQA 1A0BA 3ASOC 1ZCYA 2AU5A 3IQCA 4HO5A 2YC3A 4P9TA 3UNGC 4LDRA 1V55C 4D48A 4OINF 1GWVA 5TJ5E 3FXHA 3S84A 3I0IX 3V0LA 3SYNA 2IYLD 3LEVA 2AGDA 5CMFX 4HFKB 4J32B 2KYHA 5E2QA 1ZU4A 3I0GA 3HNIA 2FGYA 3ZF8A 5T3TA 3BEHA 4AE4B 5A6KA 1FAPB 2WVQA 3ZLKA 1YA9A 2QLAA 3S27A 5C48A 1H4CA 2PP4A 4CS9C 1OMXA 3DZAA 4ZDQA 4D4NA 4KC9A 4NQFA 2J8WA 3OWTA 4G87A 2WGZA 3C8ZA 2P73A 5L3VA 1EI7A 4FCEA 4MTGA 1YYXA 1QG8A 1SZIA 3SX3A 5JVEA 2ZU7A 3FHDA 3W4YA 1FR9A 2EPOA 2XL4A 4XEKA 3K8EA 2RITA 1EKYA 2D4UA 2J46A 2C03A 3S28A 2OI7A 4OIPF 3US6A 1G1LA 4HCQA 1T6UA 2ZXWC 2VCAA 2CNWD 1HY5A 1ZU5A 2R02A 4IRPA 2AH9A 4R7PA 4CJCA 5FTSA 3JTLO 3T7NA 1HV9A 2LQGA 1PZTA 4MVOA 1T6QA 1VH1A 5FZTA 3IHUA 2RJ5A 2VCBA 4MVMA 1D0ZA 4Z9JA 3W8HA 4KXOA 5KYWA 5C3DA 3PDMP 3CKJA 1E2XA 3A9CA 5L0CA 2Y3GA 2PF4E 4K1OA 2MZBA 1ZZPA 3RYLA 4L6RA 5AJOA 2HFIA 2R7VA 1LI5A 4ONSA 1W55A 3C18A 4FWVA 2WAWA 3CEXA 4DVZA 4MVQA 3EG9B 3H65A 2R7XA 4BEMJ 5L3QA 3MFNA 4KRVA 1CGNA 4FROA 2VH3A 3K1IA 1U6HA 2YL0A 1OQCA 3C63A 4YT5A 3ZWIA 1OR3A 2YESA 1HJJA 3EGXA 5C1LA 1HM9A 4D0TA 1VLTA 3OGZA 4EEMA 5FCLA 1G97A 3CSKA 4HG6A 5HS2A 5AC4A 1JPNA 4YL0A 1YP2A 1IINA 4CJGA 1VGUA 3AQCA 3U8VA 4J30B 1QSPA 1LL3A 2O1GA 5E3AA 2X5SA 3U2TA 3EQLF 2KW3C 1OW6A 4I44A 4BJ6A 3SZRA 3D8VA 4LLCA 2NPUA 1M6TA 4BPMA 4K0DA 3FAPB 1HE9A 1WATA 3LLKA 1EYRA 3FVYA 3HTKC 1NF5B 1ZCTA 3GM3A 3JCUQ 4YT2A 5CQPA 1RKEA 2R9RB 4RD9A 2RJ0A 2PX7A 1LL0A 1FGXA 1S05A 3JSEO 4O6YA 4KC1A 2NXVA 1JMWA 5C1HA 3QVBA 4Y7TA 3C7JA 2Y4LA 3WHNA 1H5SA 2V0LA 4FRPA 4GYTA 4YWQA 2ZPAA 5CQOA 1W2WA 2XLOA 3SNHA 1TQGA 4I3MA 1H9GA 2G3VA
chains in the Genus database with same CATH topology
3VYWA 1G93A 4KNXA 4ZLCA 4CBEA 2JCLA 4XLNF 2I5KA 1S4NA 1FWYA 1TVYA 2VS3A 3E25A 3EGDB 1S4OA 3N9WA 3BRKX 5FU0A 3SXGA 2XMEA 3T7OA 1LL2A 4HOCA 1V82A 3F46A 1WT2A 4IRUA 2W4BA 3Q7LA 3DD7A 4BJ1A 1TWHA 2Y3BA 2Y69C 1ON6A 1WSZA 5D91A 2ZU8A 4ULWA 4FRHA 1G23A 4U5CE 4ECMA 3OEOA 3EZHA 5DVWA 2VSIA 5T1DB 1QWJA 3ST8A 5KYWB 4EWCA 3OKRA 2FYAA 3I0DA 1OKKD 3RFYA 4CS8A 1H7EA 3UGPA 3OAMA 2WVOA 3KH2A 4FRDA 5C4EA 1OCRC 5I1FA 3SXAA 1N1CA 1NU7D 2NUPB 2VD4A 3OH3A 4XTKA 2Y3DA 5CMHA 2NUTB 1FO8A 4ASYA 2P6WA 3Q7GA 2HV7A 5KYUB 4B6IA 5CMGX 4C7OB 4IWBA 1G95A 4U5DE 1NMMB 5AJPA 5DLJA 2IXOA 3B9QA 5BXCA 4IJJA 2KGOA 4EE5A 1NQIB 2WZLA 3V0NA 1WT3A 3B0PA 3CZ6A 4U5FE 4N06A 4FIYA 4OD5A 4XLPF 5T3WA 1H7FA 4CS9A 2V3CC 4NAKA 4DECA 5FU8A 2IOQA 2YZSA 4NY3A 4D11A 3E26A 4YT8A 3I0EA 2EIJC 1LZ0A 2Y39A 4ZLDA 4BG0A 4QI0A 4Y6NA 2XWNA 4P02A 1Z3IX 2L9JA 3CQZA 5FV9A 4P00A 4O7GA 3K7DA 5CI8A 3WG7C 3O3PA 2AM3A 4PJJA 1W57A 4BJTA 3V91A 4E1KA 5C8RA 5D92A 1MP5A 3CKOA 3K8DA 5IFYA 3E70C 2Y6PA 4DOZA 1FOAA 2R7OA 3EGXB 1Z5ZA 4OD4A 1VZUA 2Y4MA 2Z87A 3JUJA 5DDVA 3TZTA 5C4FA 3JYHA 3UGOA 3OH2A 2W45A 3OH1A 1FFHA 4D48A 1S7ZA 1OCZC 2MYSA 3S29A 2RJ4A 3DUVA 4HO6A 2Y7AA 4F4BA 2R7RA 2V0JA 1RJ9B 2Z86A 2J7PA 4HO2A 1PD0A 4BJ5C 4LW6A 1D1BA 2JCKA 1FRWA 5EJZA 4OIOF 2FYBA 4M2AA 3V8YA 3AG1C 5C49A 3MX3A 5DQZA 3ZG1A 4AE4A 5B3SC 5BUOA 2DPWA 1JV1A 3V0MA 4JW1A 3LLIA 4B42A 4U5EE 2ZU9A 4KNVA 2DGJA 4QDLA 1WT0A 4MIXA 4X0RA 3CKQA 4B2WA 2VS5A 1FFTC 2BO6A 2E8BA 5C47A 4JISA 3FAJA 1ST6A 2QKXA 1V54C 2H7VC 2A69F 3EH2A 1SF8A 3DJUB 4XWJA 2WVNA 3DMDA 2OG2A 3E9VA 2CW0F 2OEFA 1ZHTA 1GA8A 3IOJA 3POLA 4HO4A 2Y4JA 3CKVA 5FTVA 1D1AA 2J45A 4G7HF 3RMVA 3U2VA 4EE4A 2PFDA 3KKBA 4O6NA 3FDQA 3HL3A 2DYRC 2Q4JA 2AESA 3K1IC 1KWSA 1LZJA 3JUKA 5JQQA 2FFHA 2BO4A 1ZHJA 1XHBA 1I52A 1NZEA 2D7IA 1LVWA 2CNWA 1H5RA 5DDTA 4IAOA 4Q5SF 1R80A 3DK5A 3I4UA 3LESA 1ZJ0A 5C38A 2J0AA 4DVYP 3EFOA 4PJMA 1QGQA 5CQNX 2YEVA 2Q3TA 1G3LA 1PCXA 2PX0A 1H4DA 1R81A 5L6SA 1D0XA 1MP3A 2J0BA 3U2WA 2VB6A 4KNWA 4LERA 3USQA 4M63A 1YROB 3I0JA 3ZSUA 1OQMB 1R7TA 4ASJA 1H5TA 4G3QA 3CKNA 2RIZA 4FRAA 4WJ0A 1VZXA 3NDBB 1ZI4A 1HM8A 4U5GA 2XXAB 3I0LA 3T4RA 3GUEA 3SX7A 2WE9A 1ON8A 3O6XA 4PK4A 1VGTA 2Q9CA 2J0XA 2O9XA 3I5QA 4JCHA 4H4KC 1FG5N 1H5SB 3X1OA 1VGWA 1ZCVA 2QH5A 2YHSA 2GGQA 2WB7A 2OEGA 3SX5A 5IY5C 2GGOA 2J9UA 1YP3A 1HJLA 3KIAA 5CMIA 1OCOC 1S4PA 5DS6A 4JD0A 2RJ1A 4UEGA 1FXJA 3I0KA 1GQ9A 1LZ7A 4HO3A 4XWIA 4KQLA 4PFOA 1OKKA 2I5EA 3ABKC 1D0YA 2RIXA 4HO9A 1E5KA 1PD1A 3F47A 3K1HA 5CMJA 4BJ6C 3GANA 2D7RA 1G2VA 3ABLC 3PKQA 3HJCA 4A2NB 3IOHA 4L41C 3MLGA 1JV3A 4JVSA 3SP1A 1WVCA 5IDTA 1G8OA 2VASA 2FYCB 2Q9BA 4DBQA 4HFFB 3PKPA 2R7SA 1ZYRF 3DM9B 4LW3A 4Y7UA 1ZHYA 4G3SA 1VICA 4JJFA 2A1DD 1QLEC 3OH0A 3ZGGA 1KU2A 1IIMA 2RJ6A 1QZXA 4CVHA 3BCVA 2YQCA 2A68F 3NYJA 5KYYA 4I1OB 4K7BA 2RIYA 2W0VA 1ZI1A 4BJ5A 3EZIA 4FREA 1ZHZA 2W9YA 3LJBA 2V0KA 2R7TA 5C1GA 1PZYB 2P7VA 1VGZA 2A8UA 2X5ZA 2R7UA 