5D92A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
342
structure length
340
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 107
structure length 340
sequence length 342
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d92A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d92A01
4O6MA 5D92A 5D91A 4MNDA 4Q7CA 4O6NA
chains in the Genus database with same CATH superfamily
2FYCB 2PP4A 2ZU8A 1FTSA 1T9KA 2TMVP 1AVOB 4KC4A 2MWQA 5IY5C 1LIHA 3I0EA 1G3LA 3SNHA 1MQVA 2OI5A 1O7OA 2J9VA 4AYJA 3MYIA 1JOGA 5GPGB 4YK5A 2RIXA 1ZJPA 4LACB 1VTMP 1ZJ1A 4Z9HA 2V0HA 1MP5A 2VK9A 4HEAJ 4E0IA 3ZSUA 5CQPA 4H4KC 2Q9BA 4AAWA 2BO4A 1D1BA 1EQ1A 1VZUA 4I44A 3QW1A 3D5NA 5DS5A 2NPUA 2Y3DA 1PD1A 2ZU7A 3DE9A 1Z3IX 4ASJA 4DRIB 3TK0A 4PJMA 1ZHTA 5L0GA 1OCZC 4LLEA 1HJLA 5KYYA 3PKQA 5FTSA 4FAPB 4IAOA 1EKYA 2HSBA 4Y62A 4PK4A 4JTCB 2H7OA 1YP2A 3LEVA 3LLIA 3EH2A 5C1GA 4D11C 5TJ5E 1JVGA 2Q7RA 1G2VA 4CBEA 1T01A 5JUAA 1H5SD 4EE5A 1ZJ2A 3IQ6A 4IWBA 5F5FA 2CCYA 1Q0DA 3DM9B 3ZTMA 1ZVZA 4Y7TA 1QZXA 3OH3A 4P6IC 2LK4A 4KNRA 2IXMA 3OEOA 1YA9A 3TJ5A 4CX9A 2I8BA 3IOHA 3S0XA 5T1DB 2ZXRA 3RVYA 1G1LA 1R81A 2XWMA 3M4CA 1FFTC 1CGOA 4IJJA 5EHHA 4HFKB 4NQFA 3Q7UA 5HSWA 2E87A 4BMAA 1K40A 3EZHA 2LQGA 4MW8A 3ZGFA 1QSPA 3UMHA 4BEJA 2CW0F 3GORA 2QLAA 3K1IC 3AQCA 1YJGA 4E7ZA 2AP3A 2FAPB 4MW3A 5A6KA 3OWTA 1OXBA 2CYDA 2OKUA 1MNDA 2EPLX 4B2WA 2HV7A 3MYFA 1H5RA 4LDQA 2LFFA 4KPZA 1O7QA 3I5QA 1VGWA 2VD4A 1V74B 2A6HF 2O1FA 3ZLLA 4G87A 1NFOA 3UGPA 2PX0A 4FROA 3A11A 4KNVA 2ASRA 1DOWA 4LERA 5HS2A 1BDJB 4NCQA 3W8IA 2Q4FA 2JCKA 1GA8A 3PCVA 2X5SA 5DS4A 1TWCA 4D11A 1UFBA 1W77A 2P72A 4UDVA 3ZVRA 3U2TA 2RIZA 4FCUA 2R05A 1INIA 4PJLA 1TFKB 1LZIA 2AWCA 1LKXA 2L9JA 4FRHA 1FXOA 4K1OA 4FRLA 1S7ZA 3EQLF 1I5NA 1TWAA 1OKKA 5EJ1A 4EBJA 3R7CA 3ZQYA 1T6QA 2V0JA 3FOQA 1K4VA 3I0KA 3V5YA 4N6HA 1CGME 4BJ5C 5L3VA 3EH1A 1MMDA 5JT4A 2J9WA 1VZTA 3KL4A 4MTFA 4CDYA 2OG2A 3RSBA 5FV9A 2OI6A 4KC9A 1RMVA 1EI7A 1H3MA 2RIYA 3L1MA 2AE7A 5C3DA 5COGA 3K1IA 3FDQA 4M4KA 3W4YA 2B0HA 4CIHA 4P9TA 2WVLA 1NFNA 3OH0A 1TFOB 2MHRA 2FYBA 2RJ0A 3HL3A 2LSEA 1AUEA 2XLMA 5C4FA 5L6SA 2ETSA 3U2VA 1Y6DA 4HO3A 5AJOA 3VRCA 4DVZA 3S84A 2Y7AA 4U5GA 4XPWA 1ZDGA 4CJ8A 4UEGA 3NKDA 3K1HA 2RSEB 1WSZA 2Q00A 1ZCTA 1GGQA 2UUIA 2Y3BA 4EKWA 4WGZA 3B0PA 4IAQA 3DUVA 2V26A 1YROB 3AGTA 3UMKA 2A8UA 1QPUA 5A6BD 5C1LA 1C17M 2Q9CA 2XL6A 1INJA 4Y63A 5KYWA 4IGGA 3TJ6A 4AE4B 4HFFB 2Y3HA 4B42A 4H54A 2NUTA 4GQHA 2PF4E 4E1KA 4FESA 2Y69C 1VH1A 3ASNC 2VXLA 2YL3A 5C3BA 4DE7A 2R7VA 5JLIA 2HJ3A 4JZAA 3L8JA 3O6XA 5E3CA 3RQEA 2WVOA 1RKEA 2KQ9A 4C7OB 2VC9A 2VFZA 2WVQA 3ECSA 3U2LA 1GQ9A 4M28A 1Z5ZA 1TW1A 3SXEA 2EPOA 2MYSA 1G5ZA 4W8PA 2Y4MA 2AU5A 3PDMP 2RJ4A 4WABA 3NMKA 2HSQA 1MP3A 1Q0GA 3ZDLA 3CAXA 3CGXA 1VH3A 2YHSA 1ZHJA 2P1AA 1NQIB 2ICWG 4BJ1A 5BQIA 3GM2A 4X0RA 1CGNA 5C4CA 1AEPA 2AH9A 4EIYA 3U5SA 4BG0A 1TR2A 5DVWA 3SX7A 1IIMA 2CNWD 3HTKC 4FIYA 3KKBA 5JP7A 2WVNA 1H7GA 4JC7A 4ARWA 4Y7UA 5B3SC 1XZPA 2V0KA 1G4WR 4I1MA 1H6GA 1OQCA 3CU0A 3TQDA 1JAFA 2BC5A 3IEEA 4K0DA 4JURI 1ORSC 1LL3A 5CQOA 4Z9JA 1J8YF 4JD0A 1YYXA 1ZHZA 3CKOA 3MLGA 3V7OA 2L6HA 2P0NA 2Z87A 3JUKA 5CIVA 4EE3A 2J9BA 2GDCA 1RXQA 4NAKA 3V5ZA 1FAPB 2IYLD 4U9EA 4BJ6C 4QI2A 2J45A 4EEGA 4NAIA 3DJUB 3V90A 4C7OA 4QDLA 3V8YA 1YVIA 3GEEA 3I4UA 2BO8A 1VLSA 1FO8A 4HO4A 3LW6A 1NZEA 1N1CA 1R7UA 3USRA 2AM4A 3W2WA 3Q7LA 2R7QA 3LEOA 3HNIA 1GWVA 2V0LA 4CS8C 1ZW3A 2ICYA 4K6RA 4U5BE 4BJTA 2XL4A 1ZCYA 2JCOA 1JV3A 2XLDA 2R7XA 2E8BA 4J18A 3S29A 3RMVA 3C8GA 4CJOA 3PHF2 2YVKA 2WE9A 2XLWA 4O79A 4P02A 4O7GA 1FZWA 4AL1A 1R82A 4IB4A 2VSIA 2VH3A 3ZGGA 1HW1A 3M15A 2I15A 4U9DA 2YQHA 2XM4A 3OH2A 3C18A 3GWLA 2EINC 4YT2A 4M2AA 1ZU5A 2YZSA 2WZLA 2QTVA 4AX2A 1HE1A 5EJZA 2XRHA 3HNJA 5D91A 3NMIA 1K05A 5IFYA 3ATPA 5JSLA 2VCBA 1KTMA 2DPWA 2GGQA 1BBHA 2XXAA 4NY3A 4NTBA 2A68F 2JPUA 1LZ7A 4BJ6A 1LE4A 1PCXA 1WTYA 5L0FA 3J06A 3GWNA 3GODA 1OXKA 2FFUA 4ZLCA 2R02A 3V0LA 2R7WA 3SZRA 2YESA 3Q6MA 1EYRA 4EE4A 1SYQA 2XLEA 2OQMA 3JSEO 4D4XA 1ZZPA 1FG5N 3ABKC 4XTKA 1Z63A 1ZJ3A 4AL0A 1V54C 1H7IA 4PJJA 4MIXA 2HZ8A 1T5OA 5IDTA 1LS1A 3HNKA 4CS7A 5C3AA 1Q0MA 2VB6A 3RYLA 1IW7F 4OINF 3I5PA 4GYTA 3F47A 3ZWIA 2L81A 4KT7A 3EFOB 1VYKA 3F1YA 4BPMA 2YLGA 1R7TA 4DJ9A 1V4AA 3WAQA 4U5HA 2W45A 5KYUA 4OIQF 2RD9A 1GQAA 3B9QA 2PFDA 5FZTA 3NYLA 2YQYA 3V0QA 4E7SA 3HLZA 4KRVA 2WAWA 3UNGC 2VS3A 1EA8A 3FMSA 3AJMA 2C0NA 1HJJA 4CS9C 1ZDFA 2Q4JA 1D1AA 1H5RB 3V0OA 2P6VA 2PGVA 1A7VA 4Z9IA 1QLEC 4MVSA 3SXMA 2XWLA 4P9FA 2XS8A 4P00A 4ECMA 1QWJA 4ASYA 4KPXA 2AM3A 1G95A 3JTJA 3ITFA 1H7FA 2P6WA 1TZFA 4U5EE 2HS5A 2FFHA 1LVWA 3N0TA 1CPQA 1NKHB 5DQZA 3K6BA 1NWGB 2XMHA 5F5HA 1HV9A 3DI5A 4J7TA 3KPHA 1SF8A 1H5SC 1I4ZA 2Q3TA 2ZXOA 2OU6A 3DD7A 4FX5A 3Q80A 1IZMA 4BQHA 3G4ZA 2NSGA 2J46A 2I5EA 3BCVA 1ON6A 4DVYP 4ULVA 3POVA 1FMWA 3DXJF 4R32A 1VGUA 1ZYRF 1T6UA 3EFOA 5DDTA 4FREA 1C02A 1V83A 4J32B 3AGUA 3FHDA 4HOCA 1YAUO 2NG1A 1LZJA 1KNYA 4EEOA 4E17A 2R7TA 3DMDA 1GQCA 3NYJA 3AG3C 4JW1A 5AC5A 4XEKA 2XLOA 3DWWA 4CS9A 3B29A 1MC3A 5C4EA 3MFNA 3AG2C 3W8HA 2YQJA 1FR9A 2FY7A 2BE5F 4KXOA 1FR0A 3QMKA 3E26A 1OR2A 1ZJOA 1ZHXA 4I1OB 4PFPA 3DK5A 4HE8D 4DBRA 1WATA 3E25A 3RMWA 3S90A 4YN0B 1JPNA 1QGQA 3LNRA 1WWPA 1U89A 1FOAA 3TZTA 2XSEA 4JEAA 1W55A 2AM5A 1H5SA 5CMHA 3SP1A 4YL0A 2DYSC 2V3CC 1NHEB 5KYNA 4JEBA 5B1BC 3K33A 2Y4LA 3U9MA 4FRQA 2P61A 4EHPA 4DBQA 1HM9A 3QTHA 2FYAA 5FCLA 5F28E 3ZIBA 5KYWB 2KYHA 4HCQA 2NUTB 1M57C 4MTGA 4BEMJ 1WVCA 3DJ4A 4FQWA 5L0HA 1YLMA 1VGZA 2AECA 1GS9A 2WVKA 2UUHA 1R7XA 2KK1A 4XQ1A 2VSHA 2L7AA 4LDRA 4QI0A 4XEFA 1ST6A 2GAQA 4DRJB 3H65A 2RJ5A 3PNNA 1NU7D 1V84A 1G97A 3SXAA 3OGZA 1VPAA 4Y7GA 1RKEB 2YL1A 3MBGA 1RJ9A 1Z6AA 4D0ZA 5FU8A 2X0CA 2D5RB 1FGXA 3VM6A 2G3KA 4FRPA 1DOVA 4ONSA 1B68A 2ZD9A 2ZPAA 4XLNF 1ZI5A 1ZJ0A 1TWHA 4YJWA 2A69F 