4CJCA

Orthorhombic crystal form of bogt6a e192q in complex with udp-galnac, udp, galnac
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
MRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQYGGHEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products.
pubmed doi rcsb
source organism Bacteroides ovatus
total genus 59
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cjcA00
3SX8A 1YP4A 2YC3A 4KNRA 2RJ6A 2BO8A 3I0FA 1ZJ1A 1XHBA 2WGZA 2Y4KA 1WVCA 4YS8A 2I7BA 4HO3A 2OEFA 2Y4MA 3D5NA 3SXBA 4B42A 3ZGGA 1H4DA 2W0VA 4BQHA 2QKXA 1LL2A 4L41C 2AESA 2XWNA 1W77A 1SS9A 5I1FA 4MYBA 5DDVA 1O0RA 3U2TA 1WT2A 4Y62A 4DDZA 1H5SD 4B3UA 1VH1A 1MP4A 2P73A 3OGZA 2D0JA 1JYLA 3K8EA 4EEMA 4LW6A 2VS4A 1NKHB 3USQA 1INJA 1ZI5A 2JCJA 4JD0A 4DECA 3PKQA 4GBPA 2OI7A 1K4VA 2ICXA 2E3DA 2P72A 3DUVA 3ZF8A 1W57A 5CMIA 2E8BA 2V0KA 2V0JA 5FU8A 3T7MA 2RIYA 4CJBA 1QG8A 3V90A 3SXAA 4EE4A 2VD4A 4D11A 3OH4A 5C36A 4M2BA 2ZU9A 4IRQA 3CU0A 5FYEA 1VH3A 4KQLA 4BMAA 3FWWA 5CQNX 2AECA 1QGQA 1EYRA 3SPTA 5EIYA 3OAMA 1GQ9A 3QVBA 2PGYA 1R7TA 1ZI1A 2VXMA 3D98A 3ST8A 1ZIZA 4UEGA 4CJ8A 1G23A 1R80A 5C47A 5CMHA 4R7PA 2WEEA 1HM8A 2FYDB 3V0MA 2DPWA 2Y4JA 3Q4SA 1G0RA 4EEGA 1H5SA 1V82A 2V0IA 3V91A 2Y6PA 3I0JA 1FZWA 1TW5A 4HG6A 2YQHA 2NXVA 3KIAA 2AM4A 1H7FA 3U0YA 3SX5A 1LL0A 2RJ5A 1H7GA 1O23B 3POLA 4NANA 1JV3A 3JUKA 1WT1A 1NWGB 1LL3A 4FRMA 1VPAA 1FOAA 1GA8A 2O1GA 3U2XA 2YQCA 4B2XA 1R7XA 2Z86A 4G3PA 1GX4A 1H7LA 1VICA 2BO4A 2FYAA 1INIA 1H4EA 4FRBA 2A8UA 3RSBA 5CQOA 4B5BA 1G9RA 1H7HA 4ARWA 4EEOA 3CKJA 2VFZA 2PX7A 4KC1A 4D0ZA 4FRAA 2P6WA 3V0NA 5L6VA 1YP2A 2XMEA 2Z87A 3EE5A 1LZIA 3N9WA 5IDTA 3PKPA 2AM3A 5DDTA 4Y7FA 1ON8A 1FRWA 1VGUA 1NQIB 1H5SC 1ZJ0A 4KRVA 3E25A 1MP5A 2A8WA 4KXOA 3ZLLA 2X5SA 1ZCTA 3I0IX 2RJ7A 1I52A 3SXEA 4XWIA 3T7OA 4CJCA 3CKNA 5FTSA 1G3LA 3V0QA 3SX7A 4Y7VA 1FXJA 4Y9XA 3V0OA 1R81A 4FRHA 5AJNA 2RJ1A 3DK5A 1OMXA 3TQDA 3BRKX 1ON6A 1NMMB 4Y63A 2YC5A 4AC3A 4HO9A 2Q4JA 1V83A 2ZU7A 2RJ4A 5C48A 1GWWA 4EVWA 4NAKA 4HOCA 4Y7TA 