3K66A 1ZJPA 2OCCC 1J8YF 3EHMA 1VOMA 1ZJ1A 3K6BA 3N24A 2A6EF 1VYKA 3LS0A 3Q6MA 2ICYA 3HLZA 3NKEA 1BR2A 3JT1A 3NRHA 2W4MA 2VXLA 4O6MA 5FUHA 4PJNA 1TWGA 3AG4C 1VH3A 5FYEA 4MYBA 3EG9A 3QZCA 1H7QA 4RBNA 3JRTA 1INJA 4C2SA 3EHNA 1WT1A 3USRA 1H5SC 1VZTA 3JTJA 3T7MA 3V0QA 1FZWA 1TWCA 3S0XA 2E3DA 5J49A 5F5FA 2VFZA 5AJNA 3WODF 4PJLA 1G9RA 1MC3A 1GX0A 1BR1A 1MMNA 1MP4A 1O0RA 1TKNA 3CU0A 1R82A 4DBRA 3NGWA 4W8KA 3NYLA 2MWQA 1VYIA 3LAYA 1ZCUA 1Z90A 2A8WA 2CDQA 2WZGA 3QMKA 3FWWA 1OCCC 3LW6A 4D0ZA 3ASOC 2VK9A 3DXJF 2PGVA 1ZCYA 1Z63A 2YCMA 3SEOA 4HO5A 3V0PA 3PMRA 2V0IA 2YC3A 2XSEA 1M2VA 3TQDA 1MMDA 3UNGC 2OI5A 2J9VA 4G7OF 2JD3A 3SX8A 1V55C 4MQ9F 2AM4A 2EIKC 3W8IA 4FRLA 1TWAA 3RMWA 1O87A 4OINF 2B0JA 2IXNA 1GWVA 3F1CA 3V8ZA 4AC3A 3ECSA 3DJ4A 4CSAA 3I0IX 3V0LA 3SYNA 2IYLD 3LEVA 2AGDA 1K4VA 5CMFX 2H7OA 4HFKB 2ICXA 1H7LA 4J32B 3FOQA 1SMYF 5E2QA 1EZIA 1ZU4A 3I0GA 3DAFA 2FGYA 4CS8C 1GX4A 3ZF8A 4NANA 5EJ1A 3Q80A 5T3TA 4AE4B 2EINC 2PX3A 4JJGA 1ZJOA 2FFUA 2O1FA 4Y64A 2XMHA 2EILC 4C3EA 5EIYA 1J8MF 2O1HA 3ABMC 2RJ7A 4Y7GA 2WVQA 1NG1A 3Q4SA 3SXEA 3T6JA 5EGYA 4FQWA 1OMZA 3ZLKA 1VM8A 1R7YA 1XZ6A 3U2XA 2KNHA 2D5RB 4PFPA 3S27A 1VMAA 5C48A 2ZXRA 1H4CA 2J7PD 3UMKA 5KYXA 2PP4A 4Q4ZF 4CS9C 1TW5A 3F1YA 4KC4A 1OMXA 3ZGFA 4D11C 4BEJA 2UX8A 3DZAA 1INIA 3SPTA 4ZDQA 4JZAA 4KC9A 3X2QC 3PNNA 3UR3C 1FMVA 3OWTA 4G87A 4DE7A 2WGZA 5CQLX 5IDSA 2P73A 2D0JA 1MMAA 5L3VA 3D5NA 4G3PA 1M2OA 2HV6A 1LZIA 1H5RB 2QTVA 3ZVRA 4OIQF 1R7XA 4FCEA 3SXDA 4G0HA 4Y62A 2JCJA 1QG8A 1SZIA 3EFOB 3V7OA 3SX3A 3EJNA 2YQJA 2Y3HA 3ASNC 2ZU7A 3FHDA 1FR9A 4HE8D 4C3BA 4YJWA 3UMHA 2XL4A 2YC5A 3K8EA 4KNRA 1H5TB 1ZIZA 2RITA 4FCUA 2I7BA 2VXMA 2ZXOA 5F5HA 3DM5A 4HO0A 2W0WA 2J46A 2C03A 1O23B 3S28A 2OI7A 4GEHA 3B0UX 4EEGA 4OIPF 2AM5A 1ZDGA 3AG3C 2XWMA 1MMGA 1G1LA 4HCQA 1SS9A 2ZXWC 5L6VA 3DJNB 3OA1A 4FX5A 2CNWD 4M2BA 1NHEB 2P72A 3U0XA 1ZU5A 4LLEA 2L81A 2DYSC 2Z15A 3L34A 1V83A 2PA4A 1GQCA 2AH9A 4IRPA 4NAIA 2CGEA 4R7PA 4CJCA 3U0YA 4MNDA 5FTSA 5C4BA 2VSHA 3T7NA 1FXOA 3B0VC 2XRHA 3EGDA 2PGYA 2BE5F 1HV9A 1Z6AA 1PZTA 2NG1A 4YS8A 1H5SD 3EH1A 1VH1A 3I0FA 3TD7A 4EBBA 4YT4A 2RJ5A 3UMIA 2QY9A 1ZI5A 5C4DA 1NWGB 1D0ZA 5C4CA 1TW1A 4FRMA 4KPZA 1FR8A 5B1AC 2G3KA 1FTSA 3W8HA 2RJ9A 3NYMA 5KYWA 4KXOA 4NALA 4B3UA 1IW7F 5C3DA 4ARWA 1ZHWA 3N2ZB 3CKJA 3N0TA 2Y3GA 2AECA 5B1BC 2WVLA 3Q6NA 4U5HA 1H7GA 3KMIA 2PF4E 3GODA 5KYYB 3U2UA 2NUPA 2MZBA 5E3CA 3RYLA 1ZHXA 1R7UA 4J18A 2R7QA 2NUTA 3ZLLA 1V84A 4FIXA 5AJOA 5KYUA 2FY7A 4FRQA 4C7OA 2R7VA 4Q7CA 5KYNA 1ZJ2A 2YQHA 1G0RA 1FO9A 4BMAA 4EE3A 5E33A 4BQHA 2GFHA 1W55A 3OC9A 3NG1A 3CGXA 4B4BA 2YQSA 2I8BA 4FWVA 2WAWA 2FFVA 1NU9C 1TR2A 4DVZA 1O7QA 3EG9B 3H65A 3L0IA 2R7XA 2J9WA 4GBPA 4M28A 2WL8A 5L3QA 3O39A 2AE7A 3AQBA 2X60A 4KRVA 2XWLA 4DDZA 4FROA 2WVMA 2APCA 3R2WA 1BR4A 3RSBA 2VH3A 1YP4A 2WEEA 1D1CA 4Y63A 4E7SA 3I0HA 4Y6UA 3V90A 4YT5A 2M4EA 1H7TA 2CU2A 5EHHA 2WVKA 3I5PA 3VAYA 4B2XA 1LKXA 4LACB 2YESA 1HJJA 3EGXA 3RIPA 4HO8A 5C1LA 3EE5A 4P6IC 4U5BE 2ZXPA 4I1MA 3D98A 1HM9A 4D0TA 1LVKA 1M2VB 2J0WA 3ZIBA 1O7OA 1VPAA 3LS1A 3OGZA 1RJ9A 3SXBA 5FCLA 1G97A 3KL4A 4EEMA 2JCOA 2P6VA 4C3DA 3CSKA 2IXMA 4HG6A 5HS2A 4B4MA 2G62A 5DS5A 1JPNA 2LSEA 5HSWA 1YP2A 4CIHA 2C0NA 1IINA 2BO7A 5C36A 4KBLA 1VGUA 3V0OA 3AQCA 4AAWA 5DS4A 2OI6A 2RJ8A 4CJBA 3AG2C 4J30B 2R7WA 3DAGA 3EPVA 3LNRA 4K6RA 4EEAA 4RDAA 4KT7A 1IZMA 1LL3A 2O1GA 2IXPA 3PHF2 3M1CB 1HM0A 5E3AA 4HEAJ 2X5SA 3I0CA 5CQMX 1ZJ3A 4OIRF 3EQLF 3NKDA 3OH4A 3IEEA 2KW3C 4FRBA 4I44A 4Y7VA 3U2TA 4BJ6A 3T6BA 1NKHB 3SZRA 2X65A 4LLCA 3D8VA 3IOIA 5DQTA 2EIMC 4EEOA 1JPJA 5KYXB 2FYDB 1H4EA 2A6HF 4EVWA 4K0DA 1VK5A 2KJGA 1Z23A 3LLKA 1EYRA 3FVYA 1MNDA 3HTKC 1ZDFA 5C3BA 4E7ZA 1M57C 3POVA 1NF5B 1ZCTA 2BO8A 1MNEA 4AYLA 3R3IA 4KI2A 5C3AA 3JSZA 3JCUQ 4YT2A 2KQ9A 5CQPA 1JYKA 1WGWA 4Y7FA 1LS1A 4RD9A 1W77A 2RJ0A 3RKOF 3ITFA 1H7HA 1LL0A 2PX7A 2WZFA 4G7ZF 1FGXA 2H7BA 4KC2A 4Y9XA 2C04A 4O6YA 1JVDA 2Y4KA 1R7VA 1FMWA 2QGIA 4KC1A 3W2VA 2NXVA 4B4GA 1QGSA 2V26A 4CSAC 3Q7UA 4O79A 2XXAA 3QVBA 4IRQA 5C1HA 2E87A 4Y7TA 3SXCA 3ZC4A 1FGGA 4AK9A 5CI9A 3W2WA 2Y4LA 1JYLA 1ZI3A 1H5SA 4AYJA 4YN0B 4CS7A 2V0LA 1TZFA 1GWWA 3RH3A 4FRPA 2V0HA 4AX2A 4GYTA 4YWQA 4KPXA 4M4KA 1JVGA 4B5BA 4CJ8A 4JURI 2Q9AA 2X51A 1H3MA 3K33A 1M56C 4QI2A 2ZPAA 5CQOA 4FESA 1W2WA 4ANJA 3SNHA 1G8XA 2VS4A 4I3MA 1O5HA 2G3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6M A;  5D92 A;  4O6N A;  4MND A;  5D91 A;  4Q7C A; 
#chains in the Genus database with same CATH topology