4E18A 1JYKA 3I0CA 2NXVA 2IXNA 1G23A 4YWQA 3F1CA 2RJ7A 3EPVA 3H2VA 2R7RA 1VK5A 4CDAA 5L0JA 1E84A 3RFYA 5EIYA 2E3DA 2MZBA 2WEEA 3R2WA 1W57A 2O9XA 3U3BA 2OEFA 2KSFA 3SXKA 4JTDB 1H9GA 1H7LA 2ZXPA 4AC3A 2W0WA 3JZ0A 5CQLX 1LM3B 3S9OA 3IOJA 1ZHYA 4BJ5A 3K7DA 1D0ZA 4ER9A 3SEOA 2OEVA 4CJGA 3ASOC 1Q0FA 3POLA 3LJBA 2IBFA 2EPKX 4KI2A 3EG9B 3S28A 1QVXA 2D0JA 4B4MA 2AGDA 4CVHA 1QG8A 4HO2A 2I5KA 1PV3A 1JR8A 3T7MA 3TOLA 1MP4A 4OD5A 2QY9A 2CU2A 1YA7O 5BXCA 1G4US 2FFVA 2O1HA 3N2ZB 5DDVA 1WT0A 1YARO 2WZFA 3R3IA 1H4EA 2OEXA 2J7PA 5JVEA 1HE9A 2F22A 1KU2A 3C8GB 1H4DA 4EEAA 1OCOC 3FWWA 4Y7VA 1ZI1A 1RCPA 3IQ5A 3X2QC 5C4DA 5T3TA 2H7BA 1A7DA 1JRAA 4Q7CA 3ZG1A 4KQLA 2L6GA 2QH5A 2BL2A 4KBLA 5A6BA 3V0MA 1E5KA 2VS4A 3ABMC 3N9WA 4YT4A 4KNWA 1XZ6A 5L6VA 2EPMX 5FUHA 3DE8A 4G3SA 3C8GD 3OA1A 2IXOA 2YQSA 1G8XA 1LL2A 4MQ9F 1GWWA 5FTVA 1BZ4A 5CQNX 4IRUA 4K7BA 4U5DE 1XWJA 3U9JA 3VF0A 1ZCVA 2RITA 3RVZA 2RJ1A 4NTAA 2XXAB 1R7YA 4PR9A 3LS1A 3DAGA 3RIPA 5A6AA 2PA4A 1QQ3A 3Q7GA 5BQGA 4J7YA 2Z86A 3EG9A 4IARA 3L8IA 4FWVA 2ZXWC 1M2VB 1D0XA 3E9VA 3I0IX 3FOPA 2NUPB 2VS5A 1A7EA 4A4AA 4J30B 2V0IA 5C8RA 3C7JA 1LPEA 4ANJA 3ZC4A 1H7HA 1ON8A 1SMYF 2EIMC 4RDAA 3U8PA 4D4NA 3I0FA 3ZQVA 4W8KA 2VCCA 2VASA 4KNXA 2A6EF 2VCAA 3S27A 3CQZA 1YP3A 2JCJA 4HO9A 4JJGA 3PKPA 1ORYA 3FAPB 3RW0A 4MVMA 1Z90A 5KYUB 4FIXA 4C3DA 2LFDA 1NF5B 3A9CA 3CKQA 2J0XA 5CI8A 1YZCA 3ZTZA 2WL8A 1U6HA 3AQBA 4A2NB 3EE5A 4LW6A 2HUJA 1NU9C 1SR2A 4B4GA 1ZI3A 2C03A 3GANA 2YL0A 3U0CA 1R7VA 5E2QA 1LI5A 4L6RA 1NBBA 3OC9A 3EJNA 3C63A 1JVDA 3WHNA 5C4BA 5C47A 1D0YA 4LLCA 1OW7A 1FXJA 4JRZA 4MVUA 4NALA 3RQGA 3O39A 2YEVA 2H7VC 4RBNA 2YC5A 3GM3A 1M2VA 1OW8A 4PJNA 1OMXA 3BEHA 2OI7A 2NUPA 4LW3A 2NSFA 2X65A 1O23B 3D8VA 2PX3A 2KGOA 3JTLO 3OH4A 5L3QA 1T6IA 4CS8A 1J8MF 3B0UX 1VGTA 2BO7A 4I3MA 4B4BA 2J0AA 1M6TA 2YQCA 5D92A 2X60A 1TVYA 1UG7A 3CEXA 1Z7Qc 3OH1A 1PD0A 4XLPF 2XM0A 1U0BB 2A1DD 3M4BA 2FYDB 3JT1A 3NRHA 2W4MA 1H4CA 3FAJA 3B0VC 1KWSA 3TOMA 1LI7A 3U2UA 1WN0A 3I0LA 4YT8A 1NG1A 3DJNB 1FRWA 5AJNA 4D0TA 3AOUA 3Q4SA 4Q5SF 4E0HA 4F4BA 1GX0A 2UX8A 1VLTA 3LUTB 3NKEA 3NDBB 4FRBA 1VYIA 1NSGB 2R7UA 3NMJA 1XZQA 3DZAA 2P73A 1BR4A 3JCUQ 2XL8A 1OQMB 2G3VA 2Y39A 1M2OA 4AYLA 2R9RB 1ZCUA 1H5SB 1HMDA 5L0DA 1G93A 3RH3A 3V0PA 3U0YA 2X5ZA 2QE9A 4FRDA 1WGWA 3JRTA 3CKNA 3KYJA 4ZDQA 1Z23A 1ORJA 2YRFA 3E70C 2EPNA 4YL3A 4OIPF 3SXGA 4KC2A 2FGYA 4EBKA 4RD9A 2J0WA 3T7NA 4N6CA 4JJFA 4DOZA 1QKRA 3C8ZA 3CKJA 4YT5A 256BA 2PBEA 3F46A 4HO5A 4O6MA 2OEGA 3L34A 3B71A 1O0RA 3SXZA 3LLKA 2XLHA 3CZ6A 3VAYA 4EWCA 2QGIA 1G8OA 1TW5A 1OKKD 3IQTA 2D7RA 3N24A 5L0CA 4ZLDA 3NGWA 1RJ9B 3U8VA 3X1OA 3OKRA 3SXDA 2OJED 1ZHWA 1LL0A 5J49A 1S4PA 3V8ZA 4MYBA 2WZGA 2KC3A 4JTAB 2XLVA 3SXCA 4ULWA 3QVBA 4EBBA 5EGYA 2R7OA 2XWNA 3RQFA 3MX3A 2I7BA 1LS4A 1L7CA 1C03A 3O10A 5B1AC 1JV1A 4PACA 3LAYA 1JPJA 3OAMA 4MVZA 2Y4KA 3WG7C 2O1GA 4CJCA 4GEHA 3U2WA 4C2SA 4M63A 2LIGA 2HJMA 5CMGX 3UGOA 2YC3A 2QKXA 4GBPA 2HV6A 5AJPA 4AK9A 2RJ9A 1FFHA 4MTOA 4JCZA 2GWWA 2AESA 5C38A 3T6GB 2JCLA 1FGGA 1PZYB 4OIRF 1HM8A 3V5XA 3L0IA 5DLJA 3JYHA 1GM5A 5A6JA 2P7VA 2EIJC 2PX7A 4NANA 2YLDA 3HJCA 4HO0A 1W2WA 3SX8A 2D4UA 2JX0A 1WT1A 1TQGA 1FR8A 1R4TA 3I0GA 4L41C 1HW2A 3FOOA 5C48A 1H9TA 4JISA 5CQMX 1XHBA 2APCA 3V0NA 2YKZA 4EVWA 4WJ0A 3G50A 4DRHB 3RF3A 3GM1A 3K8DA 1MMNA 1WOLA 3AG4C 3D98A 4DXWA 1E83A 5BQHA 3EZIA 3QVYA 5CMIA 2BO6A 2HKVA 3USQA 3G4XA 4Y6UA 4PFOA 1SZIA 2WB7A 2DGJA 3CSKA 1G9RA 3RKOF 3SYNA 5COFA 3SXBA 4MNDA 5CMFX 1V55C 3KYIA 4YS8A 2YLIA 1OCRC 2A8WA 5AGFA 4C3BA 2H8AA 2GA0A 1OCCC 1YZAA 4OD4A 2VXMA 1ZI4A 3Q6NA 2J7PD 4WGYA 3KH2A 2WGZA 3JYYA 4JCHA 2M64A 1BR2A 3UR3C 4XEVA 5E3AA 2ICXA 3LNMB 2IOQA 2RJ6A 4B6IA 3SXYA 3T6BA 1YYJA 5K0IA 2C04A 5KYXB 3LESA 4EUKB 3U0XA 5JRAA 3TULA 4OIOF 4G7HF 1E2XA 1VMAA 2GGOA 2M4EA 1D1CA 3C62A 2ZU9A 2AWYA 4JKVA 2W9YA 1TKNA 3WODF 5EK0A 1RKCA 4B5BA 3U3FA 2EIKC 3K8EA 4G3PA 2OJQA 1FNTc 3JSZA 3QZCA 2XMEA 2G62A 1S4OA 3W2VA 2OCCC 3FVYA 3O3PA 1VB5A 3EGDB 3GEIA 3EGXB 4G3QA 5C36A 2A0UA 4FRAA 3DKAA 1OR3A 1GX4A 5FYEA 1QGSA 3I0DA 3IHUA 1H5TB 3IQCA 2J8WA 3BRJA 2W0VA 1F1MA 2LP4A 1A0BA 1G0RA 4MVQA 5DS6A 1YDIA 3HKKA 3SX3A 5A69A 3ABLC 1JYLA 2R7SA 4IRQA 3SX5A 4D48A 2J9UA 1E85A 4FRMA 4U5FE 4MVRA 4Y9XA 5CI9A 4MVOA 5L0IA 1R5ID 4JVSA 2J0BA 2XS1A 5JS5A 3SPTA 1H7TA 3U2XA 4CSAC 4XWIA 1O87A 1EZIA 1WASA 5I1FA 4FCEA 1LE2A 1V82A 3U2MA 2DYRC 1VOMA 3EHMA 1MMGA 1BR1A 1FWYA 3ZLKA 5KYXA 3JRMO 3ST8A 3JUJA 4KC1A 3QW0A 5C49A 4NC3A 1APCA 4Y7FA 2GFHA 4Y64A 1Y4CA 4AE4A 3NG1A 3UMIA 4C3EA 2YWAA 3T6JA 2DI3A 4CDVA 2IM8A 3T9OA 4CJBA 4G78A 4B3UA 5T3WA 4IRPA 3NYMA 2QUPA 2Z15A 2WVMA 3V91A 4YL1A 1O3UA 3EGDA 4Y6NA 3EGXA 4R7PA 2DB4A 4O6NA 3TD7A 1I52A 1HMOA 1TWGA 1H5TA 4B2XA 4XPYA 1OMZA 1FO9A 3PMRA 1Q0KA 3M79A 1ZW2A 5B3IA 1ZIZA 2PNOA 2PGYA 2CNWA 2OOCA 1L3PA 2D7IA 3R2PA 1IINA 3T7OA 4DECA 3HNLA 1OW6A 1K04A 2CDQA 4XPXA 2Y4JA 4HO8A 5CMJA 2YCMA 4MS2A 3QVZA 1H7EA 3KIAA 1I4YA 2QNLA 2KJGA 1VICA 4CSAA 3ZF8A 1SS9A 3BRKX 5AC4A 3M1CB 2JD3A 4JE9A 1HM0A 4N4WA 3I0JA 1HY5A 4U5CE 4G0HA 3TQOA 1O5HA 1FMVA 4HG6A 1WT3A 2EILC 1LVKA 2LD6A 1S05A 3DM5A 4XWJA 3GEHA 4G7OF 1WT2A 3GUEA 1LZ0A 4N06A 1M56C 3I0HA 5C1HA 4NTFA 2KW3C 2RJ8A 2Y3GA 2X51A 3AG1C 1VZXA 1H7QA 4O6YA 2Q9AA 2YL7A 1MMAA 4EEMA 2HMQA 3O55A 1YP4A 4Q4ZF 5IDSA 1E86A 2AVKA 5BUOA 1R80A 3LS0A 3DAFA 1NLXA 2Y6PA 2R03A 5JQQA 1S4NA 3KMIA 3US6A 1VM8A 3IOIA 4HO6A 3VYWA 5KYYB 1MNEA 1JMWA 2IXPA 4M2BA 2L6FA 4G7ZF 3IPMO 4JIOA 3CKVA 2W4BA 1CPRA 1ZU4A 5DQTA 4DDZA 2HFIA 5FU0A 3H2UA 2KNHA 1PZTA 3EHNA 2LCHA 2A0BA 2HMZA 1A41A 2R25A 3K66A 2CGEA 5E33A 4LDKA 1NMMB 5HV9A 5COMA 3FXHA 3T4RA 2B0JA 4CIPA
chains in the Genus database with same CATH topology