1XZ6A 4B4GA 1LZJA 5EJZA 3V0PA 5FV9A 5CQLX 5C3BA 5IDSA 1V84A 4B2WA 3HL3A 2PGVA 3CKOA 3LW6A 1HJJA 2FYBA 1ZDGA 2WVLA 5CMFX 1VZUA 4NALA 5AJPA 5FTVA 1VZXA 5C3AA 2ZU8A 4EE5A 3PNNA 4M2AA 4C2SA 4HCQA 4NAIA 1H5SB 2JCOA 5L6SA 2V0LA 3ZGFA 5C4BA 3K8DA 3U2UA 1GX0A 3O3PA 1JVDA 4P00A 5CMGX 3V8ZA 2RJ8A 2YQJA 4K6RA 5FUHA 2AE7A 1G93A 1G95A 2WE9A 4J18A 1G1LA 3GUEA 4E1KA 2RIZA 4HO6A 1VGZA 2FFUA 2BO6A 2VXLA 1ZJ2A 1OMZA 1HM9A 4CVHA 2D7IA 1Z90A 2GGQA 2O1FA 1LZ0A 1ZCUA 4D11C 3F1YA 1TVYA 1ZJPA 4FCEA 5JQQA 3Q80A 2RJ0A 4FROA 4M4KA 3V0LA 4FRDA 1EZIA 4AYJA 1R7UA 1HV9A 3Q7UA 5C4EA 5C4CA 3I0EA 1FR9A 3U2VA 1TW1A 1WSZA 4G3QA 2APCA 1H7TA 2ICYA 3E26A 2AM5A 3OKRA 1JYKA 1IIMA 2OEGA 4MNDA 3RMVA 5C1HA 2D7RA 4EE3A 3F1CA 2XWLA 3NGWA 4ASJA 2YCMA 4FRPA 3IOHA 4AAWA 5C4DA 1VM8A 2FYCB 1O7QA 1VGWA 3OH0A 3USRA 2WVKA 2O1HA 1MP3A 1G97A 2GGOA 2QH5A 3OH2A 4B4MA 4ZDQA 2AGDA 4Y6UA 1ZDFA 3CKVA 4ECMA 1WT0A 2UX8A 4JISA 3IOIA 4HO8A 4Y7UA 5C3DA 1MC3A 1FR8A 1FXOA 3I0HA 5EJ1A 4IRPA 1FGGA 1YROB 5J49A 2FY7A 4EEAA 1FWYA 1ZJOA 2I5KA 5AJOA 2XMHA 5CMJA 4P02A 1LZ7A 3SXCA 1ZI3A 1FO8A 3ZLKA 2X5ZA 1FGXA 5HS2A 5CQPA 5C1LA 2FFVA 3SXGA 3OH3A 1H7EA 1JVGA 5C38A 2QGIA 3CGXA 3I0LA 1G2VA 3U2WA 2I5EA 2VS5A 3D8VA 1QWJA 4Y64A 5CQMX 1S4NA 3R3IA 1NF5B 1QGSA 2CU2A 1ZJ3A 2X60A 4G87A 5IFYA 4FQWA 1OQMB 4Y6NA 1KWSA 1IINA 2RJ9A 4D0TA 3V8YA 1PZTA 2JCLA 4Y7GA 1H5RB 4M28A 3I0KA 1HM0A 4HO4A 1H5RA 1ZCYA 3FOQA 1ZCVA 3U0XA 2WAWA 3SXDA 1ZI4A 2X65A 4KC4A 1R7VA 2Y7AA 5C4FA 4KPZA 2BO7A 2PA4A 2MZBA 4HO5A 3JUJA 4FREA 1S4PA 4HO2A 5BXCA 1H7QA 3I0GA 5C1GA 1FO9A 2OI5A 3R2WA 1R82A 2AH9A 4KNXA 1LVWA 3SX3A 1G8OA 5FU0A 4B4BA 4FRLA 4ASYA 1H3MA 3IOJA 3CKQA 1PZYB 4AYLA 1JV1A 3I0DA 3T7NA 1H5TB 2V0HA 2W0WA 2YQSA 3I0CA 1VZTA 3JTJA 2Y4LA 1H5TA 1H4CA 1O7OA 4DE7A 2VSIA 1WT3A 2XWMA 3DJ4A 1VGTA 4D48A 4KPXA 4HO0A 1S4OA 5C8RA 1TZFA 4KT7A 3OH1A 2WVMA 2OI6A 4LW3A 1FG5N 2VS3A 3RMWA 1HJLA 4FRQA 2RIXA 4KC2A 3BCVA 1NHEB 1GWVA 2JCKA 3TZTA 5C49A 1W55A 2RITA 3OC9A 1GQCA 1R7YA 1YP3A 1ZHJA 2VSHA 4FCUA 4G3SA 2YESA 1E5KA