 4XLN F;  3C8G A;  1S4N A;  4IGG A;  4EBK A;  2PBE A;  3VM6 A;  1V82 A;  4IRU A;  4E17 A;  2W4B A;  3Q7L A;  2Y69 C;  4FRH A;  1G23 A;  2L6F A;  2VSI A;  5KYW B;  4EWC A;  2FYA A;  1Y4C A;  3UGP A;  2WVO A;  4FRD A;  5C4E A;  1WN0 A;  2VD4 A;  1FO8 A;  3ZTM A;  4B6I A;  5CMG X;  4U5D E;  1PV3 A;  3S90 A;  5BXC A;  2KGO A;  4EE5 A;  3V0N A;  4NTA A;  4U5F E;  3CZ6 A;  4N06 A;  4FIY A;  5T3W A;  1GM5 A;  2IOQ A;  2YZS A;  3I0E A;  3HNJ A;  2YRF A;  5JLI A;  1OXB A;  3LEO A;  2L9J A;  4O7G A;  5CI8 A;  2AM3 A;  1W57 A;  4BJT A;  5C8R A;  3CKO A;  1SYQ A;  3E70 C;  3EGX B;  3JUJ A;  2P61 A;  5DDV A;  3L1M A;  3OH2 A;  3OH1 A;  1EA8 A;  1S7Z A;  2RJ4 A;  4HO6 A;  3DUV A;  4F4B A;  2Z86 A;  4LW6 A;  1D1B A;  1K40 A;  1FRW A;  2YL7 A;  1QVX A;  1T01 A;  5C49 A;  3MX3 A;  1YZA A;  3ZG1 A;  2FAP B;  1A41 A;  3R7C A;  2DGJ A;  1WT0 A;  4MIX A;  4JC7 A;  4B2W A;  2E8B A;  2XL6 A;  1ST6 A;  5K0I A;  3EH2 A;  3B29 A;  2IBF A;  4XWJ A;  2OG2 A;  3E9V A;  3IOJ A;  5CIV A;  2Y4J A;  4G7H F;  1GS9 A;  2DYR C;  1Y6D A;  1UFB A;  1H5R A;  1ZJ0 A;  2LK4 A;  4DVY P;  1NFO A;  2LP4 A;  5L6S A;  3U2W A;  1LPE A;  4KNW A;  1RKE B;  1OW8 A;  3QVZ A;  4G3Q A;  2MHR A;  4FRA A;  4WJ0 A;  1MQV A;  1VZX A;  1ZI4 A;  1ZW2 A;  2Q9C A;  1XZP A;  2O9X A;  1FG5 N;  1H5S B;  3X1O A;  3IQT A;  3GWL A;  2J9U A;  1YP3 A;  1HJL A;  2XL8 A;  1OCO C;  1S4P A;  4UEG A;  1LZ7 A;  1AUE A;  2I5E A;  1PD1 A;  3F47 A;  3C8G B;  3IOH A;  4JVS A;  1WVC A;  2Q9B A;  4HFF B;  3DM9 B;  4G3S A;  3OH0 A;  4EIY A;  3QVY A;  3BCV A;  2YQC A;  3EZI A;  3SX7 A;  2R7T A;  2F22 A;  2OCC C;  2A6E F;  3C8G D;  1BR2 A;  3JT1 A;  3NRH A;  4O6M A;  1TWG A;  1VH3 A;  1V4A A;  4C2S A;  3EHN A;  1WT1 A;  3V0Q A;  3DE9 A;  5AJN A;  3WOD F;  1MP4 A;  1TKN A;  3CU0 A;  4DBR A;  3NGW A;  3V90 A;  3FWW A;  2A8W A;  3QMK A;  4D0Z A;  3RF3 A;  3CAX A;  4MVR A;  1Z63 A;  3O55 A;  2YCM A;  1AVO B;  2HJM A;  1M2V A;  3U3B A;  2JD3 A;  3SX8 A;  4JTA B;  4MQ9 F;  2AM4 A;  3W8I A;  1TWA A;  3V8Z A;  5C4D A;  2IXN A;  3F1C A;  2XLV A;  2XLM A;  3ECS A;  4CSA A;  2R25 A;  4LDK A;  1YYJ A;  1GX4 A;  4NAN A;  4EHP A;  2PX3 A;  2FFU A;  1U89 A;  2XMH A;  2NSG A;  4C3E A;  5EIY A;  4DXW A;  4Z9I A;  1NG1 A;  3T6J A;  5JP7 A;  3U2X A;  1WWP A;  2ZXR A;  1GQA A;  3UMK A;  4KC4 A;  3ZGF A;  3KYJ A;  1INI A;  1FMV A;  3ZDL A;  5IDS A;  2D0J A;  4MW3 A;  1H5R B;  3RVY A;  4OIQ F;  1R7X A;  4G0H A;  3M4C A;  3TOL A;  2I7B A;  2ZXO A;  5F5H A;  1LM3 B;  4HO0 A;  2LCH A;  2L7A A;  4EEG A;  2AM5 A;  3TOM A;  5L6V A;  3DJN B;  5HV9 A;  4GQH A;  4LLE A;  2L81 A;  2DYS C;  2Z15 A;  3V8Y A;  1GQC A;  4MND A;  2VSH A;  1Z6A A;  2NG1 A;  3EH1 A;  3TD7 A;  1EQ1 A;  1ZI5 A;  1NWG B;  1UG7 A;  5C4C A;  4KPZ A;  5B1A C;  2G3K A;  1FTS A;  4WAB A;  2RJ9 A;  1YZC A;  1ZHW A;  2AEC A;  1DOW A;  2WVL A;  4U5H A;  2R7Q A;  2NUT A;  1V84 A;  5KYU A;  4FRQ A;  4Q7C A;  1ZJ2 A;  2YQH A;  4JTC B;  4BMA A;  1V74 B;  4BQH A;  3OC9 A;  2JPU A;  3CGX A;  2I8B A;  1NU9 C;  1TR2 A;  4XPX A;  3RQF A;  2XLH A;  3SXY A;  2AE7 A;  3AQB A;  2DI3 A;  2XWL A;  4J7T A;  4E18 A;  3H2V A;  1YP4 A;  4Y63 A;  1H7T A;  2M4E A;  5COG A;  2WVK A;  4B2X A;  4P6I C;  4U5B E;  3RQG A;  3RVZ A;  3J06 A;  1M2V B;  3LS1 A;  1RJ9 A;  3SXB A;  3KL4 A;  1YLM A;  5DS5 A;  2LSE A;  5HSW A;  4CIH A;  4KBL A;  3V0O A;  3LUT B;  3GOR A;  2RJ8 A;  3AG2 C;  4EEA A;  3EPV A;  4EUK B;  4G78 A;  3HNL A;  4KT7 A;  2IXP A;  1HM0 A;  1NBB A;  4HEA J;  1R4T A;  3I0C A;  4OIR F;  4FRB A;  3QW0 A;  3T6B A;  3SXM A;  3IOI A;  1JPJ A;  2AWC A;  1MND A;  2GDC A;  2GAQ A;  3IQ5 A;  5BQH A;  2L6G A;  4E7Z A;  1M57 C;  3U2L A;  3POV A;  4AYL A;  5C3A A;  2KQ9 A;  4Y7F A;  1H7H A;  2WZF A;  4G7Z F;  2C04 A;  2Y4K A;  2QGI A;  4D4X A;  4B4G A;  4O79 A;  2XXA A;  1FGG A;  4IB4 A;  1CPR A;  3AOU A;  1GWW A;  3RH3 A;  2V0H A;  4M4K A;  1JVG A;  4CJ8 A;  2Q9A A;  1H3M A;  1M56 C;  4FES A;  3FOO A;  4WGZ A;  4ANJ A;  5L0G A;  2VS4 A;  2HS5 A;  1O5H A;  4U9D A;  4ZLC A;  4CBE A;  2VS3 A;  2I5K A;  3E25 A;  1FWY A;  3V5X A;  3A11 A;  3BRK X;  5FU0 A;  3SXG A;  3U0C A;  1WT2 A;  4NTF A;  1H9T A;  3GM2 A;  4BJ1 A;  1TWH A;  2Y3B A;  3AJM A;  1CGO A;  1FR0 A;  4ULW A;  4U5C E;  5DVW A;  3ST8 A;  3VF0 A;  1QWJ A;  1I4Y A;  1OKK D;  1H7E A;  1NLX A;  5I1F A;  1OCR C;  4CDY A;  1N1C A;  4XPW A;  2NUT B;  4ASY A;  2P6W A;  5KYU B;  1G95 A;  3B9Q A;  4N4W A;  4CIP A;  2WZL A;  1WT3 A;  3B0P A;  1VB5 A;  1H7F A;  4CS9 A;  5AGF A;  4NY3 A;  5JUA A;  2Y39 A;  4ZLD A;  