2FYCB 1FO8A 2PP4A 4HO4A 3LW6A 2ZU8A 1NZEA 1FTSA 5B1AC 1N1CA 3SEOA 1JV1A 3ASOC 1R7UA 3LAYA 1JPJA 2AM4A 3OAMA 3W2WA 3USRA 2Y4KA 4KC4A 3WG7C 2MWQA 2O1GA 3POLA 4GEHA 4CJCA 5IY5C 3LJBA 3Q7LA 3U2WA 3I0EA 2R7QA 1G3LA 4C2SA 1GWVA 2V0LA 4M63A 4CS8C 3SNHA 2ICYA 4K6RA 4U5BE 4BJTA 3UGOA 5CMGX 2OI5A 2XL4A 1O7OA 1ZCYA 2J9VA 2YC3A 2JCOA 2QKXA 4KI2A 4AYJA 4GBPA 3EG9B 1JV3A 3S28A 2RIXA 2R7XA 2E8BA 4J18A 1ZJPA 2HV6A 4LACB 1ZJ1A 3S29A 5AJPA 2D0JA 4AK9A 2V0HA 2RJ9A 3RMVA 4B4MA 3PHF2 1FFHA 1MP5A 2AGDA 1QG8A 2VK9A 4HO2A 4CVHA 2I5KA 2WE9A 4HEAJ 2AESA 5C38A 4O79A 2JCLA 4P02A 4O7GA 1FGGA 1FZWA 1R82A 1PZYB 3ZSUA 4OIRF 1HM8A 5CQPA 3T7MA 2VSIA 3L0IA 1MP4A 2VH3A 4H4KC 3ZGGA 2Q9BA 5DLJA 3JYHA 4AAWA 2BO4A 1D1BA 2P7VA 4OD5A 1VZUA 2EIJC 2QY9A 4I44A 2CU2A 2PX7A 2YQHA 3D5NA 4NANA 3HJCA 5DS5A 5BXCA 3OH2A 2Y3DA 4HO0A 1W2WA 3SX8A 2EINC 4YT2A 2FFVA 2O1HA 3N2ZB 1PD1A 2ZU7A 4M2AA 1ZU5A 5DDVA 1Z3IX 1WT0A 2YZSA 2WZFA 4ASJA 2WZLA 2QTVA 1WT1A 3R3IA 4PJMA 1H4EA 4AX2A 1ZHTA 1OCZC 4LLEA 5EJZA 2J7PA 2XRHA 1FR8A 1HJLA 5D91A 1KU2A 3I0GA 4L41C 1H4DA 5KYYA 4EEAA 1OCOC 3FWWA 5IFYA 5C48A 3PKQA 5FTSA 4Y7VA 1ZI1A 4JISA 4IAOA 4Y62A 4PK4A 5CQMX 1XHBA 2H7OA 3X2QC 1YP2A 5T3TA 2H7BA 3LEVA 3LLIA 3EH2A 2APCA 2DPWA 3V0NA 5C1GA 4EVWA 4D11C 4WJ0A 2GGQA 4Q7CA 1JVGA 1G2VA 3ZG1A 4KQLA 4CBEA 2XXAA 4NY3A 2QH5A 1H5SD 4EE5A 4KBLA 2A68F 1MMNA 1ZJ2A 3K8DA 3V0MA 1E5KA 3AG4C 1LZ7A 4IWBA 2VS4A 3ABMC 3D98A 5F5FA 3DM9B 3EZIA 3N9WA 4YT4A 4BJ6A 4Y7TA 1QZXA 4KNWA 1XZ6A 3OH3A 1PCXA 5L6VA 4P6IC 5CMIA 2BO6A 2FFUA 3GODA 4KNRA 5FUHA 4ZLCA 2IXMA 3OA1A 4G3SA 3USQA 2IXOA 3V0LA 3OEOA 2YQSA 1G8XA 4Y6UA 2R7WA 3SZRA 2YESA 3Q6MA 4PFOA 1EYRA 4EE4A 2I8BA 1SZIA 2WB7A 1LL2A 2DGJA 3CSKA 4MQ9F 1G9RA 1GWWA 3IOHA 5FTVA 3S0XA 5T1DB 2ZXRA 3ABKC 4XTKA 3RKOF 1FG5N 1G1LA 1R81A 2XWMA 3SYNA 5CQNX 3SXBA 1Z63A 4MNDA 1ZJ3A 4IRUA 1V55C 4K7BA 4U5DE 1ZCVA 2RITA 5CMFX 1FFTC 4YS8A 1V54C 2RJ1A 1OCRC 4PJJA 4IJJA 2A8WA 5EHHA 2XXAB 4HFKB 3Q7UA 4MIXA 4C3BA 5HSWA 2E87A 4BMAA 3EZHA 1OCCC 1R7YA 5IDTA 3LS1A 4OD4A 3DAGA 3RIPA 2PA4A 1LS1A 3Q7GA 2VXMA 4CS7A 3ZGFA 1ZI4A 3UMHA 5C3AA 3Q6NA 4BEJA 2VB6A 3RYLA 2CW0F 2Z86A 2J7PD 3EG9A 1IW7F 3KH2A 3K1IC 4JCHA 4OINF 2WGZA 4FWVA 3I5PA 4GYTA 2ZXWC 3AQCA 1BR2A 3F47A 3UR3C 1M2VB 4E7ZA 1D0XA 2L81A 3E9VA 5E3AA 2ICXA 3I0IX 3OWTA 4KT7A 2IOQA 2RJ6A 4B6IA 3EFOB 1VYKA 3F1YA 2NUPB 2VS5A 1MNDA 4J30B 3T6BA 2V0IA 4B2WA 1R7TA 2HV7A 5C8RA 1H5RA 2C04A 5KYXB 3LESA 4U5HA 3ZC4A 2W45A 4ANJA 4KPZA 1O7QA 3I5QA 5KYUA 4OIQF 1SMYF 1H7HA 2EIMC 1ON8A 4RDAA 1VGWA 3U0XA 2VD4A 2A6HF 2O1FA 3B9QA 2PFDA 4OIOF 3ZLLA 4G7HF 4G87A 3NYLA 3I0FA 3V0QA 4E7SA 1VMAA 3UGPA 4W8KA 2GGOA 3HLZA 2PX0A 4FROA 4KNVA 2M4EA 1D1CA 2VASA 4KNXA 2A6EF 4LERA 4KRVA 5HS2A 2ZU9A 2WAWA 3W8IA 2JCKA 1GA8A 2W9YA 3S27A 3CQZA 1TKNA 3UNGC 3WODF 2X5SA 1YP3A 2VS3A 2JCJA 4HO9A 4JJGA 4B5BA 5DS4A 2EIKC 3K8EA 1TWCA 4G3PA 4D11A 3PKPA 2C0NA 1HJJA 3JSZA 1W77A 2P72A 3QZCA 4CS9C 2XMEA 1ZDFA 2G62A 1Z90A 3ZVRA 1S4OA 2Q4JA 3W2VA 1D1AA 2OCCC 1H5RB 3FVYA 3U2TA 3O3PA 3EGDB 2RIZA 2P6VA 3V0OA 2PGVA 5KYUB 4FIXA 4C3DA 1QLEC 3EGXB 2XWLA 4FCUA 1NF5B 4G3QA 5C36A 3CKQA 2J0XA 5CI8A 4FRAA 1INIA 4PJLA 5FYEA 1GX4A 2WL8A 1LZIA 1QGSA 1LKXA 2L9JA 4FRHA 3AQBA 1FXOA 4A2NB 3EE5A 4FRLA 4LW6A 4P00A 1S7ZA 3EQLF 3I0DA 4ECMA 1NU9C 1H5TB 1QWJA 1TWAA 1OKKA 5EJ1A 4ASYA 4KPXA 4B4GA 2AM3A 1G95A 2W0VA 3JTJA 3ITFA 1H7FA 1ZI3A 2V0JA 2P6WA 2C03A 3GANA 3FOQA 1TZFA 1K4VA 3I0KA 1R7VA 1G0RA 4U5EE 5E2QA 4BJ5C 5L3VA 3EH1A 2FFHA 5DS6A 1LVWA 1MMDA 2J9WA 3OC9A 1VZTA 3KL4A 3N0TA 3EJNA 3SX3A 1NKHB 2OG2A 5DQZA 3ABLC 1JYLA 3K6BA 1NWGB 2R7SA 1JVDA 2XMHA 3RSBA 4IRQA 5F5HA 5C4BA 3SX5A 4D48A 5FV9A 1HV9A 2OI6A 1SF8A 5C47A 2J9UA 4KC9A 1D0YA 1H5SC 4LLCA 2Q3TA 2ZXOA 1H3MA 4FRMA 3DD7A 1FXJA 2AE7A 2RIYA 4FX5A 3Q80A 5C3DA 4U5FE 1IZMA 3FDQA 4BQHA 4NALA 4M4KA 4Y9XA 2J46A 2I5EA 5CI9A 1ON6A 3BCVA 4CIHA 3O39A 4DVYP 3POVA 4JVSA 2YEVA 2H7VC 2J0BA 1FMWA 2WVLA 3SPTA 1H7TA 3DXJF 4RBNA 2YC5A 3OH0A 3U2XA 4CSAC 1VGUA 4XWIA 1M2VA 1O87A 2FYBA 2RJ0A 4PJNA 1EZIA 1OMXA 1ZYRF 2OI7A 5I1FA 4FCEA 3EFOA 1V82A 3HL3A 5DDTA 4FREA 2NUPA 4LW3A 2LSEA 2DYRC 1VOMA 2X65A 1O23B 1V83A 3D8VA 2PX3A 4J32B 2KGOA 3EHMA 1MMGA 5C4FA 5L6SA 1BR1A 1FWYA 3ZLKA 3OH4A 5KYXA 3FHDA 5L3QA 3U2VA 4CS8A 4HO3A 4HOCA 5AJOA 1J8MF 3ST8A 2NG1A 3B0UX 1LZJA 1VGTA 2BO7A 4DVZA 2Y7AA 3JUJA 4U5GA 4KC1A 4EEOA 2R7TA 1GQCA 3DMDA 4I3MA 3NYJA 3AG3C 1ZDGA 4CJ8A 4Y7FA 5C49A 4UEGA 3NKDA 2GFHA 4B4BA 3K1HA 4JW1A 4Y64A 2J0AA 4AE4A 5C4DA 3NG1A 3UMIA 4C3EA 3T6JA 2YQCA 5D92A 1WSZA 2X60A 1TVYA 4CS9A 4CJBA 1ZCTA 4B3UA 3OH1A 1MC3A 5C4EA 1PD0A 2Y3BA 5T3WA 4XLPF 4IRPA 3AG2C 3B0PA 3NYMA 3W8HA 2A1DD 1FR9A 2Z15A 2V26A 2FY7A 2WVMA 2YQJA 2BE5F 1YROB 3V91A 4KXOA 3QMKA 3EGDA 3UMKA 2A8UA 3E26A 4Y6NA 2FYDB 3EGXA 5C1LA 3JT1A 1ZJOA 4R7PA 3TD7A 1ZHXA 3NRHA 4I1OB 4O6NA 4PFPA 2Q9CA 2W4MA 1I52A 3DK5A 1TWGA 4HE8D 1H5TA 1H4CA 4DBRA 1INJA 4Y63A 4B2XA 3FAJA 4AE4B 5KYWA 3B0VC 1OMZA 4HFFB 3E25A 1FO9A 3PMRA 1KWSA 2Y3HA 4B42A 3RMWA 3U2UA 2NUTA 4YN0B 1JPNA 1QGQA 2PF4E 3I0LA 3LNRA 4YT8A 1NG1A 1ZIZA 1FOAA 3DJNB 2PGYA 4E1KA 4FESA 2Y69C 1FRWA 5AJNA 2CNWA 4D0TA 3TZTA 2XSEA 3Q4SA 1VH1A 3ASNC 4Q5SF 1W55A 1H5SA 2AM5A 5CMHA 2VXLA 3SP1A 2D7IA 4F4BA 1IINA 1GX0A 2UX8A 3T7OA 2DYSC 5C3BA 4DECA 4DE7A 2V3CC 2R7VA 1NHEB 3NKEA 2CDQA 2Y4JA 5KYNA 4HO8A 3NDBB 5B1BC 3K33A 2YCMA 2Y4LA 5CMJA 4JZAA 1H7EA 4FRQA 4FRBA 1VYIA 4DBQA 3KIAA 3O6XA 1HM9A 5E3CA 2KJGA 2FYAA 2R7UA 1VICA 2WVOA 3ZIBA 5FCLA 5KYWB 4CSAA 3ZF8A 2KQ9A 1SS9A 3BRKX 4HCQA 4C7OB 3DZAA 2VFZA 2P73A 1BR4A 2NUTB 2WVQA 3ECSA 3JCUQ 1GQ9A 4M28A 1M57C 3M1CB 1Z5ZA 1OQMB 1WVCA 3DUVA 2JD3A 2G3VA 1HM0A 1TW1A 3DJ4A 2MYSA 3SXEA 4FQWA 2Y39A 1M2OA 2Y4MA 4AYLA 2RJ4A 3I0JA 1ZCUA 4U5CE 1VGZA 1H5SB 2AECA 1G93A 4G0HA 1MP3A 2WVKA 1O5HA 3RH3A 1FMVA 1R7XA 3V0PA 2VSHA 4HG6A 1WT3A 3U0YA 2X5ZA 4FRDA 4QI0A 1WGWA 1ST6A 2EILC 3JRTA 1LVKA 3H65A 3CKNA 2RJ5A 3CGXA 3PNNA 4ZDQA 1Z23A 3DM5A 2YHSA 1NU7D 