chains in the Genus database with same CATH superfamily
3SX8A 1YP4A 2C0NA 2YC3A 4KNRA 2RJ6A 2BO8A 3I0FA 1ZJ1A 1XHBA 2Y4KA 2WGZA 2VK9A 1WVCA 4YS8A 2I7BA 4HO3A 2OEFA 2Y4MA 3D5NA 3SXBA 4B42A 3ZGGA 1H4DA 2W0VA 4BQHA 2QKXA 1LL2A 4L41C 2AESA 2XWNA 1W77A 1SS9A 5I1FA 4MYBA 5DDVA 1O0RA 3U2TA 1WT2A 4Y62A 4DDZA 1H5SD 4B3UA 1VH1A 1MP4A 2P73A 3OGZA 2D0JA 1JYLA 3K8EA 4EEMA 4LW6A 2VS4A 1NKHB 3USQA 1INJA 1ZI5A 2JCJA 4JD0A 4DECA 3PKQA 4GBPA 2OI7A 1K4VA 2ICXA 2E3DA 2P72A 3DUVA 3ZF8A 1W57A 5CMIA 2E8BA 2V0KA 2V0JA 5FU8A 3T7MA 2RIYA 4CJBA 1QG8A 3V90A 3SXAA 4EE4A 2VD4A 4D11A 3OH4A 5C36A 4M2BA 2ZU9A 4IRQA 3CU0A 5FYEA 1VH3A 4KQLA 4BMAA 3FWWA 5CQNX 2AECA 1QGQA 1EYRA 3SPTA 5EIYA 3OAMA 1GQ9A 3QVBA 2PGYA 1R7TA 1ZI1A 2VXMA 3D98A 3ST8A 1ZIZA 4UEGA 4CJ8A 1G23A 1R80A 5C47A 5CMHA 4R7PA 2WEEA 1HM8A 2FYDB 3V0MA 2DPWA 2Y4JA 3Q4SA 1G0RA 4EEGA 1H5SA 4FIXA 1V82A 2V0IA 3V91A 2Y6PA 3I0JA 1FZWA 1TW5A 4HG6A 2YQHA 2NXVA 3KIAA 2AM4A 1H7FA 3U0YA 3SX5A 1LL0A 2RJ5A 1H7GA 1O23B 3POLA 4NANA 1JV3A 3JUKA 1WT1A 1NWGB 1LL3A 4FRMA 1VPAA 1FOAA 1GA8A 2O1GA 3U2XA 2YQCA 2J0AA 4B2XA 1R7XA 2Z86A 4G3PA 1GX4A 1H7LA 1VICA 2BO4A 2FYAA 1INIA 1H4EA 4FRBA 2A8UA 3RSBA 5CQOA 4B5BA 1G9RA 1H7HA 4ARWA 4EEOA 3CKJA 2VFZA 2PX7A 4KC1A 4D0ZA 4FRAA 2P6WA 3V0NA 5L6VA 1YP2A 2XMEA 2Z87A 3EE5A 1LZIA 3N9WA 5IDTA 3PKPA 2AM3A 5DDTA 4Q7CA 4Y7FA 1ON8A 1FRWA 1VGUA 1NQIB 1H5SC 1ZJ0A 4KRVA 3E25A 1MP5A 2A8WA 4KXOA 3ZLLA 2X5SA 1ZCTA 3I0IX 2RJ7A 4FIYA 1I52A 3SXEA 4XWIA 3T7OA 4CJCA 3CKNA 5FTSA 1G3LA 3V0QA 3SX7A 4Y7VA 1FXJA 4Y9XA 3V0OA 1R81A 4FRHA 5AJNA 2RJ1A 3DK5A 1OMXA 3TQDA 3BRKX 1ON6A 1NMMB 4Y63A 2YC5A 4AC3A 4HO9A 2Q4JA 1V83A 2ZU7A 2RJ4A 5C48A 1GWWA 4EVWA 4NAKA 4HOCA 4Y7TA 1XZ6A 4B4GA 1LZJA 5EJZA 3V0PA 5FV9A 5CQLX 5C3BA 5IDSA 1V84A 4B2WA 3HL3A 2PGVA 3CKOA 3LW6A 1HJJA 2FYBA 1ZDGA 2WVLA 5CMFX 1VZUA 4NALA 5AJPA 5FTVA 1VZXA 5C3AA 2ZU8A 4EE5A 3PNNA 4M2AA 4C2SA 4HCQA 4MIXA 4NAIA 1H5SB 2JCOA 5L6SA 2V0LA 3ZGFA 5C4BA 3K8DA 3U2UA 1GX0A 3O3PA 1JVDA 4P00A 5CMGX 3V8ZA 2RJ8A 