4BG0 A;  4QI0 A;  1BBH A;  5FV9 A;  4P00 A;  2RSE B;  3V91 A;  5D92 A;  5IFY A;  2Y4M A;  5AC5 A;  5BQI A;  3TZT A;  5C4F A;  2HZ8 A;  3T9O A;  2R7R A;  1RJ9 B;  2J7P A;  4HO2 A;  1PD0 A;  2LFD A;  4OIO F;  4W8P A;  2DPW A;  3V0M A;  4JW1 A;  4ER9 A;  3U3F A;  4KNV A;  4X0R A;  1FFT C;  4CJO A;  5C47 A;  3KYI A;  4JIS A;  3FAJ A;  2QKX A;  2A69 F;  4NTB A;  2WVN A;  3DMD A;  1JAF A;  5JS5 A;  5FTV A;  3U2V A;  4EE4 A;  2YWA A;  3HL3 A;  1VLS A;  1TFK B;  2AES A;  1KWS A;  3JUK A;  1YVI A;  5JQQ A;  1NZE A;  4JIO A;  4IAO A;  4Q5S F;  3I4U A;  3L8I A;  4PAC A;  1QGQ A;  4PJM A;  2Q3T A;  1PCX A;  2PX0 A;  2J0B A;  3ZTZ A;  2VB6 A;  3I0J A;  3ZSU A;  4ASJ A;  4JCZ A;  4JTD B;  4UDV A;  2XXA B;  1ORS C;  1TFO B;  3T4R A;  1ON8 A;  1VGT A;  2QH5 A;  3GEI A;  2GGQ A;  3JRM O;  3SX5 A;  5IY5 C;  1KNY A;  5DS6 A;  1XZQ A;  4HO3 A;  4XWI A;  4KQL A;  2J9B A;  1D0Y A;  1E5K A;  3M79 A;  3K1H A;  5CMJ A;  3FOP A;  2OEV A;  3PKQ A;  3HJC A;  4A2N B;  3MLG A;  3SP1 A;  2FYC B;  2Q4F A;  4LW3 A;  4Y7U A;  1T9K A;  1QZX A;  3NYJ A;  2RIY A;  1ZI1 A;  4FRE A;  2OOC A;  5C1G A;  3U5S A;  1PZY B;  2X5Z A;  1ZJP A;  4AL0 A;  3N24 A;  3LS0 A;  3Q6M A;  2ICY A;  3HLZ A;  3NKE A;  4EKW A;  2W4M A;  4A4A A;  2VXL A;  4PJN A;  3RQE A;  4MYB A;  2ASR A;  1INJ A;  2AWY A;  3JTJ A;  3S0X A;  2R05 A;  4YK5 A;  3U9M A;  1QKR A;  2CCY A;  1R82 A;  2YLD A;  4W8K A;  1VYI A;  1ZCU A;  1RKC A;  2WZG A;  5BQG A;  3LW6 A;  1OCC C;  1E86 A;  3PCV A;  3SEO A;  4MW8 A;  2XSE A;  1MMD A;  2OI5 A;  4G7O F;  1JRA A;  1E84 A;  2EIK C;  4FRL A;  2B0J A;  1JOG A;  1K4V A;  2H7O A;  2ICX A;  3V5Z A;  3DAF A;  1ZVZ A;  4CS8 C;  2DB4 A;  1Q0K A;  1B68 A;  1ZJO A;  1J8M F;  1G4W R;  4Y7G A;  4IAR A;  1HMO A;  5EGY A;  4FQW A;  1OMZ A;  1R7Y A;  1XZ6 A;  2D5R B;  2J7P D;  5KYX A;  3F1Y A;  4D11 C;  4BEJ A;  3SPT A;  1APC A;  3X2Q C;  3PNN A;  3UR3 C;  4DE7 A;  5F28 E;  3D5N A;  2PNO A;  1M2O A;  2HV6 A;  2QTV A;  4Y62 A;  4ULV A;  1WOL A;  3EJN A;  3ASN C;  3LNM B;  1K05 A;  2AVK A;  4HE8 D;  4YJW A;  1DOV A;  2YC5 A;  2EPK X;  4Z9H A;  4DRJ B;  1O23 B;  4JEA A;  1ZDG A;  1MMG A;  2OU6 A;  3OA1 A;  4M2B A;  1NHE B;  1OXK A;  5JT4 A;  2BL2 A;  2CGE A;  4MVS A;  2X0C A;  2PGY A;  4YS8 A;  3HNK A;  1H5S D;  1I5N A;  1I4Z A;  3UMI A;  2ETS A;  3MYF A;  1GGQ A;  1TW1 A;  3QTH A;  4JEB A;  4NAL A;  3MBG A;  3NYM A;  3SXK A;  1IW7 F;  5B1B C;  1H7G A;  3KMI A;  4N6H A;  1ZHX A;  3ZLL A;  2BC5 A;  4FIX A;  3GEE A;  5E33 A;  3NMK A;  2YLG A;  2YQS A;  4MVU A;  1O7Q A;  2H8A A;  5A69 A;  1WAS A;  4M28 A;  3O39 A;  2X60 A;  4DDZ A;  2LFF A;  1K04 A;  1T5O A;  2WEE A;  4E7S A;  3I5P A;  1LKX A;  3RIP A;  1C03 A;  2ZXP A;  3D98 A;  3VRC A;  1LVK A;  2JCO A;  2IXM A;  5JRA A;  2G62 A;  2C0N A;  1E83 A;  3MYI A;  2OI6 A;  2R7W A;  3DAG A;  4K6R A;  1Q0F A;  2IM8 A;  1CGM E;  5L0I A;  1ZJ3 A;  3OH4 A;  2QE9 A;  1NKH B;  2AP3 A;  2EIM C;  4EEO A;  5KYX B;  2FYD B;  2JX0 A;  4N6C A;  2A6H F;  3S9O A;  1MNE A;  3R3I A;  4KI2 A;  3JSZ A;  1F1M A;  1WGW A;  1W77 A;  2H7B A;  1HMD A;  4XPY A;  4KC2 A;  4Y9X A;  3G4X A;  3Q7U A;  2V26 A;  4IRQ A;  2E87 A;  1H7I A;  3DI5 A;  3ZC4 A;  2HUJ A;  5L0J A;  4YN0 B;  3U2M A;  4B5B A;  2X51 A;  2HSQ A;  2YQY A;  1LE2 A;  1C17 M;  1G93 A;  1TVY A;  1S4O A;  3N9W A;  3T7O A;  4HOC A;  3F46 A;  4LDQ A;  2LIG A;  2GWW A;  3DD7 A;  5T1D B;  2HMQ A;  1KTM A;  3I0D A;  3RFY A;  2A0B A;  1HW1 A;  3SXA A;  3M15 A;  4XTK A;  2NSF A;  5CMH A;  1E85 A;  1NMM B;  5AJP A;  5DLJ A;  2IXO A;  1A7V A;  4E0I A;  2XM0 A;  4OD5 A;  2V3C C;  4NAK A;  4DEC A;  3E26 A;  2VC9 A;  2EIJ C;  2XLD A;  2XWN A;  2XLW A;  3WG7 C;  1Q0G A;  1MP5 A;  4DOZ A;  1FOA A;  2R7O A;  1VZU A;  4OD4 A;  1YJG A;  3JYH A;  3UGO A;  2W45 A;  1FFH A;  1OCZ C;  2Y7A A;  2V0J A;  2HSB A;  4BJ5 C;  1RXQ A;  2JCK A;  2QUP A;  5EJZ A;  4XEV A;  5DQZ A;  2LD6 A;  5B3S C;  5BUO A;  3LLI A;  2ZU9 A;  4XEF A;  4QDL A;  5B3I A;  3CKQ A;  2VS5 A;  3T6G B;  2H7V C;  1RCP A;  2OEF A;  1ZHT A;  1GA8 A;  3POL A;  4HO4 A;  3CKV A;  4J7Y A;  4H54 A;  1A7D A;  2XS8 A;  3RMV A;  1NFN A;  2PFD A;  2TMV P;  2Q4J A;  3K1I C;  1LZJ A;  1OW7 A;  2FFH A;  1HE1 A;  1ZHJ A;  2BO4 A;  1I52 A;  2D7I A;  1LVW A;  5DDT A;  3ZQV A;  1R80 A;  2J0A A;  3EFO A;  2YEV A;  1G3L A;  1G4U S;  1H4D A;  1R81 A;  1MP3 A;  2A0U A;  3USQ A;  4M63 A;  1YRO B;  1OQM B;  1R7T A;  1H5T A;  2RIZ A;  2ZD9 A;  1HM8 A;  4U5G A;  4CX9 A;  3GUE