4XWJA 1V84A 1VH3A 1G97A 1ZHJA 4G7OF 1WT2A 3GUEA 1NQIB 1LZ0A 3E70C 3SXAA 4BJ1A 3OGZA 4OIPF 1VPAA 4Y7GA 4X0RA 3SXGA 4N06A 1M56C 4KC2A 5C4CA 2FGYA 3I0HA 1RJ9A 2KW3C 1Z6AA 5C1HA 2RJ8A 2AH9A 4RD9A 2Y3GA 2J0WA 2X51A 3AG1C 1TR2A 4BG0A 1VZXA 4D0ZA 5DVWA 1H7QA 3SX7A 3T7NA 1IIMA 4JJFA 4DOZA 2CNWD 3HTKC 4O6YA 4FIYA 2Q9AA 3KKBA 4YT5A 3CKJA 1MMAA 5FU8A 4EEMA 3F46A 2D5RB 1FGXA 4HO5A 2G3KA 4O6MA 2WVNA 4Q4ZF 1YP4A 2OEGA 3L34A 1H7GA 4FRPA 5IDSA 2ZPAA 4ARWA 5BUOA 1O0RA 4Y7UA 1R80A 3LS0A 4XLNF 3LLKA 5B3SC 1ZI5A 3DAFA 2V0KA 1ZJ0A 3CZ6A 3VAYA 2Y6PA 4EWCA 1TWHA 2QGIA 4YJWA 1S4NA 5JQQA 3KMIA 1VM8A 4I1MA 3IOIA 4HO6A 2A69F 1G8OA 1TW5A 3CU0A 3TQDA 1OKKD 1JYKA 3VYWA 5KYYB 3I0CA 2NXVA 2D7RA 1MNEA 2IXNA 3IEEA 3N24A 4K0DA 4JURI 4YWQA 1G23A 3F1CA 2IXPA 4ZLDA 3NGWA 1RJ9B 2RJ7A 3X1OA 4M2BA 1LL3A 4G7ZF 3EPVA 5CQOA 3OKRA 3SXDA 2R7RA 1ZHWA 3CKVA 2W4BA 1J8YF 1VK5A 1LL0A 4JD0A 3RFYA 1ZU4A 5EIYA 5J49A 2E3DA 5DQTA 2MZBA 2WEEA 3R2WA 1S4PA 1ZHZA 1W57A 3V8ZA 4DDZA 2O9XA 3CKOA 5FU0A 3MLGA 3V7OA 2KNHA 4MYBA 2Z87A 3JUKA 2OEFA 4EE3A 2WZGA 1PZTA 3EHNA 1H7LA 2ZXPA 3SXCA 4NAKA 2IYLD 4ULWA 4AC3A 2W0WA 3QVBA 3K66A 4BJ6C 4QI2A 2J45A 4EBBA 2CGEA 5CQLX 5E33A 4EEGA 5EGYA 2R7OA 4NAIA 3IOJA 2XWNA 1ZHYA 1NMMB 3DJUB 3K7DA 4BJ5A 3V90A 4C7OA 4QDLA 3V8YA 3MX3A 2I7BA 3I4UA 2BO8A 3T4RA 2B0JA 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6M A;  5D92 A;  5D91 A;  4MND A;  4Q7C A;  4O6N A; 
#chains in the Genus database with same CATH topology
 2FYC B;  2PP4 A;  2ZU8 A;  1FTS A;  1T9K A;  2TMV P;  1AVO B;  4KC4 A;  2MWQ A;  5IY5 C;  1LIH A;  3I0E A;  1G3L A;  3SNH A;  1MQV A;  2OI5 A;  1O7O A;  2J9V A;  4AYJ A;  3MYI A;  1JOG A;  5GPG B;  4YK5 A;  2RIX A;  1ZJP A;  4LAC B;  1VTM P;  1ZJ1 A;  4Z9H A;  2V0H A;  1MP5 A;  2VK9 A;  4HEA J;  4E0I A;  3ZSU A;  5CQP A;  4H4K C;  2Q9B A;  4AAW A;  2BO4 A;  1D1B A;  1EQ1 A;  1VZU A;  4I44 A;  3QW1 A;  3D5N A;  5DS5 A;  2NPU A;  2Y3D A;  1PD1 A;  2ZU7 A;  3DE9 A;  1Z3I X;  4ASJ A;  4DRI B;  3TK0 A;  4PJM A;  1ZHT A;  5L0G A;  1OCZ C;  4LLE A;  1HJL A;  5KYY A;  3PKQ A;  5FTS A;  4FAP B;  4IAO A;  1EKY A;  2HSB A;  4Y62 A;  4PK4 A;  4JTC B;  2H7O A;  1YP2 A;  3LEV A;  3LLI A;  3EH2 A;  5C1G A;  4D11 C;  5TJ5 E;  1JVG A;  2Q7R A;  1G2V A;  4CBE A;  1T01 A;  5JUA A;  1H5S D;  4EE5 A;  1ZJ2 A;  3IQ6 A;  4IWB A;  5F5F A;  2CCY A;  1Q0D A;  3DM9 B;  3ZTM A;  1ZVZ A;  4Y7T A;  1QZX A;  3OH3 A;  4P6I C;  2LK4 A;  4KNR A;  2IXM A;  3OEO A;  1YA9 A;  3TJ5 A;  4CX9 A;  2I8B A;  3IOH A;  3S0X A;  5T1D B;  2ZXR A;  3RVY A;  1G1L A;  1R81 A;  2XWM A;  3M4C A;  1FFT C;  1CGO A;  4IJJ A;  5EHH A;  4HFK B;  4NQF A;  3Q7U A;  5HSW A;  2E87 A;  4BMA A;  1K40 A;  3EZH A;  2LQG A;  4MW8 A;  3ZGF A;  1QSP A;  3UMH A;  4BEJ A;  2CW0 F;  3GOR A;  2QLA A;  3K1I C;  3AQC A;  1YJG A;  4E7Z A;  2AP3 A;  2FAP B;  4MW3 A;  5A6K A;  3OWT A;  1OXB A;  2CYD A;  2OKU A;  1MND A;  2EPL X;  4B2W A;  2HV7 A;  3MYF A;  1H5R A;  4LDQ A;  2LFF A;  4KPZ A;  1O7Q A;  3I5Q A;  1VGW A;  2VD4 A;  1V74 B;  2A6H F;  2O1F A;  3ZLL A;  4G87 A;  1NFO A;  3UGP A;  2PX0 A;  4FRO A;  3A11 A;  4KNV A;  2ASR A;  1DOW A;  4LER A;  5HS2 A;  1BDJ B;  4NCQ A;  3W8I A;  2Q4F A;  2JCK A;  1GA8 A;  3PCV A;  2X5S A;  5DS4 A;  1TWC A;  4D11 A;  1UFB A;  1W77 A;  2P72 A;  4UDV A;  3ZVR A;  3U2T A;  2RIZ A;  4FCU A;  2R05 A;  1INI A;  4PJL A;  1TFK B;  1LZI A;  2AWC A;  1LKX A;  2L9J A;  4FRH A;  1FXO A;  4K1O A;  4FRL A;  1S7Z A;  3EQL F;  1I5N A;  1TWA A;  1OKK A;  5EJ1 A;  4EBJ A;  3R7C A;  3ZQY A;  1T6Q A;  2V0J A;  3FOQ A;  1K4V A;  3I0K A;  3V5Y A;  4N6H A;  1CGM E;  4BJ5 C;  5L3V A;  3EH1 A;  1MMD A;  5JT4 A;  2J9W A;  1VZT A;  3KL4 A;  4MTF A;  4CDY A;  2OG2 A;  3RSB A;  5FV9 A;  2OI6 A;  4KC9 A;  1RMV A;  1EI7 A;  1H3M A;  2RIY A;  3L1M A;  2AE7 A;  5C3D A;  5COG A;  3K1I A;  3FDQ A;  4M4K A;  3W4Y A;  2B0H A;  4CIH A;  4P9T A;  2WVL A;  1NFN A;  3OH0 A;  1TFO B;  2MHR A;  2FYB A;  2RJ0 A;  3HL3 A;  2LSE A;  1AUE A;  2XLM A;  5C4F A;  5L6S A;  2ETS A;  3U2V A;  1Y6D A;  4HO3 A;  5AJO A;  3VRC A;  4DVZ A;  3S84 A;  2Y7A A;  4U5G A;  4XPW A;  1ZDG A;  4CJ8 A;  4UEG A;  3NKD A;  3K1H A;  2RSE B;  1WSZ A;  2Q00 A;  1ZCT A;  1GGQ A;  2UUI A;  2Y3B A;  4EKW A;  4WGZ A;  3B0P A;  4IAQ A;  3DUV A;  2V26 A;  1YRO B;  3AGT A;  3UMK A;  2A8U A;  1QPU A;  5A6B D;  5C1L A;  1C17 M;  2Q9C A;  2XL6 A;  1INJ A;  4Y63 A;  5KYW A;  4IGG A;  3TJ6 A;  4AE4 B;  4HFF B;  2Y3H A;  4B42 A;  4H54 A;  2NUT A;  4GQH A;  2PF4 E;  4E1K A;  4FES A;  2Y69 C;  1VH1 A;  3ASN C;  2VXL A;  2YL3 A;  5C3B A;  4DE7 A;  2R7V A;  5JLI A;  2HJ3 A;  4JZA A;  3L8J A;  3O6X A;  5E3C A;  3RQE A;  2WVO A;  1RKE A;  2KQ9 A;  4C7O B;  2VC9 A;  2VFZ A;  2WVQ A;  3ECS A;  3U2L A;  1GQ9 A;  4M28 A;  1Z5Z A;  1TW1 A;  3SXE A;  2EPO A;  2MYS A;  1G5Z A;  4W8P A;  2Y4M A;  2AU5 A;  3PDM P;  2RJ4 A;  4WAB A;  3NMK A;  2HSQ A;  1MP3 A;  1Q0G A;  3ZDL A;  3CAX A;  3CGX A;  1VH3 A;  2YHS A;  1ZHJ A;  2P1A A;  1NQI B;  2ICW G;  4BJ1 A;  5BQI A;  3GM2 A;  4X0R A;  1CGN A;  5C4C A;  1AEP A;  2AH9 A;  4EIY A;  3U5S A;  4BG0 A;  1TR2 A;  5DVW A;  3SX7 A;  1IIM A;  2CNW D;  3HTK C;  4FIY A;  3KKB A;  5JP7 A;  2WVN A;  1H7G A;  4JC7 A;  4ARW A;  4Y7U A;  5B3S C;  1XZP A;  2V0K A;  1G4W R;  4I1M A;  1H6G A;  1OQC A;  3CU0 A;  3TQD A;  1JAF A;  2BC5 A;  3IEE A;  4K0D A;  4JUR I;  1ORS C;  1LL3 A;  5CQO A;  4Z9J A;  1J8Y F;  4JD0 A;  1YYX A;  1ZHZ A;  3CKO A;  3MLG A;  3V7O A;  2L6H A;  2P0N A;  2Z87 A;  3JUK A;  5CIV A;  4EE3 A;  2J9B A;  2GDC A;  1RXQ A;  4NAK A;  3V5Z A;  1FAP B;  2IYL D;  4U9E A;  4BJ6 C;  4QI2 A;  2J45 A;  4EEG A;  4NAI A;  3DJU B;  3V90 A;  4C7O A;  4QDL A;  3V8Y A;  