2YQJA 4K6RA 5FUHA 2AE7A 1G93A 1G95A 2WE9A 4J18A 1G1LA 3GUEA 4E1KA 2RIZA 4HO6A 1VGZA 2FFUA 2BO6A 2VXLA 1ZJ2A 1OMZA 1HM9A 4CVHA 2D7IA 1Z90A 2GGQA 2O1FA 1LZ0A 1ZCUA 4D11C 3F1YA 1TVYA 1ZJPA 4FCEA 5JQQA 3Q80A 2RJ0A 4FROA 4M4KA 3V0LA 4FRDA 1EZIA 4AYJA 1R7UA 1HV9A 3Q7UA 5C4EA 5C4CA 3I0EA 1FR9A 3U2VA 1TW1A 1WSZA 4G3QA 2APCA 1H7TA 2ICYA 5D92A 3E26A 2AM5A 3OKRA 1JYKA 1IIMA 2OEGA 4MNDA 3RMVA 5C1HA 2D7RA 4EE3A 3F1CA 2XWLA 3NGWA 4ASJA 2YCMA 4FRPA 3IOHA 4AAWA 5C4DA 1VM8A 2FYCB 1O7QA 1VGWA 4O6MA 3OH0A 3USRA 2WVKA 2O1HA 1MP3A 1G97A 2GGOA 2QH5A 3OH2A 4O6NA 4B4MA 4ZDQA 2AGDA 4Y6UA 1ZDFA 3CKVA 4ECMA 1WT0A 2UX8A 4JISA 3IOIA 4HO8A 4Y7UA 5C3DA 1MC3A 1FR8A 1FXOA 3I0HA 5EJ1A 4IRPA 1FGGA 1YROB 5J49A 2FY7A 4EEAA 1FWYA 1ZJOA 2I5KA 5AJOA 2XMHA 5CMJA 4P02A 1LZ7A 3SXCA 1ZI3A 1FO8A 3ZLKA 2X5ZA 1FGXA 5HS2A 5CQPA 5C1LA 2FFVA 3SXGA 3OH3A 1H7EA 1JVGA 5C38A 2QGIA 3CGXA 3I0LA 1G2VA 3U2WA 2I5EA 2VS5A 3D8VA 1QWJA 4Y64A 5CQMX 1S4NA 3R3IA 1NF5B 1QGSA 2CU2A 1ZJ3A 2X60A 4G87A 5IFYA 4FQWA 1OQMB 4Y6NA 1KWSA 1IINA 2RJ9A 4D0TA 3V8YA 1PZTA 2JCLA 4Y7GA 1H5RB 4M28A 3I0KA 1HM0A 4HO4A 1H5RA 1ZCYA 3FOQA 1ZCVA 3U0XA 2WAWA 3SXDA 1ZI4A 2X65A 4KC4A 1R7VA 2Y7AA 5C4FA 4KPZA 2BO7A 2PA4A 2MZBA 4HO5A 3JUJA 4FREA 1S4PA 4HO2A 5BXCA 1H7QA 3I0GA 5C1GA 1FO9A 2OI5A 3R2WA 1R82A 2AH9A 4KNXA 5D91A 1LVWA 3SX3A 1G8OA 5FU0A 4B4BA 4FRLA 4ASYA 1H3MA 3IOJA 2J0BA 3CKQA 1PZYB 4AYLA 1JV1A 3I0DA 3T7NA 1H5TB 2V0HA 2W0WA 2YQSA 3I0CA 1VZTA 3JTJA 2Y4LA 1H5TA 1H4CA 1O7OA 4DE7A 2VSIA 1WT3A 2XWMA 3DJ4A 1VGTA 4D48A 4KPXA 4HO0A 1S4OA 5C8RA 1TZFA 4KT7A 3OH1A 2WVMA 2OI6A 4LW3A 1FG5N 2VS3A 3RMWA 1HJLA 4FRQA 2RIXA 4KC2A 3BCVA 1NHEB 1GWVA 2JCKA 3TZTA 5C49A 1W55A 2RITA 3OC9A 1GQCA 1R7YA 1YP3A 1ZHJA 2VSHA 4FCUA 4G3SA 2YESA 1E5KA
chains in the Genus database with same CATH topology