A;  2WE9 A;  2J0X A;  3I5Q A;  4JCH A;  4H4K C;  2WB7 A;  2OEG A;  2GGO A;  3KIA A;  1Q0D A;  2RJ1 A;  3I0K A;  4HO9 A;  2P0N A;  4BJ6 C;  2XLE A;  3GAN A;  2D7R A;  1HW2 A;  4L41 C;  3G50 A;  1JV3 A;  5IDT A;  2VAS A;  2R7S A;  1ZYR F;  4IAQ A;  1Q0M A;  2A1D D;  1QLE C;  4CVH A;  1T6I A;  2YVK A;  5KYY A;  4K7B A;  4FAP B;  1BDJ B;  4BJ5 A;  2W9Y A;  5A6B A;  2V0K A;  2P7V A;  1VGZ A;  3K66 A;  3V5Y A;  1J8Y F;  3EHM A;  1ZJ1 A;  2CYD A;  1VYK A;  2KC3 A;  5FYE A;  1H7Q A;  4RBN A;  3JRT A;  2ICW G;  3USR A;  1H5S C;  1VZT A;  1YAU O;  3T7M A;  5A6J A;  1FZW A;  1TWC A;  2E3D A;  3G4Z A;  1LE4 A;  5J49 A;  1U0B B;  1MC3 A;  1GX0 A;  1MMN A;  5COM A;  1O0R A;  3NYL A;  2MWQ A;  1YDI A;  2VK9 A;  3DXJ F;  2PGV A;  1ORY A;  2EPM X;  3V0P A;  3PMR A;  2V0I A;  3TQD A;  2UUI A;  1JR8 A;  4MVZ A;  2J9V A;  1AEP A;  4MTO A;  3RMW A;  1O87 A;  4AC3 A;  4WGY A;  3DJ4 A;  1C02 A;  1H7L A;  3FOQ A;  1SMY F;  1EZI A;  1L7C A;  5EJ1 A;  5L0H A;  3Q80 A;  2O1F A;  4Y64 A;  2EIN C;  4JJG A;  3SXE A;  2KSF A;  2EIL C;  2OEX A;  2O1H A;  3L8J A;  3ABM C;  2RJ7 A;  3Q4S A;  3JYY A;  3WAQ A;  1VM8 A;  2KNH A;  4PFP A;  1VMA A;  4Q4Z F;  1TW5 A;  1LI7 A;  5A6A A;  2UX8 A;  2YL3 A;  3TK0 A;  1ZW3 A;  4JZA A;  3DKA A;  5GPG B;  5CQL X;  3O10 A;  1MMA A;  1LZI A;  3ZVR A;  4JE9 A;  3SXD A;  2JCJ A;  3EFO B;  3V7O A;  2YQJ A;  2Y3H A;  4NC3 A;  4C3B A;  3UMH A;  2XS1 A;  4KNR A;  1H5T B;  1ZIZ A;  2Q7R A;  2OJQ A;  4FCU A;  2VXM A;  3DM5 A;  1QPU A;  2W0W A;  4GEH A;  3B0U X;  2XWM A;  3AG3 C;  1Z7Q c;  5L0D A;  4XQ1 A;  1SS9 A;  1RMV A;  4FX5 A;  2P72 A;  2HKV A;  3IPM O;  3U0X A;  4PR9 A;  4NAI A;  1V83 A;  3L34 A;  2PA4 A;  2I15 A;  3U0Y A;  5C4B A;  1FXO A;  3B0V C;  2XRH A;  3EGD A;  2BE5 F;  3I0F A;  4EBB A;  4YT4 A;  2QY9 A;  4FRM A;  1FR8 A;  4B3U A;  4ARW A;  3DE8 A;  3N2Z B;  3N0T A;  2XM4 A;  3Q6N A;  3U2U A;  3GOD A;  2YLI A;  5KYY B;  2NUP A;  5E3C A;  4DJ9 A;  1R7U A;  4J18 A;  4MS2 A;  2FY7 A;  4C7O A;  2R03 A;  5KYN A;  1G0R A;  1FO9 A;  4EE3 A;  2QNL A;  1R5I D;  2GFH A;  3GEH A;  3NG1 A;  4B4B A;  2FFV A;  3BRJ A;  3L0I A;  1G5Z A;  2J9W A;  4GBP A;  3JZ0 A;  2WL8 A;  2WVM A;  2APC A;  3R2W A;  1BR4 A;  3RW0 A;  3RSB A;  5A6B D;  1D1C A;  3I0H A;  4Y6U A;  2CU2 A;  5EHH A;  3VAY A;  4LAC B;  1BZ4 A;  4HO8 A;  3EE5 A;  4I1M A;  1SR2 A;  2J0W A;  3ZIB A;  1O7O A;  1VPA A;  2P6V A;  4C3D A;  1NSG B;  4B4M A;  4EBJ A;  3AGU A;  2BO7 A;  5C36 A;  4AAW A;  5DS4 A;  4CJB A;  2OJE D;  3LNR A;  4RDA A;  1IZM A;  3PHF 2;  3M1C B;  2GA0 A;  3NKD A;  4Y7V A;  3IEE A;  2X65 A;  3TUL A;  5DQT A;  4DRI B;  1H4E A;  4EVW A;  1VK5 A;  2KJG A;  1Z23 A;  5L0F A;  1ZDF A;  5C3B A;  2BO8 A;  3GM1 A;  3U8P A;  2HJ3 A;  1JYK A;  1LS1 A;  3RKO F;  3ITF A;  3TQO A;  2UUH A;  1JVD A;  1R7V A;  1FMW A;  3W2V A;  1QGS A;  4CSA C;  3SXC A;  3R2P A;  4AK9 A;  5CI9 A;  3W2W A;  1JYL A;  1ZI3 A;  4CS7 A;  2EPN A;  1TZF A;  4AX2 A;  4E0H A;  4KPX A;  4JUR I;  3K33 A;  4QI2 A;  4U9E A;  4NCQ A;  1G8X A;  4G3P A;  3DWW A;  4AYJ A;  3VYW A;  4KNX A;  1L3P A;  2JCL A;  3EGD B;  1CPQ A;  2XME A;  3FMS A;  1LL2 A;  3QW1 A;  1ON6 A;  1WSZ A;  5D91 A;  2ZU8 A;  4ECM A;  3OEO A;  3EZH A;  3OKR A;  3IQ6 A;  1LIH A;  1OR2 A;  4CS8 A;  4P9F A;  4JRZ A;  5COF A;  3OAM A;  3KH2 A;  1O3U A;  1NU7 D;  2NUP B;  3OH3 A;  2Y3D A;  2Q00 A;  3Q7G A;  2HV7 A;  4C7O B;  4IWB A;  3H2U A;  4IJJ A;  4DRH B;  4AL1 A;  1NQI B;  4R32 A;  4XLP F;  5FU8 A;  4D11 A;  4YT8 A;  2HMZ A;  1H6G A;  1FNT c;  1LZ0 A;  4Y6N A;  3ATP A;  4P02 A;  1Z3I X;  2L6H A;  3CQZ A;  2P1A A;  1YAR O;  3K7D A;  3TJ6 A;  3O3P A;  4PJJ A;  4E1K A;  1A7E A;  3K8D A;  2Y6P A;  1Z5Z A;  2RD9 A;  2Z87 A;  2YKZ A;  1XWJ A;  3S29 A;  2MYS A;  2OKU A;  2OQM A;  2FYB A;  4M2A A;  3AG1 C;  4AE4 A;  1JV1 A;  3NMI A;  4CDA A;  4B42 A;  4U5E E;  2BO6 A;  1YA7 O;  2B0H A;  1V54 C;  1SF8 A;  256B A;  3DJU B;  2CW0 F;  3SXZ A;  5JSL A;  1D1A A;  2J45 A;  3GWN A;  4O6N A;  3KKB A;  5EK0 A;  3FDQ A;  2KK1 A;  1XHB A;  4YL1 A;  2CNW A;  3DK5 A;  3TJ5 A;  3LES A;  5C38 A;  5CQN X;  1D0X A;  4LER A;  1ORJ A;  1WTY A;  3CKN A;  3M4B A;  3NDB B;  3I0L A;  3O6X A;  4PK4 A;  5CQM X;  1ZCV A;  4CDV A;  1VGW A;  2YHS A;  3C62 A;  3AGT A;  3HKK A;  5CMI A;  4JD0 A;  1FXJ A;  4MTF A;  1GQ9 A;  3B71 A;  4PFO A;  1OKK A;  2RIX A;  3ABK C;  1QQ3 A;  1G2V A;  2VCC A;  3ABL C;  1VTM P;  1G8O A;  4DBQ A;  3PKP A;  1ZHY A;  1VIC A;  4JJF A;  