1YVI A;  3GEE A;  3I4U A;  2BO8 A;  1VLS A;  1FO8 A;  4HO4 A;  3LW6 A;  1NZE A;  1N1C A;  1R7U A;  3USR A;  2AM4 A;  3W2W A;  3Q7L A;  2R7Q A;  3LEO A;  3HNI A;  1GWV A;  2V0L A;  4CS8 C;  1ZW3 A;  2ICY A;  4K6R A;  4U5B E;  4BJT A;  2XL4 A;  1ZCY A;  2JCO A;  1JV3 A;  2XLD A;  2R7X A;  2E8B A;  4J18 A;  3S29 A;  3RMV A;  3C8G A;  4CJO A;  3PHF 2;  2YVK A;  2WE9 A;  2XLW A;  4O79 A;  4P02 A;  4O7G A;  1FZW A;  4AL1 A;  1R82 A;  4IB4 A;  2VSI A;  2VH3 A;  3ZGG A;  1HW1 A;  3M15 A;  2I15 A;  4U9D A;  2YQH A;  2XM4 A;  3OH2 A;  3C18 A;  3GWL A;  2EIN C;  4YT2 A;  4M2A A;  1ZU5 A;  2YZS A;  2WZL A;  2QTV A;  4AX2 A;  1HE1 A;  5EJZ A;  2XRH A;  3HNJ A;  5D91 A;  3NMI A;  1K05 A;  5IFY A;  3ATP A;  5JSL A;  2VCB A;  1KTM A;  2DPW A;  2GGQ A;  1BBH A;  2XXA A;  4NY3 A;  4NTB A;  2A68 F;  2JPU A;  1LZ7 A;  4BJ6 A;  1LE4 A;  1PCX A;  1WTY A;  5L0F A;  3J06 A;  3GWN A;  3GOD A;  1OXK A;  2FFU A;  4ZLC A;  2R02 A;  3V0L A;  2R7W A;  3SZR A;  2YES A;  3Q6M A;  1EYR A;  4EE4 A;  1SYQ A;  2XLE A;  2OQM A;  3JSE O;  4D4X A;  1ZZP A;  1FG5 N;  3ABK C;  4XTK A;  1Z63 A;  1ZJ3 A;  4AL0 A;  1V54 C;  1H7I A;  4PJJ A;  4MIX A;  2HZ8 A;  1T5O A;  5IDT A;  1LS1 A;  3HNK A;  4CS7 A;  5C3A A;  1Q0M A;  2VB6 A;  3RYL A;  1IW7 F;  4OIN F;  3I5P A;  4GYT A;  3F47 A;  3ZWI A;  2L81 A;  4KT7 A;  3EFO B;  1VYK A;  3F1Y A;  4BPM A;  2YLG A;  1R7T A;  4DJ9 A;  1V4A A;  3WAQ A;  4U5H A;  2W45 A;  5KYU A;  4OIQ F;  2RD9 A;  1GQA A;  3B9Q A;  2PFD A;  5FZT A;  3NYL A;  2YQY A;  3V0Q A;  4E7S A;  3HLZ A;  4KRV A;  2WAW A;  3UNG C;  2VS3 A;  1EA8 A;  3FMS A;  3AJM A;  2C0N A;  1HJJ A;  4CS9 C;  1ZDF A;  2Q4J A;  1D1A A;  1H5R B;  3V0O A;  2P6V A;  2PGV A;  1A7V A;  4Z9I A;  1QLE C;  4MVS A;  3SXM A;  2XWL A;  4P9F A;  2XS8 A;  4P00 A;  4ECM A;  1QWJ A;  4ASY A;  4KPX A;  2AM3 A;  1G95 A;  3JTJ A;  3ITF A;  1H7F A;  2P6W A;  1TZF A;  4U5E E;  2HS5 A;  2FFH A;  1LVW A;  3N0T A;  1CPQ A;  1NKH B;  5DQZ A;  3K6B A;  1NWG B;  2XMH A;  5F5H A;  1HV9 A;  3DI5 A;  4J7T A;  3KPH A;  1SF8 A;  1H5S C;  1I4Z A;  2Q3T A;  2ZXO A;  2OU6 A;  3DD7 A;  4FX5 A;  3Q80 A;  1IZM A;  4BQH A;  3G4Z A;  2NSG A;  2J46 A;  2I5E A;  3BCV A;  1ON6 A;  4DVY P;  4ULV A;  3POV A;  1FMW A;  3DXJ F;  4R32 A;  1VGU A;  1ZYR F;  1T6U A;  3EFO A;  5DDT A;  4FRE A;  1C02 A;  1V83 A;  4J32 B;  3AGU A;  3FHD A;  4HOC A;  1YAU O;  2NG1 A;  1LZJ A;  1KNY A;  4EEO A;  4E17 A;  2R7T A;  3DMD A;  1GQC A;  3NYJ A;  3AG3 C;  4JW1 A;  5AC5 A;  4XEK A;  2XLO A;  3DWW A;  4CS9 A;  3B29 A;  1MC3 A;  5C4E A;  3MFN A;  3AG2 C;  3W8H A;  2YQJ A;  1FR9 A;  2FY7 A;  2BE5 F;  4KXO A;  1FR0 A;  3QMK A;  3E26 A;  1OR2 A;  1ZJO A;  1ZHX A;  4I1O B;  4PFP A;  3DK5 A;  4HE8 D;  4DBR A;  1WAT A;  3E25 A;  3RMW A;  3S90 A;  4YN0 B;  1JPN A;  1QGQ A;  3LNR A;  1WWP A;  1U89 A;  1FOA A;  3TZT A;  2XSE A;  4JEA A;  1W55 A;  2AM5 A;  1H5S A;  5CMH A;  3SP1 A;  4YL0 A;  2DYS C;  2V3C C;  1NHE B;  5KYN A;  4JEB A;  5B1B C;  3K33 A;  2Y4L A;  3U9M A;  4FRQ A;  2P61 A;  4EHP A;  4DBQ A;  1HM9 A;  3QTH A;  2FYA A;  5FCL A;  5F28 E;  3ZIB A;  5KYW B;  2KYH A;  4HCQ A;  2NUT B;  1M57 C;  4MTG A;  4BEM J;  1WVC A;  3DJ4 A;  4FQW A;  5L0H A;  1YLM A;  1VGZ A;  2AEC A;  1GS9 A;  2WVK A;  2UUH A;  1R7X A;  2KK1 A;  4XQ1 A;  2VSH A;  2L7A A;  4LDR A;  4QI0 A;  4XEF A;  1ST6 A;  2GAQ A;  4DRJ B;  3H65 A;  2RJ5 A;  3PNN A;  1NU7 D;  1V84 A;  1G97 A;  3SXA A;  3OGZ A;  1VPA A;  4Y7G A;  1RKE B;  2YL1 A;  3MBG A;  1RJ9 A;  1Z6A A;  4D0Z A;  5FU8 A;  2X0C A;  2D5R B;  1FGX A;  3VM6 A;  2G3K A;  4FRP A;  1DOV A;  4ONS A;  1B68 A;  2ZD9 A;  2ZPA A;  4XLN F;  1ZI5 A;  1ZJ0 A;  1TWH A;  4YJW A;  2A69 F;  4E18 A;  1JYK A;  3I0C A;  2NXV A;  2IXN A;  1G23 A;  4YWQ A;  3F1C A;  2RJ7 A;  3EPV A;  3H2V A;  2R7R A;  1VK5 A;  4CDA A;  5L0J A;  1E84 A;  3RFY A;  5EIY A;  2E3D A;  2MZB A;  2WEE A;  3R2W A;  1W57 A;  2O9X A;  3U3B A;  2OEF A;  2KSF A;  3SXK A;  4JTD B;  1H9G A;  1H7L A;  2ZXP A;  4AC3 A;  2W0W A;  3JZ0 A;  5CQL X;  1LM3 B;  3S9O A;  3IOJ A;  1ZHY A;  4BJ5 A;  3K7D A;  1D0Z A;  4ER9 A;  3SEO A;  2OEV A;  4CJG A;  3ASO C;  1Q0F A;  3POL A;  3LJB A;  2IBF A;  2EPK X;  4KI2 A;  3EG9 B;  3S28 A;  1QVX A;  2D0J A;  4B4M A;  2AGD A;  4CVH A;  1QG8 A;  4HO2 A;  2I5K A;  1PV3 A;  1JR8 A;  3T7M A;  3TOL A;  1MP4 A;  4OD5 A;  2QY9 A;  2CU2 A;  1YA7 O;  5BXC A;  1G4U S;  2FFV A;  2O1H A;  3N2Z B;  5DDV A;  1WT0 A;  1YAR O;  2WZF A;  3R3I A;  1H4E A;  2OEX A;  2J7P A;  5JVE A;  1HE9 A;  2F22 A;  1KU2 A;  3C8G B;  1H4D A;  4EEA A;  1OCO C;  3FWW A;  4Y7V A;  1ZI1 A;  1RCP A;  3IQ5 A;  3X2Q C;  5C4D A;  5T3T A;  2H7B A;  1A7D A;  1JRA A;  4Q7C A;  3ZG1 A;  4KQL A;  2L6G A;  2QH5 A;  2BL2 A;  4KBL A;  5A6B A;  3V0M A;  1E5K A;  2VS4 A;  3ABM C;  3N9W A;  4YT4 A;  4KNW A;  1XZ6 A;  5L6V A;  2EPM X;  5FUH A;  3DE8 A;  4G3S A;  3C8G D;  3OA1 A;  2IXO A;  2YQS A;  1G8X A;  1LL2 A;  4MQ9 F;  1GWW A;  5FTV A;  1BZ4 A;  5CQN X;  4IRU A;  4K7B A;  4U5D E;  1XWJ A;  3U9J A;  3VF0 A;  1ZCV A;  2RIT A;  3RVZ A;  2RJ1 A;  4NTA A;  2XXA B;  1R7Y A;  4PR9 A;  3LS1 A;  3DAG A;  3RIP A;  5A6A A;  2PA4 A;  1QQ3 A;  3Q7G A;  5BQG A;  4J7Y A;  2Z86 A;  3EG9 A;  4IAR A;  3L8I A;  4FWV A;  2ZXW C;  1M2V B;  1D0X A;  3E9V A;  3I0I X;  3FOP A;  2NUP B;  2VS5 A;  1A7E A;  4A4A A;  4J30 B;  2V0I A;  5C8R A;  3C7J A;  1LPE A;  4ANJ A;  3ZC4 A;  1H7H A;  1ON8 A;  1SMY F;  2EIM C;  4RDA A;  3U8P A;  4D4N A;  3I0F A;  3ZQV A;  4W8K A;  2VCC A;  2VAS A;  4KNX A;  2A6E F;  2VCA A;  3S27 A;  3CQZ A;  1YP3 A;  2JCJ A;  4HO9 A;  4JJG A;  3PKP A;  1ORY A;  3FAP B;  3RW0 A;  4MVM A;  1Z90 A;  5KYU B;  4FIX A;  4C3D A;  