3ZGG A;  1KU2 A;  1IIM A;  2RJ6 A;  2A68 F;  4I1O B;  2W0V A;  1ZHZ A;  3LJB A;  2A8U A;  2R7U A;  3NMJ A;  1VOM A;  3K6B A;  3ZQY A;  5FUH A;  1LS4 A;  3AG4 C;  3KPH A;  2YL1 A;  2EPL X;  3EG9 A;  3QZC A;  3U9J A;  4YL3 A;  5F5F A;  2VFZ A;  4JKV A;  4PJL A;  1G9R A;  1BR1 A;  2M64 A;  1Z90 A;  3LAY A;  2CDQ A;  1A0B A;  3ASO C;  1ZCY A;  2AU5 A;  3IQC A;  4HO5 A;  2YC3 A;  4P9T A;  3UNG C;  4LDR A;  1V55 C;  4D48 A;  4OIN F;  1GWV A;  5TJ5 E;  3FXH A;  3S84 A;  3I0I X;  3V0L A;  3SYN A;  2IYL D;  3LEV A;  2AGD A;  5CMF X;  4HFK B;  4J32 B;  2KYH A;  5E2Q A;  1ZU4 A;  3I0G A;  3HNI A;  2FGY A;  3ZF8 A;  5T3T A;  3BEH A;  4AE4 B;  5A6K A;  1FAP B;  2WVQ A;  3ZLK A;  1YA9 A;  2QLA A;  3S27 A;  5C48 A;  1H4C A;  2PP4 A;  4CS9 C;  1OMX A;  3DZA A;  4ZDQ A;  4D4N A;  4KC9 A;  4NQF A;  2J8W A;  3OWT A;  4G87 A;  2WGZ A;  3C8Z A;  2P73 A;  5L3V A;  1EI7 A;  4FCE A;  4MTG A;  1YYX A;  1QG8 A;  1SZI A;  3SX3 A;  5JVE A;  2ZU7 A;  3FHD A;  3W4Y A;  1FR9 A;  2EPO A;  2XL4 A;  4XEK A;  3K8E A;  2RIT A;  1EKY A;  2D4U A;  2J46 A;  2C03 A;  3S28 A;  2OI7 A;  4OIP F;  3US6 A;  1G1L A;  4HCQ A;  1T6U A;  2ZXW C;  2VCA A;  2CNW D;  1HY5 A;  1ZU5 A;  2R02 A;  4IRP A;  2AH9 A;  4R7P A;  4CJC A;  5FTS A;  3JTL O;  3T7N A;  1HV9 A;  2LQG A;  1PZT A;  4MVO A;  1T6Q A;  1VH1 A;  5FZT A;  3IHU A;  2RJ5 A;  2VCB A;  4MVM A;  1D0Z A;  4Z9J A;  3W8H A;  4KXO A;  5KYW A;  5C3D A;  3PDM P;  3CKJ A;  1E2X A;  3A9C A;  5L0C A;  2Y3G A;  2PF4 E;  4K1O A;  2MZB A;  1ZZP A;  3RYL A;  4L6R A;  5AJO A;  2HFI A;  2R7V A;  1LI5 A;  4ONS A;  1W55 A;  3C18 A;  4FWV A;  2WAW A;  3CEX A;  4DVZ A;  4MVQ A;  3EG9 B;  3H65 A;  2R7X A;  4BEM J;  5L3Q A;  3MFN A;  4KRV A;  1CGN A;  4FRO A;  2VH3 A;  3K1I A;  1U6H A;  2YL0 A;  1OQC A;  3C63 A;  4YT5 A;  3ZWI A;  1OR3 A;  2YES A;  1HJJ A;  3EGX A;  5C1L A;  1HM9 A;  4D0T A;  1VLT A;  3OGZ A;  4EEM A;  5FCL A;  1G97 A;  3CSK A;  4HG6 A;  5HS2 A;  5AC4 A;  1JPN A;  4YL0 A;  1YP2 A;  1IIN A;  4CJG A;  1VGU A;  3AQC A;  3U8V A;  4J30 B;  1QSP A;  1LL3 A;  2O1G A;  5E3A A;  2X5S A;  3U2T A;  3EQL F;  2KW3 C;  1OW6 A;  4I44 A;  4BJ6 A;  3SZR A;  3D8V A;  4LLC A;  2NPU A;  1M6T A;  4BPM A;  4K0D A;  3FAP B;  1HE9 A;  1WAT A;  3LLK A;  1EYR A;  3FVY A;  3HTK C;  1NF5 B;  1ZCT A;  3GM3 A;  3JCU Q;  4YT2 A;  5CQP A;  1RKE A;  2R9R B;  4RD9 A;  2RJ0 A;  2PX7 A;  1LL0 A;  1FGX A;  1S05 A;  3JSE O;  4O6Y A;  4KC1 A;  2NXV A;  1JMW A;  5C1H A;  3QVB A;  4Y7T A;  3C7J A;  2Y4L A;  3WHN A;  1H5S A;  2V0L A;  4FRP A;  4GYT A;  4YWQ A;  2ZPA A;  5CQO A;  1W2W A;  2XLO A;  3SNH A;  1TQG A;  4I3M A;  1H9G A;  2G3V A; 
#chains in the Genus database with same CATH homology
 3VYW A;  1G93 A;  4KNX A;  4ZLC A;  4CBE A;  2JCL A;  4XLN F;  2I5K A;  1S4N A;  1FWY A;  1TVY A;  2VS3 A;  3E25 A;  3EGD B;  1S4O A;  3N9W A;  3BRK X;  5FU0 A;  3SXG A;  2XME A;  3T7O A;  1LL2 A;  4HOC A;  1V82 A;  3F46 A;  1WT2 A;  4IRU A;  2W4B A;  3Q7L A;  3DD7 A;  4BJ1 A;  1TWH A;  2Y3B A;  2Y69 C;  1ON6 A;  1WSZ A;  5D91 A;  2ZU8 A;  4ULW A;  4FRH A;  1G23 A;  4U5C E;  4ECM A;  3OEO A;  3EZH A;  5DVW A;  2VSI A;  5T1D B;  1QWJ A;  3ST8 A;  5KYW B;  4EWC A;  3OKR A;  2FYA A;  3I0D A;  1OKK D;  3RFY A;  4CS8 A;  1H7E A;  3UGP A;  3OAM A;  2WVO A;  3KH2 A;  4FRD A;  5C4E A;  1OCR C;  5I1F A;  3SXA A;  1N1C A;  1NU7 D;  2NUP B;  2VD4 A;  3OH3 A;  4XTK A;  2Y3D A;  5CMH A;  2NUT B;  1FO8 A;  4ASY A;  2P6W A;  3Q7G A;  2HV7 A;  5KYU B;  4B6I A;  5CMG X;  4C7O B;  4IWB A;  1G95 A;  4U5D E;  1NMM B;  5AJP A;  5DLJ A;  2IXO A;  3B9Q A;  5BXC A;  4IJJ A;  2KGO A;  4EE5 A;  1NQI B;  2WZL A;  3V0N A;  1WT3 A;  3B0P A;  3CZ6 A;  4U5F E;  4N06 A;  4FIY A;  4OD5 A;  4XLP F;  5T3W A;  1H7F A;  4CS9 A;  2V3C C;  4NAK A;  4DEC A;  5FU8 A;  2IOQ A;  2YZS A;  4NY3 A;  4D11 A;  3E26 A;  4YT8 A;  3I0E A;  2EIJ C;  1LZ0 A;  2Y39 A;  4ZLD A;  4BG0 A;  4QI0 A;  4Y6N A;  2XWN A;  4P02 A;  1Z3I X;  2L9J A;  3CQZ A;  5FV9 A;  4P00 A;  4O7G A;  3K7D A;  5CI8 A;  3WG7 C;  3O3P A;  2AM3 A;  4PJJ A;  1W57 A;  4BJT A;  3V91 A;  4E1K A;  5C8R A;  5D92 A;  1MP5 A;  3CKO A;  3K8D A;  5IFY A;  3E70 C;  2Y6P A;  4DOZ A;  1FOA A;  2R7O A;  3EGX B;  1Z5Z A;  4OD4 A;  1VZU A;  2Y4M A;  2Z87 A;  3JUJ A;  5DDV A;  3TZT A;  5C4F A;  3JYH A;  3UGO A;  3OH2 A;  2W45 A;  3OH1 A;  1FFH A;  4D48 A;  1S7Z A;  1OCZ C;  2MYS A;  3S29 A;  2RJ4 A;  3DUV A;  4HO6 A;  2Y7A A;  4F4B A;  2R7R A;  2V0J A;  1RJ9 B;  2Z86 A;  2J7P A;  4HO2 A;  1PD0 A;  4BJ5 C;  4LW6 A;  1D1B A;  2JCK A;  1FRW A;  5EJZ A;  4OIO F;  2FYB A;  4M2A A;  3V8Y A;  3AG1 C;  5C49 A;  3MX3 A;  5DQZ A;  3ZG1 A;  4AE4 A;  5B3S C;  5BUO A;  2DPW A;  1JV1 A;  3V0M A;  4JW1 A;  3LLI A;  4B42 A;  4U5E E;  2ZU9 A;  4KNV A;  2DGJ A;  4QDL A;  1WT0 A;  4MIX A;  4X0R A;  3CKQ A;  4B2W A;  2VS5 A;  1FFT C;  2BO6 A;  2E8B A;  5C47 A;  4JIS A;  3FAJ A;  1ST6 A;  2QKX A;  1V54 C;  2H7V C;  2A69 F;  3EH2 A;  1SF8 A;  3DJU B;  4XWJ A;  2WVN A;  3DMD A;  2OG2 A;  3E9V A;  2CW0 F;  2OEF A;  1ZHT A;  1GA8 A;  3IOJ A;  3POL A;  4HO4 A;  2Y4J A;  3CKV A;  5FTV A;  1D1A A;  2J45 A;  4G7H F;  3RMV A;  3U2V A;  4EE4 A;  2PFD A;  3KKB A;  4O6N A;  3FDQ A;  3HL3 A;  2DYR C;  2Q4J A;  2AES A;  3K1I C;  1KWS A;  1LZJ A;  3JUK A;  5JQQ A;  2FFH A;  2BO4 A;  1ZHJ A;  1XHB A;  1I52 A;  1NZE A;  2D7I A;  1LVW A;  2CNW A;  1H5R A;  5DDT A;  4IAO A;  4Q5S F;  1R80 A;  3DK5 A;  3I4U A;  3LES A;  1ZJ0 A;  5C38 A;  2J0A A;  4DVY P;  3EFO A;  4PJM A;  1QGQ A;  5CQN X;  2YEV A;  2Q3T A;  1G3L A;  1PCX A;  2PX0 A;  1H4D A;  1R81 A;  5L6S A;  1D0X A;  1MP3 A;  2J0B A;  3U2W A;  2VB6 A;  4KNW A;  4LER A;  3USQ A;  4M63 A;  1YRO B;  3I0J A;  3ZSU A;  1OQM B;  1R7T A;  4ASJ A;  1H5T A;  4G3Q A;  3CKN A;  2RIZ A;  4FRA A;  4WJ0 A;  1VZX A;  3NDB B;  1ZI4 A;  1HM8 A;  4U5G A;  2XXA B;  3I0L A;  3T4R A;  3GUE A;  3SX7 A;  2WE9 A;  1ON8 A;  3O6X A;  4PK4 A;  1VGT A;  2Q9C A;  2J0X A;  2O9X A;  3I5Q A;  4JCH A;  4H4K C;  1FG5 N;  1H5S B;  3X1O A;  1VGW A;  1ZCV A;  2QH5 A;  2YHS A;  2GGQ A;  2WB7 A;  2OEG A;  3SX5 A;  5IY5 C;  2GGO A;  2J9U A;  1YP3 A;  1HJL A;  3KIA A;  5CMI A;  1OCO C;  1S4P A;  5DS6 A;  4JD0 A;  2RJ1 A;  4UEG A;  1FXJ A;  3I0K A;  1GQ9 A;  1LZ7 A;  4HO3 A;  4XWI A;  4KQL A;  4PFO A;  1OKK A;  2I5E A;  3ABK C;  1D0Y A;  2RIX A;  4HO9 A;  1E5K A;  1PD1 A;  3F47 A;  3K1H A;  5CMJ A;  4BJ6 C;  3GAN A;  2D7R A;  1G2V A;  3ABL C;  3PKQ A;  3HJC A;  4A2N B;  3IOH A;  4L41 C;  3MLG A;  1JV3 A;  4JVS A;  3SP1 A;  1WVC A;  5IDT A;  1G8O A;  2VAS A;  2FYC B;  2Q9B A;  4DBQ A;  4HFF B;  3PKP A;  2R7S A;  1ZYR F;  3DM9 B;  4LW3 A;  4Y7U A;  1ZHY A;  4G3S A;  1VIC A;  4JJF A;  2A1D D;  1QLE C;  3OH0 A;  3ZGG A;  1KU2 A;  1IIM A;  2RJ6 A;  1QZX A;  4CVH A;  3BCV A;  2YQC A;  2A68 F;  3NYJ A;  5KYY A;  4I1O B;  4K7B A;  2RIY A;  2W0V A;  1ZI1 A;  4BJ5 A;  3EZI A;  4FRE A;  1ZHZ A;  2W9Y A;  3LJB A;  2V0K A;  2R7T A;  5C1G A;  1PZY B;  2P7V A;  1VGZ A;  2A8U A;  2X5Z A;  2R7U A;  3K66 A;  1ZJP A;  2OCC C;  1J8Y F;  3EHM A;  1VOM A;  1ZJ1 A;  3K6B A;  3N24 A;  2A6E F;  1VYK A;  3LS0 A;  3Q6M A;  2ICY A;  3HLZ A;  3NKE A;  1BR2 A;  3JT1 A;  3NRH A;  2W4M A;  2VXL A;  4O6M A;  5FUH A;  4PJN A;  1TWG A;  3AG4 C;  1VH3 A;  5FYE A;  4MYB A;  3EG9 A;  3QZC A;  1H7Q A;  4RBN A;  3JRT A;  1INJ A;  4C2S A;  3EHN A;  1WT1 A;  3USR A;  1H5S C;  1VZT A;  3JTJ A;  3T7M A;  3V0Q A;  1FZW A;  1TWC A;  3S0X A;  2E3D A;  5J49 A;  5F5F A;  2VFZ A;  5AJN A;  3WOD F;  4PJL A;  1G9R A;  1MC3 A;  1GX0 A;  1BR1 A;  1MMN A;  1MP4 A;  1O0R A;  1TKN A;  3CU0 A;  1R82 A;  4DBR A;  3NGW A;  4W8K A;  3NYL A;  2MWQ A;  1VYI A;  3LAY A;  1ZCU A;  1Z90 A;  2A8W A;  2CDQ A;  2WZG A;  3QMK A;  3FWW A;  1OCC C;  3LW6 A;  4D0Z A;  3ASO C;  2VK9 A;  3DXJ F;  2PGV A;  1ZCY A;  1Z63 A;  2YCM A;  3SEO A;  4HO5 A;  3V0P A;  3PMR A;  2V0I A;  2YC3 A;  2XSE A;  1M2V A;  3TQD A;  1MMD A;  3UNG C;  2OI5 A;  2J9V A;  4G7O F;  2JD3 A;  3SX8 A;  1V55 C;  4MQ9 F;  2AM4 A;  2EIK C;  3W8I A;  4FRL A;  1TWA A;  3RMW A;  1O87 A;  4OIN F;  2B0J A;  2IXN A;  1GWV A;  3F1C A;  3V8Z A;  4AC3 A;  3ECS A;  3DJ4 A;  4CSA A;  3I0I X;  3V0L A;  3SYN A;  2IYL D;  3LEV A;  2AGD A;  1K4V A;  5CMF X;  2H7O A;  4HFK B;  2ICX A;  1H7L A;  4J32 B;  3FOQ A;  1SMY F;  5E2Q A;  1EZI A;  1ZU4 A;  3I0G A;  3DAF A;  2FGY A;  4CS8 C;  1GX4 A;  3ZF8 A;  4NAN A;  5EJ1 A;  3Q80 A;  5T3T A;  4AE4 B;  2EIN C;  2PX3 A;  4JJG A;  1ZJO A;  2FFU A;  2O1F A;  4Y64 A;  2XMH A;  2EIL C;  4C3E A;  5EIY A;  1J8M F;  2O1H A;  3ABM C;  2RJ7 A;  4Y7G A;  2WVQ A;  1NG1 A;  3Q4S A;  3SXE A;  3T6J A;  5EGY A;  4FQW A;  1OMZ A;  3ZLK A;  1VM8 A;  1R7Y A;  1XZ6 A;  3U2X A;  2KNH A;  2D5R B;  4PFP A;  3S27 A;  1VMA A;  5C48 A;  2ZXR A;  1H4C A;  2J7P D;  3UMK A;  5KYX A;  2PP4 A;  4Q4Z F;  4CS9 C;  1TW5 A;  3F1Y A;  4KC4 A;  1OMX A;  3ZGF A;  4D11 C;  4BEJ A;  2UX8 A;  3DZA A;  1INI A;  3SPT A;  4ZDQ A;  