2LFD A;  1NF5 B;  3A9C A;  3CKQ A;  2J0X A;  5CI8 A;  1YZC A;  3ZTZ A;  2WL8 A;  1U6H A;  3AQB A;  4A2N B;  3EE5 A;  4LW6 A;  2HUJ A;  1NU9 C;  1SR2 A;  4B4G A;  1ZI3 A;  2C03 A;  3GAN A;  2YL0 A;  3U0C A;  1R7V A;  5E2Q A;  1LI5 A;  4L6R A;  1NBB A;  3OC9 A;  3EJN A;  3C63 A;  1JVD A;  3WHN A;  5C4B A;  5C47 A;  1D0Y A;  4LLC A;  1OW7 A;  1FXJ A;  4JRZ A;  4MVU A;  4NAL A;  3RQG A;  3O39 A;  2YEV A;  2H7V C;  4RBN A;  2YC5 A;  3GM3 A;  1M2V A;  1OW8 A;  4PJN A;  1OMX A;  3BEH A;  2OI7 A;  2NUP A;  4LW3 A;  2NSF A;  2X65 A;  1O23 B;  3D8V A;  2PX3 A;  2KGO A;  3JTL O;  3OH4 A;  5L3Q A;  1T6I A;  4CS8 A;  1J8M F;  3B0U X;  1VGT A;  2BO7 A;  4I3M A;  4B4B A;  2J0A A;  1M6T A;  2YQC A;  5D92 A;  2X60 A;  1TVY A;  1UG7 A;  3CEX A;  1Z7Q c;  3OH1 A;  1PD0 A;  4XLP F;  2XM0 A;  1U0B B;  2A1D D;  3M4B A;  2FYD B;  3JT1 A;  3NRH A;  2W4M A;  1H4C A;  3FAJ A;  3B0V C;  1KWS A;  3TOM A;  1LI7 A;  3U2U A;  1WN0 A;  3I0L A;  4YT8 A;  1NG1 A;  3DJN B;  1FRW A;  5AJN A;  4D0T A;  3AOU A;  3Q4S A;  4Q5S F;  4E0H A;  4F4B A;  1GX0 A;  2UX8 A;  1VLT A;  3LUT B;  3NKE A;  3NDB B;  4FRB A;  1VYI A;  1NSG B;  2R7U A;  3NMJ A;  1XZQ A;  3DZA A;  2P73 A;  1BR4 A;  3JCU Q;  2XL8 A;  1OQM B;  2G3V A;  2Y39 A;  1M2O A;  4AYL A;  2R9R B;  1ZCU A;  1H5S B;  1HMD A;  5L0D A;  1G93 A;  3RH3 A;  3V0P A;  3U0Y A;  2X5Z A;  2QE9 A;  4FRD A;  1WGW A;  3JRT A;  3CKN A;  3KYJ A;  4ZDQ A;  1Z23 A;  1ORJ A;  2YRF A;  3E70 C;  2EPN A;  4YL3 A;  4OIP F;  3SXG A;  4KC2 A;  2FGY A;  4EBK A;  4RD9 A;  2J0W A;  3T7N A;  4N6C A;  4JJF A;  4DOZ A;  1QKR A;  3C8Z A;  3CKJ A;  4YT5 A;  256B A;  2PBE A;  3F46 A;  4HO5 A;  4O6M A;  2OEG A;  3L34 A;  3B71 A;  1O0R A;  3SXZ A;  3LLK A;  2XLH A;  3CZ6 A;  3VAY A;  4EWC A;  2QGI A;  1G8O A;  1TW5 A;  1OKK D;  3IQT A;  2D7R A;  3N24 A;  5L0C A;  4ZLD A;  3NGW A;  1RJ9 B;  3U8V A;  3X1O A;  3OKR A;  3SXD A;  2OJE D;  1ZHW A;  1LL0 A;  5J49 A;  1S4P A;  3V8Z A;  4MYB A;  2WZG A;  2KC3 A;  4JTA B;  2XLV A;  3SXC A;  4ULW A;  3QVB A;  4EBB A;  5EGY A;  2R7O A;  2XWN A;  3RQF A;  3MX3 A;  2I7B A;  1LS4 A;  1L7C A;  1C03 A;  3O10 A;  5B1A C;  1JV1 A;  4PAC A;  3LAY A;  1JPJ A;  3OAM A;  4MVZ A;  2Y4K A;  3WG7 C;  2O1G A;  4CJC A;  4GEH A;  3U2W A;  4C2S A;  4M63 A;  2LIG A;  2HJM A;  5CMG X;  3UGO A;  2YC3 A;  2QKX A;  4GBP A;  2HV6 A;  5AJP A;  4AK9 A;  2RJ9 A;  1FFH A;  4MTO A;  4JCZ A;  2GWW A;  2AES A;  5C38 A;  3T6G B;  2JCL A;  1FGG A;  1PZY B;  4OIR F;  1HM8 A;  3V5X A;  3L0I A;  5DLJ A;  3JYH A;  1GM5 A;  5A6J A;  2P7V A;  2EIJ C;  2PX7 A;  4NAN A;  2YLD A;  3HJC A;  4HO0 A;  1W2W A;  3SX8 A;  2D4U A;  2JX0 A;  1WT1 A;  1TQG A;  1FR8 A;  1R4T A;  3I0G A;  4L41 C;  1HW2 A;  3FOO A;  5C48 A;  1H9T A;  4JIS A;  5CQM X;  1XHB A;  2APC A;  3V0N A;  2YKZ A;  4EVW A;  4WJ0 A;  3G50 A;  4DRH B;  3RF3 A;  3GM1 A;  3K8D A;  1MMN A;  1WOL A;  3AG4 C;  3D98 A;  4DXW A;  1E83 A;  5BQH A;  3EZI A;  3QVY A;  5CMI A;  2BO6 A;  2HKV A;  3USQ A;  3G4X A;  4Y6U A;  4PFO A;  1SZI A;  2WB7 A;  2DGJ A;  3CSK A;  1G9R A;  3RKO F;  3SYN A;  5COF A;  3SXB A;  4MND A;  5CMF X;  1V55 C;  3KYI A;  4YS8 A;  2YLI A;  1OCR C;  2A8W A;  5AGF A;  4C3B A;  2H8A A;  2GA0 A;  1OCC C;  1YZA A;  4OD4 A;  2VXM A;  1ZI4 A;  3Q6N A;  2J7P D;  4WGY A;  3KH2 A;  2WGZ A;  3JYY A;  4JCH A;  2M64 A;  1BR2 A;  3UR3 C;  4XEV A;  5E3A A;  2ICX A;  3LNM B;  2IOQ A;  2RJ6 A;  4B6I A;  3SXY A;  3T6B A;  1YYJ A;  5K0I A;  2C04 A;  5KYX B;  3LES A;  4EUK B;  3U0X A;  5JRA A;  3TUL A;  4OIO F;  4G7H F;  1E2X A;  1VMA A;  2GGO A;  2M4E A;  1D1C A;  3C62 A;  2ZU9 A;  2AWY A;  4JKV A;  2W9Y A;  1TKN A;  3WOD F;  5EK0 A;  1RKC A;  4B5B A;  3U3F A;  2EIK C;  3K8E A;  4G3P A;  2OJQ A;  1FNT c;  3JSZ A;  3QZC A;  2XME A;  2G62 A;  1S4O A;  3W2V A;  2OCC C;  3FVY A;  3O3P A;  1VB5 A;  3EGD B;  3GEI A;  3EGX B;  4G3Q A;  5C36 A;  2A0U A;  4FRA A;  3DKA A;  1OR3 A;  1GX4 A;  5FYE A;  1QGS A;  3I0D A;  3IHU A;  1H5T B;  3IQC A;  2J8W A;  3BRJ A;  2W0V A;  1F1M A;  2LP4 A;  1A0B A;  1G0R A;  4MVQ A;  5DS6 A;  1YDI A;  3HKK A;  3SX3 A;  5A69 A;  3ABL C;  1JYL A;  2R7S A;  4IRQ A;  3SX5 A;  4D48 A;  2J9U A;  1E85 A;  4FRM A;  4U5F E;  4MVR A;  4Y9X A;  5CI9 A;  4MVO A;  5L0I A;  1R5I D;  4JVS A;  2J0B A;  2XS1 A;  5JS5 A;  3SPT A;  1H7T A;  3U2X A;  4CSA C;  4XWI A;  1O87 A;  1EZI A;  1WAS A;  5I1F A;  4FCE A;  1LE2 A;  1V82 A;  3U2M A;  2DYR C;  1VOM A;  3EHM A;  1MMG A;  1BR1 A;  1FWY A;  3ZLK A;  5KYX A;  3JRM O;  3ST8 A;  3JUJ A;  4KC1 A;  3QW0 A;  5C49 A;  4NC3 A;  1APC A;  4Y7F A;  2GFH A;  4Y64 A;  1Y4C A;  4AE4 A;  3NG1 A;  3UMI A;  4C3E A;  2YWA A;  3T6J A;  2DI3 A;  4CDV A;  2IM8 A;  3T9O A;  4CJB A;  4G78 A;  4B3U A;  5T3W A;  4IRP A;  3NYM A;  2QUP A;  2Z15 A;  2WVM A;  3V91 A;  4YL1 A;  1O3U A;  3EGD A;  4Y6N A;  3EGX A;  4R7P A;  2DB4 A;  4O6N A;  3TD7 A;  1I52 A;  1HMO A;  1TWG A;  1H5T A;  4B2X A;  4XPY A;  1OMZ A;  1FO9 A;  3PMR A;  1Q0K A;  3M79 A;  1ZW2 A;  5B3I A;  1ZIZ A;  2PNO A;  2PGY A;  2CNW A;  2OOC A;  1L3P A;  2D7I A;  3R2P A;  1IIN A;  3T7O A;  4DEC A;  3HNL A;  1OW6 A;  1K04 A;  2CDQ A;  4XPX A;  2Y4J A;  4HO8 A;  5CMJ A;  2YCM A;  4MS2 A;  3QVZ A;  1H7E A;  3KIA A;  1I4Y A;  2QNL A;  2KJG A;  1VIC A;  4CSA A;  3ZF8 A;  1SS9 A;  3BRK X;  5AC4 A;  3M1C B;  2JD3 A;  4JE9 A;  1HM0 A;  4N4W A;  3I0J A;  1HY5 A;  4U5C E;  4G0H A;  3TQO A;  1O5H A;  1FMV A;  4HG6 A;  1WT3 A;  2EIL C;  1LVK A;  2LD6 A;  1S05 A;  3DM5 A;  4XWJ A;  3GEH A;  4G7O F;  1WT2 A;  3GUE A;  1LZ0 A;  4N06 A;  1M56 C;  3I0H A;  5C1H A;  4NTF A;  2KW3 C;  2RJ8 A;  2Y3G A;  2X51 A;  3AG1 C;  1VZX A;  1H7Q A;  4O6Y A;  2Q9A A;  2YL7 A;  1MMA A;  4EEM A;  2HMQ A;  3O55 A;  1YP4 A;  4Q4Z F;  5IDS A;  1E86 A;  2AVK A;  5BUO A;  1R80 A;  3LS0 A;  3DAF A;  1NLX A;  2Y6P A;  2R03 A;  5JQQ A;  1S4N A;  3KMI A;  3US6 A;  1VM8 A;  3IOI A;  4HO6 A;  3VYW A;  5KYY B;  1MNE A;  1JMW A;  2IXP A;  4M2B A;  2L6F A;  4G7Z F;  3IPM O;  4JIO A;  3CKV A;  2W4B A;  1CPR A;  1ZU4 A;  5DQT A;  4DDZ A;  2HFI A;  5FU0 A;  3H2U A;  2KNH A;  1PZT A;  3EHN A;  2LCH A;  2A0B A;  2HMZ A;  1A41 A;  2R25 A;  3K66 A;  2CGE A;  5E33 A;  4LDK A;  1NMM B;  5HV9 A;  5COM A;  3FXH A;  3T4R A;  2B0J A;  4CIP A; 
#chains in the Genus database with same CATH homology
 2FYC B;  1FO8 A;  2PP4 A;  4HO4 A;  3LW6 A;  2ZU8 A;  1NZE A;  1FTS A;  5B1A C;  1N1C A;  3SEO A;  1JV1 A;  3ASO C;  1R7U A;  3LAY A;  1JPJ A;  2AM4 A;  3OAM A;  3W2W A;  3USR A;  2Y4K A;  4KC4 A;  3WG7 C;  2MWQ A;  2O1G A;  3POL A;  4GEH A;  4CJC A;  5IY5 C;  3LJB A;  3Q7L A;  3U2W A;  3I0E A;  2R7Q A;  1G3L A;  4C2S A;  1GWV A;  2V0L A;  4M63 A;  4CS8 C;  3SNH A;  2ICY A;  4K6R A;  4U5B E;  4BJT A;  3UGO A;  5CMG X;  2OI5 A;  2XL4 A;  1O7O A;  1ZCY A;  2J9V A;  2YC3 A;  2JCO A;  2QKX A;  4KI2 A;  4AYJ A;  4GBP A;  3EG9 B;  1JV3 A;  3S28 A;  2RIX A;  2R7X A;  2E8B A;  4J18 A;  1ZJP A;  2HV6 A;  4LAC B;  1ZJ1 A;  3S29 A;  5AJP A;  2D0J A;  4AK9 A;  2V0H A;  2RJ9 A;  3RMV A;  4B4M A;  3PHF 2;  1FFH A;  1MP5 A;  2AGD A;  1QG8 A;  2VK9 A;  4HO2 A;  4CVH A;  2I5K A;  2WE9 A;  4HEA J;  2AES A;  5C38 A;  4O79 A;  2JCL A;  4P02 A;  4O7G A;  1FGG A;  1FZW A;  1R82 A;  1PZY B;  3ZSU A;  4OIR F;  1HM8 A;  5CQP A;  3T7M A;  2VSI A;  3L0I A;  1MP4 A;  2VH3 A;  4H4K C;  3ZGG A;  2Q9B A;  5DLJ A;  3JYH A;  4AAW A;  2BO4 A;  1D1B A;  2P7V A;  4OD5 A;  1VZU A;  2EIJ C;  2QY9 A;  4I44 A;  2CU2 A;  2PX7 A;  2YQH A;  3D5N A;  4NAN A;  3HJC A;  5DS5 A;  5BXC A;  3OH2 A;  2Y3D A;  4HO0 A;  1W2W A;  3SX8 A;  2EIN C;  4YT2 A;  2FFV A;  2O1H A;  3N2Z B;  1PD1 A;  2ZU7 A;  4M2A A;  1ZU5 A;  5DDV A;  1Z3I X;  1WT0 A;  2YZS A;  2WZF A;  4ASJ A;  2WZL A;  2QTV A;  1WT1 A;  3R3I A;  4PJM A;  1H4E A;  4AX2 A;  1ZHT A;  1OCZ C;  4LLE A;  5EJZ A;  2J7P A;  2XRH A;  1FR8 A;  1HJL A;  5D91 A;  1KU2 A;  3I0G A;  4L41 C;  1H4D A;  5KYY A;  4EEA A;  1OCO C;  3FWW A;  5IFY A;  5C48 A;  3PKQ A;  5FTS A;  4Y7V A;  1ZI1 A;  4JIS A;  4IAO A;  4Y62 A;  4PK4 A;  5CQM X;  1XHB A;  2H7O A;  3X2Q C;  1YP2 A;  5T3T A;  2H7B A;  3LEV A;  3LLI A;  3EH2 A;  2APC A;  2DPW A;  3V0N A;  5C1G A;  4EVW A;  4D11 C;  4WJ0 A;  2GGQ A;  4Q7C A;  1JVG A;  1G2V A;  3ZG1 A;  4KQL A;  4CBE A;  2XXA A;  4NY3 A;  2QH5 A;  1H5S D;  4EE5 A;  4KBL A;  2A68 F;  1MMN A;  1ZJ2 A;  3K8D A;  3V0M A;  1E5K A;  3AG4 C;  1LZ7 A;  4IWB A;  2VS4 A;  3ABM C;  3D98 A;  5F5F A;  3DM9 B;  3EZI A;  3N9W A;  4YT4 A;  4BJ6 A;  4Y7T A;  1QZX A;  4KNW A;  1XZ6 A;  3OH3 A;  1PCX A;  5L6V A;  4P6I C;  5CMI A;  2BO6 A;  2FFU A;  3GOD A;  4KNR A;  5FUH A;  4ZLC A;  2IXM A;  3OA1 A;  4G3S A;  3USQ A;  2IXO A;  3V0L A;  3OEO A;  2YQS A;  1G8X A;  4Y6U A;  2R7W A;  3SZR A;  2YES A;  3Q6M A;  4PFO A;  1EYR A;  4EE4 A;  2I8B A;  1SZI A;  2WB7 A;  1LL2 A;  2DGJ A;  3CSK A;  4MQ9 F;  1G9R A;  1GWW A;  3IOH A;  5FTV A;  3S0X A;  5T1D B;  2ZXR A;  3ABK C;  4XTK A;  3RKO F;  1FG5 N;  1G1L A;  1R81 A;  2XWM A;  3SYN A;  5CQN X;  3SXB A;  1Z63 A;  4MND A;  1ZJ3 A;  4IRU A;  1V55 C;  4K7B A;  4U5D E;  1ZCV A;  2RIT A;  5CMF X;  1FFT C;  4YS8 A;  1V54 C;  2RJ1 A;  1OCR C;  4PJJ A;  4IJJ A;  2A8W A;  5EHH A;  2XXA B;  4HFK B;  3Q7U A;  4MIX A;  4C3B A;  5HSW A;  2E87 A;  4BMA A;  3EZH A;  1OCC C;  1R7Y A;  5IDT A;  3LS1 A;  4OD4 A;  3DAG A;  3RIP A;  2PA4 A;  1LS1 A;  3Q7G A;  2VXM A;  4CS7 A;  3ZGF A;  1ZI4 A;  3UMH A;  5C3A A;  3Q6N A;  4BEJ A;  2VB6 A;  3RYL A;  2CW0 F;  2Z86 A;  2J7P D;  3EG9 A;  1IW7 F;  3KH2 A;  3K1I C;  4JCH A;  4OIN F;  2WGZ A;  4FWV A;  3I5P A;  4GYT A;  2ZXW C;  3AQC A;  1BR2 A;  3F47 A;  3UR3 C;  1M2V B;  4E7Z A;  1D0X A;  2L81 A;  3E9V A;  5E3A A;  2ICX A;  3I0I X;  3OWT A;  4KT7 A;  2IOQ A;  2RJ6 A;  4B6I A;  3EFO B;  1VYK A;  3F1Y A;  2NUP B;  2VS5 A;  1MND A;  4J30 B;  3T6B A;  2V0I A;  4B2W A;  1R7T A;  2HV7 A;  5C8R A;  1H5R A;  2C04 A;  5KYX B;  3LES A;  4U5H A;  3ZC4 A;  2W45 A;  4ANJ A;  4KPZ A;  1O7Q A;  3I5Q A;  5KYU A;  4OIQ F;  1SMY F;  1H7H A;  2EIM C;  1ON8 A;  4RDA A;  1VGW A;  3U0X A;  2VD4 A;  2A6H F;  2O1F A;  3B9Q A;  2PFD A;  4OIO F;  3ZLL A;  4G7H F;  4G87 A;  3NYL A;  3I0F A;  3V0Q A;  4E7S A;  1VMA A;  3UGP A;  4W8K A;  2GGO A;  3HLZ A;  2PX0 A;  4FRO A;  4KNV A;  2M4E A;  1D1C A;  2VAS A;  4KNX A;  2A6E F;  4LER A;  4KRV A;  5HS2 A;  2ZU9 A;  2WAW A;  3W8I A;  2JCK A;  1GA8 A;  2W9Y A;  3S27 A;  3CQZ A;  1TKN A;  3UNG C;  3WOD F;  2X5S A;  1YP3 A;  2VS3 A;  2JCJ A;  4HO9 A;  4JJG A;  4B5B A;  5DS4 A;  2EIK C;  3K8E A;  1TWC A;  4G3P A;  4D11 A;  3PKP A;  2C0N A;  1HJJ A;  3JSZ A;  1W77 A;  2P72 A;  3QZC A;  4CS9 C;  2XME A;  1ZDF A;  2G62 A;  1Z90 A;  3ZVR A;  1S4O A;  2Q4J A;  3W2V A;  1D1A A;  2OCC C;  1H5R B;  3FVY A;  3U2T A;  3O3P A;  3EGD B;  2RIZ A;  2P6V A;  3V0O A;  2PGV A;  5KYU B;  4FIX A;  4C3D A;  1QLE C;  3EGX B;  2XWL A;  4FCU A;  1NF5 B;  4G3Q A;  5C36 A;  3CKQ A;  2J0X A;  5CI8 A;  4FRA A;  1INI A;  4PJL A;  5FYE A;  1GX4 A;  2WL8 A;  1LZI A;  1QGS A;  1LKX A;  2L9J A;  4FRH A;  3AQB A;  1FXO A;  4A2N B;  3EE5 A;  4FRL A;  4LW6 A;  4P00 A;  1S7Z A;  3EQL F;  3I0D A;  4ECM A;  1NU9 C;  1H5T B;  1QWJ A;  1TWA A;  1OKK A;  5EJ1 A;  4ASY A;  4KPX A;  4B4G A;  2AM3 A;  1G95 A;  2W0V A;  3JTJ A;  3ITF A;  1H7F A;  1ZI3 A;  2V0J A;  2P6W A;  2C03 A;  3GAN A;  3FOQ A;  1TZF A;  1K4V A;  