4JZA A;  4KC9 A;  3X2Q C;  3PNN A;  3UR3 C;  1FMV A;  3OWT A;  4G87 A;  4DE7 A;  2WGZ A;  5CQL X;  5IDS A;  2P73 A;  2D0J A;  1MMA A;  5L3V A;  3D5N A;  4G3P A;  1M2O A;  2HV6 A;  1LZI A;  1H5R B;  2QTV A;  3ZVR A;  4OIQ F;  1R7X A;  4FCE A;  3SXD A;  4G0H A;  4Y62 A;  2JCJ A;  1QG8 A;  1SZI A;  3EFO B;  3V7O A;  3SX3 A;  3EJN A;  2YQJ A;  2Y3H A;  3ASN C;  2ZU7 A;  3FHD A;  1FR9 A;  4HE8 D;  4C3B A;  4YJW A;  3UMH A;  2XL4 A;  2YC5 A;  3K8E A;  4KNR A;  1H5T B;  1ZIZ A;  2RIT A;  4FCU A;  2I7B A;  2VXM A;  2ZXO A;  5F5H A;  3DM5 A;  4HO0 A;  2W0W A;  2J46 A;  2C03 A;  1O23 B;  3S28 A;  2OI7 A;  4GEH A;  3B0U X;  4EEG A;  4OIP F;  2AM5 A;  1ZDG A;  3AG3 C;  2XWM A;  1MMG A;  1G1L A;  4HCQ A;  1SS9 A;  2ZXW C;  5L6V A;  3DJN B;  3OA1 A;  4FX5 A;  2CNW D;  4M2B A;  1NHE B;  2P72 A;  3U0X A;  1ZU5 A;  4LLE A;  2L81 A;  2DYS C;  2Z15 A;  3L34 A;  1V83 A;  2PA4 A;  1GQC A;  2AH9 A;  4IRP A;  4NAI A;  2CGE A;  4R7P A;  4CJC A;  3U0Y A;  4MND A;  5FTS A;  5C4B A;  2VSH A;  3T7N A;  1FXO A;  3B0V C;  2XRH A;  3EGD A;  2PGY A;  2BE5 F;  1HV9 A;  1Z6A A;  1PZT A;  2NG1 A;  4YS8 A;  1H5S D;  3EH1 A;  1VH1 A;  3I0F A;  3TD7 A;  4EBB A;  4YT4 A;  2RJ5 A;  3UMI A;  2QY9 A;  1ZI5 A;  5C4D A;  1NWG B;  1D0Z A;  5C4C A;  1TW1 A;  4FRM A;  4KPZ A;  1FR8 A;  5B1A C;  2G3K A;  1FTS A;  3W8H A;  2RJ9 A;  3NYM A;  5KYW A;  4KXO A;  4NAL A;  4B3U A;  1IW7 F;  5C3D A;  4ARW A;  1ZHW A;  3N2Z B;  3CKJ A;  3N0T A;  2Y3G A;  2AEC A;  5B1B C;  2WVL A;  3Q6N A;  4U5H A;  1H7G A;  3KMI A;  2PF4 E;  3GOD A;  5KYY B;  3U2U A;  2NUP A;  2MZB A;  5E3C A;  3RYL A;  1ZHX A;  1R7U A;  4J18 A;  2R7Q A;  2NUT A;  3ZLL A;  1V84 A;  4FIX A;  5AJO A;  5KYU A;  2FY7 A;  4FRQ A;  4C7O A;  2R7V A;  4Q7C A;  5KYN A;  1ZJ2 A;  2YQH A;  1G0R A;  1FO9 A;  4BMA A;  4EE3 A;  5E33 A;  4BQH A;  2GFH A;  1W55 A;  3OC9 A;  3NG1 A;  3CGX A;  4B4B A;  2YQS A;  2I8B A;  4FWV A;  2WAW A;  2FFV A;  1NU9 C;  1TR2 A;  4DVZ A;  1O7Q A;  3EG9 B;  3H65 A;  3L0I A;  2R7X A;  2J9W A;  4GBP A;  4M28 A;  2WL8 A;  5L3Q A;  3O39 A;  2AE7 A;  3AQB A;  2X60 A;  4KRV A;  2XWL A;  4DDZ A;  4FRO A;  2WVM A;  2APC A;  3R2W A;  1BR4 A;  3RSB A;  2VH3 A;  1YP4 A;  2WEE A;  1D1C A;  4Y63 A;  4E7S A;  3I0H A;  4Y6U A;  3V90 A;  4YT5 A;  2M4E A;  1H7T A;  2CU2 A;  5EHH A;  2WVK A;  3I5P A;  3VAY A;  4B2X A;  1LKX A;  4LAC B;  2YES A;  1HJJ A;  3EGX A;  3RIP A;  4HO8 A;  5C1L A;  3EE5 A;  4P6I C;  4U5B E;  2ZXP A;  4I1M A;  3D98 A;  1HM9 A;  4D0T A;  1LVK A;  1M2V B;  2J0W A;  3ZIB A;  1O7O A;  1VPA A;  3LS1 A;  3OGZ A;  1RJ9 A;  3SXB A;  5FCL A;  1G97 A;  3KL4 A;  4EEM A;  2JCO A;  2P6V A;  4C3D A;  3CSK A;  2IXM A;  4HG6 A;  5HS2 A;  4B4M A;  2G62 A;  5DS5 A;  1JPN A;  2LSE A;  5HSW A;  1YP2 A;  4CIH A;  2C0N A;  1IIN A;  2BO7 A;  5C36 A;  4KBL A;  1VGU A;  3V0O A;  3AQC A;  4AAW A;  5DS4 A;  2OI6 A;  2RJ8 A;  4CJB A;  3AG2 C;  4J30 B;  2R7W A;  3DAG A;  3EPV A;  3LNR A;  4K6R A;  4EEA A;  4RDA A;  4KT7 A;  1IZM A;  1LL3 A;  2O1G A;  2IXP A;  3PHF 2;  3M1C B;  1HM0 A;  5E3A A;  4HEA J;  2X5S A;  3I0C A;  5CQM X;  1ZJ3 A;  4OIR F;  3EQL F;  3NKD A;  3OH4 A;  3IEE A;  2KW3 C;  4FRB A;  4I44 A;  4Y7V A;  3U2T A;  4BJ6 A;  3T6B A;  1NKH B;  3SZR A;  2X65 A;  4LLC A;  3D8V A;  3IOI A;  5DQT A;  2EIM C;  4EEO A;  1JPJ A;  5KYX B;  2FYD B;  1H4E A;  2A6H F;  4EVW A;  4K0D A;  1VK5 A;  2KJG A;  1Z23 A;  3LLK A;  1EYR A;  3FVY A;  1MND A;  3HTK C;  1ZDF A;  5C3B A;  4E7Z A;  1M57 C;  3POV A;  1NF5 B;  1ZCT A;  2BO8 A;  1MNE A;  4AYL A;  3R3I A;  4KI2 A;  5C3A A;  3JSZ A;  3JCU Q;  4YT2 A;  2KQ9 A;  5CQP A;  1JYK A;  1WGW A;  4Y7F A;  1LS1 A;  4RD9 A;  1W77 A;  2RJ0 A;  3RKO F;  3ITF A;  1H7H A;  1LL0 A;  2PX7 A;  2WZF A;  4G7Z F;  1FGX A;  2H7B A;  4KC2 A;  4Y9X A;  2C04 A;  4O6Y A;  1JVD A;  2Y4K A;  1R7V A;  1FMW A;  2QGI A;  4KC1 A;  3W2V A;  2NXV A;  4B4G A;  1QGS A;  2V26 A;  4CSA C;  3Q7U A;  4O79 A;  2XXA A;  3QVB A;  4IRQ A;  5C1H A;  2E87 A;  4Y7T A;  3SXC A;  3ZC4 A;  1FGG A;  4AK9 A;  5CI9 A;  3W2W A;  2Y4L A;  1JYL A;  1ZI3 A;  1H5S A;  4AYJ A;  4YN0 B;  4CS7 A;  2V0L A;  1TZF A;  1GWW A;  3RH3 A;  4FRP A;  2V0H A;  4AX2 A;  4GYT A;  4YWQ A;  4KPX A;  4M4K A;  1JVG A;  4B5B A;  4CJ8 A;  4JUR I;  2Q9A A;  2X51 A;  1H3M A;  3K33 A;  1M56 C;  4QI2 A;  2ZPA A;  5CQO A;  4FES A;  1W2W A;  4ANJ A;  3SNH A;  1G8X A;  2VS4 A;  4I3M A;  1O5H A;  2G3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...