3I0K A;  1R7V A;  1G0R A;  4U5E E;  5E2Q A;  4BJ5 C;  5L3V A;  3EH1 A;  2FFH A;  5DS6 A;  1LVW A;  1MMD A;  2J9W A;  3OC9 A;  1VZT A;  3KL4 A;  3N0T A;  3EJN A;  3SX3 A;  1NKH B;  2OG2 A;  5DQZ A;  3ABL C;  1JYL A;  3K6B A;  1NWG B;  2R7S A;  1JVD A;  2XMH A;  3RSB A;  4IRQ A;  5F5H A;  5C4B A;  3SX5 A;  4D48 A;  5FV9 A;  1HV9 A;  2OI6 A;  1SF8 A;  5C47 A;  2J9U A;  4KC9 A;  1D0Y A;  1H5S C;  4LLC A;  2Q3T A;  2ZXO A;  1H3M A;  4FRM A;  3DD7 A;  1FXJ A;  2AE7 A;  2RIY A;  4FX5 A;  3Q80 A;  5C3D A;  4U5F E;  1IZM A;  3FDQ A;  4BQH A;  4NAL A;  4M4K A;  4Y9X A;  2J46 A;  2I5E A;  5CI9 A;  1ON6 A;  3BCV A;  4CIH A;  3O39 A;  4DVY P;  3POV A;  4JVS A;  2YEV A;  2H7V C;  2J0B A;  1FMW A;  2WVL A;  3SPT A;  1H7T A;  3DXJ F;  4RBN A;  2YC5 A;  3OH0 A;  3U2X A;  4CSA C;  1VGU A;  4XWI A;  1M2V A;  1O87 A;  2FYB A;  2RJ0 A;  4PJN A;  1EZI A;  1OMX A;  1ZYR F;  2OI7 A;  5I1F A;  4FCE A;  3EFO A;  1V82 A;  3HL3 A;  5DDT A;  4FRE A;  2NUP A;  4LW3 A;  2LSE A;  2DYR C;  1VOM A;  2X65 A;  1O23 B;  1V83 A;  3D8V A;  2PX3 A;  4J32 B;  2KGO A;  3EHM A;  1MMG A;  5C4F A;  5L6S A;  1BR1 A;  1FWY A;  3ZLK A;  3OH4 A;  5KYX A;  3FHD A;  5L3Q A;  3U2V A;  4CS8 A;  4HO3 A;  4HOC A;  5AJO A;  1J8M F;  3ST8 A;  2NG1 A;  3B0U X;  1LZJ A;  1VGT A;  2BO7 A;  4DVZ A;  2Y7A A;  3JUJ A;  4U5G A;  4KC1 A;  4EEO A;  2R7T A;  1GQC A;  3DMD A;  4I3M A;  3NYJ A;  3AG3 C;  1ZDG A;  4CJ8 A;  4Y7F A;  5C49 A;  4UEG A;  3NKD A;  2GFH A;  4B4B A;  3K1H A;  4JW1 A;  4Y64 A;  2J0A A;  4AE4 A;  5C4D A;  3NG1 A;  3UMI A;  4C3E A;  3T6J A;  2YQC A;  5D92 A;  1WSZ A;  2X60 A;  1TVY A;  4CS9 A;  4CJB A;  1ZCT A;  4B3U A;  3OH1 A;  1MC3 A;  5C4E A;  1PD0 A;  2Y3B A;  5T3W A;  4XLP F;  4IRP A;  3AG2 C;  3B0P A;  3NYM A;  3W8H A;  2A1D D;  1FR9 A;  2Z15 A;  2V26 A;  2FY7 A;  2WVM A;  2YQJ A;  2BE5 F;  1YRO B;  3V91 A;  4KXO A;  3QMK A;  3EGD A;  3UMK A;  2A8U A;  3E26 A;  4Y6N A;  2FYD B;  3EGX A;  5C1L A;  3JT1 A;  1ZJO A;  4R7P A;  3TD7 A;  1ZHX A;  3NRH A;  4I1O B;  4O6N A;  4PFP A;  2Q9C A;  2W4M A;  1I52 A;  3DK5 A;  1TWG A;  4HE8 D;  1H5T A;  1H4C A;  4DBR A;  1INJ A;  4Y63 A;  4B2X A;  3FAJ A;  4AE4 B;  5KYW A;  3B0V C;  1OMZ A;  4HFF B;  3E25 A;  1FO9 A;  3PMR A;  1KWS A;  2Y3H A;  4B42 A;  3RMW A;  3U2U A;  2NUT A;  4YN0 B;  1JPN A;  1QGQ A;  2PF4 E;  3I0L A;  3LNR A;  4YT8 A;  1NG1 A;  1ZIZ A;  1FOA A;  3DJN B;  2PGY A;  4E1K A;  4FES A;  2Y69 C;  1FRW A;  5AJN A;  2CNW A;  4D0T A;  3TZT A;  2XSE A;  3Q4S A;  1VH1 A;  3ASN C;  4Q5S F;  1W55 A;  1H5S A;  2AM5 A;  5CMH A;  2VXL A;  3SP1 A;  2D7I A;  4F4B A;  1IIN A;  1GX0 A;  2UX8 A;  3T7O A;  2DYS C;  5C3B A;  4DEC A;  4DE7 A;  2V3C C;  2R7V A;  1NHE B;  3NKE A;  2CDQ A;  2Y4J A;  5KYN A;  4HO8 A;  3NDB B;  5B1B C;  3K33 A;  2YCM A;  2Y4L A;  5CMJ A;  4JZA A;  1H7E A;  4FRQ A;  4FRB A;  1VYI A;  4DBQ A;  3KIA A;  3O6X A;  1HM9 A;  5E3C A;  2KJG A;  2FYA A;  2R7U A;  1VIC A;  2WVO A;  3ZIB A;  5FCL A;  5KYW B;  4CSA A;  3ZF8 A;  2KQ9 A;  1SS9 A;  3BRK X;  4HCQ A;  4C7O B;  3DZA A;  2VFZ A;  2P73 A;  1BR4 A;  2NUT B;  2WVQ A;  3ECS A;  3JCU Q;  1GQ9 A;  4M28 A;  1M57 C;  3M1C B;  1Z5Z A;  1OQM B;  1WVC A;  3DUV A;  2JD3 A;  2G3V A;  1HM0 A;  1TW1 A;  3DJ4 A;  2MYS A;  3SXE A;  4FQW A;  2Y39 A;  1M2O A;  2Y4M A;  4AYL A;  2RJ4 A;  3I0J A;  1ZCU A;  4U5C E;  1VGZ A;  1H5S B;  2AEC A;  1G93 A;  4G0H A;  1MP3 A;  2WVK A;  1O5H A;  3RH3 A;  1FMV A;  1R7X A;  3V0P A;  2VSH A;  4HG6 A;  1WT3 A;  3U0Y A;  2X5Z A;  4FRD A;  4QI0 A;  1WGW A;  1ST6 A;  2EIL C;  3JRT A;  1LVK A;  3H65 A;  3CKN A;  2RJ5 A;  3CGX A;  3PNN A;  4ZDQ A;  1Z23 A;  3DM5 A;  2YHS A;  1NU7 D;  4XWJ A;  1V84 A;  1VH3 A;  1G97 A;  1ZHJ A;  4G7O F;  1WT2 A;  3GUE A;  1NQI B;  1LZ0 A;  3E70 C;  3SXA A;  4BJ1 A;  3OGZ A;  4OIP F;  1VPA A;  4Y7G A;  4X0R A;  3SXG A;  4N06 A;  1M56 C;  4KC2 A;  5C4C A;  2FGY A;  3I0H A;  1RJ9 A;  2KW3 C;  1Z6A A;  5C1H A;  2RJ8 A;  2AH9 A;  4RD9 A;  2Y3G A;  2J0W A;  2X51 A;  3AG1 C;  1TR2 A;  4BG0 A;  1VZX A;  4D0Z A;  5DVW A;  1H7Q A;  3SX7 A;  3T7N A;  1IIM A;  4JJF A;  4DOZ A;  2CNW D;  3HTK C;  4O6Y A;  4FIY A;  2Q9A A;  3KKB A;  4YT5 A;  3CKJ A;  1MMA A;  5FU8 A;  4EEM A;  3F46 A;  2D5R B;  1FGX A;  4HO5 A;  2G3K A;  4O6M A;  2WVN A;  4Q4Z F;  1YP4 A;  2OEG A;  3L34 A;  1H7G A;  4FRP A;  5IDS A;  2ZPA A;  4ARW A;  5BUO A;  1O0R A;  4Y7U A;  1R80 A;  3LS0 A;  4XLN F;  3LLK A;  5B3S C;  1ZI5 A;  3DAF A;  2V0K A;  1ZJ0 A;  3CZ6 A;  3VAY A;  2Y6P A;  4EWC A;  1TWH A;  2QGI A;  4YJW A;  1S4N A;  5JQQ A;  3KMI A;  1VM8 A;  4I1M A;  3IOI A;  4HO6 A;  2A69 F;  1G8O A;  1TW5 A;  3CU0 A;  3TQD A;  1OKK D;  1JYK A;  3VYW A;  5KYY B;  3I0C A;  2NXV A;  2D7R A;  1MNE A;  2IXN A;  3IEE A;  3N24 A;  4K0D A;  4JUR I;  4YWQ A;  1G23 A;  3F1C A;  2IXP A;  4ZLD A;  3NGW A;  1RJ9 B;  2RJ7 A;  3X1O A;  4M2B A;  1LL3 A;  4G7Z F;  3EPV A;  5CQO A;  3OKR A;  3SXD A;  2R7R A;  1ZHW A;  3CKV A;  2W4B A;  1J8Y F;  1VK5 A;  1LL0 A;  4JD0 A;  3RFY A;  1ZU4 A;  5EIY A;  5J49 A;  2E3D A;  5DQT A;  2MZB A;  2WEE A;  3R2W A;  1S4P A;  1ZHZ A;  1W57 A;  3V8Z A;  4DDZ A;  2O9X A;  3CKO A;  5FU0 A;  3MLG A;  3V7O A;  2KNH A;  4MYB A;  2Z87 A;  3JUK A;  2OEF A;  4EE3 A;  2WZG A;  1PZT A;  3EHN A;  1H7L A;  2ZXP A;  3SXC A;  4NAK A;  2IYL D;  4ULW A;  4AC3 A;  2W0W A;  3QVB A;  3K66 A;  4BJ6 C;  4QI2 A;  2J45 A;  4EBB A;  2CGE A;  5CQL X;  5E33 A;  4EEG A;  5EGY A;  2R7O A;  4NAI A;  3IOJ A;  2XWN A;  1ZHY A;  1NMM B;  3DJU B;  3K7D A;  4BJ5 A;  3V90 A;  4C7O A;  4QDL A;  3V8Y A;  3MX3 A;  2I7B A;  3I4U A;  2BO8 A;  3T4R A;  2B0J A;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...