3SX8A 1YP4A 2C0NA 2YC3A 4KNRA 2RJ6A 2BO8A 3I0FA 1ZJ1A 1XHBA 2Y4KA 2WGZA 2VK9A 1WVCA 4YS8A 2I7BA 4HO3A 2OEFA 2Y4MA 3D5NA 3SXBA 4B42A 3ZGGA 1H4DA 2W0VA 4BQHA 2QKXA 1LL2A 4L41C 2AESA 2XWNA 1W77A 1SS9A 5I1FA 4MYBA 5DDVA 1O0RA 3U2TA 1WT2A 4Y62A 4DDZA 1H5SD 4B3UA 1VH1A 1MP4A 2P73A 3OGZA 2D0JA 1JYLA 3K8EA 4EEMA 4LW6A 2VS4A 1NKHB 3USQA 1INJA 1ZI5A 2JCJA 4JD0A 4DECA 3PKQA 4GBPA 2OI7A 1K4VA 2ICXA 2E3DA 2P72A 3DUVA 3ZF8A 1W57A 5CMIA 2E8BA 2V0KA 2V0JA 5FU8A 3T7MA 2RIYA 4CJBA 1QG8A 3V90A 3SXAA 4EE4A 2VD4A 4D11A 3OH4A 5C36A 4M2BA 2ZU9A 4IRQA 3CU0A 5FYEA 1VH3A 4KQLA 4BMAA 3FWWA 5CQNX 2AECA 1QGQA 1EYRA 3SPTA 5EIYA 3OAMA 1GQ9A 3QVBA 2PGYA 1R7TA 1ZI1A 2VXMA 3D98A 3ST8A 1ZIZA 4UEGA 4CJ8A 1G23A 1R80A 5C47A 5CMHA 4R7PA 2WEEA 1HM8A 2FYDB 3V0MA 2DPWA 2Y4JA 3Q4SA 1G0RA 4EEGA 1H5SA 4FIXA 1V82A 2V0IA 3V91A 2Y6PA 3I0JA 1FZWA 1TW5A 4HG6A 2YQHA 2NXVA 3KIAA 2AM4A 1H7FA 3U0YA 3SX5A 1LL0A 2RJ5A 1H7GA 1O23B 3POLA 4NANA 1JV3A 3JUKA 1WT1A 1NWGB 1LL3A 4FRMA 1VPAA 1FOAA 1GA8A 2O1GA 3U2XA 2YQCA 2J0AA 4B2XA 1R7XA 2Z86A 4G3PA 1GX4A 1H7LA 1VICA 2BO4A 2FYAA 1INIA 1H4EA 4FRBA 2A8UA 3RSBA 5CQOA 4B5BA 1G9RA 1H7HA 4ARWA 4EEOA 3CKJA 2VFZA 2PX7A 4KC1A 4D0ZA 4FRAA 2P6WA 3V0NA 5L6VA 1YP2A 2XMEA 2Z87A 3EE5A 1LZIA 3N9WA 5IDTA 3PKPA 2AM3A 5DDTA 4Q7CA 4Y7FA 1ON8A 1FRWA 1VGUA 1NQIB 1H5SC 1ZJ0A 4KRVA 3E25A 1MP5A 2A8WA 4KXOA 3ZLLA 2X5SA 1ZCTA 3I0IX 2RJ7A 4FIYA 1I52A 3SXEA 4XWIA 3T7OA 4CJCA 3CKNA 5FTSA 1G3LA 3V0QA 3SX7A 4Y7VA 1FXJA 4Y9XA 3V0OA 1R81A 4FRHA 5AJNA 2RJ1A 3DK5A 1OMXA 3TQDA 3BRKX 1ON6A 1NMMB 4Y63A 2YC5A 4AC3A 4HO9A 2Q4JA 1V83A 2ZU7A 2RJ4A 5C48A 1GWWA 4EVWA 4NAKA 4HOCA 4Y7TA 1XZ6A 4B4GA 1LZJA 5EJZA 3V0PA 5FV9A 5CQLX 5C3BA 5IDSA 1V84A 4B2WA 3HL3A 2PGVA 3CKOA 3LW6A 1HJJA 2FYBA 1ZDGA 2WVLA 5CMFX 1VZUA 4NALA 5AJPA 5FTVA 1VZXA 5C3AA 2ZU8A 4EE5A 3PNNA 4M2AA 4C2SA 4HCQA 4MIXA 4NAIA 1H5SB 2JCOA 5L6SA 2V0LA 3ZGFA 5C4BA 3K8DA 3U2UA 1GX0A 3O3PA 1JVDA 4P00A 5CMGX 3V8ZA 2RJ8A 2YQJA 4K6RA 5FUHA 2AE7A 1G93A 1G95A 2WE9A 4J18A 1G1LA 3GUEA 4E1KA 2RIZA 4HO6A 1VGZA 2FFUA 2BO6A 2VXLA 1ZJ2A 1OMZA 1HM9A 4CVHA 2D7IA 1Z90A 2GGQA 2O1FA 1LZ0A 1ZCUA 4D11C 3F1YA 1TVYA 1ZJPA 4FCEA 5JQQA 3Q80A 2RJ0A 4FROA 4M4KA 3V0LA 4FRDA 1EZIA 4AYJA 1R7UA 1HV9A 3Q7UA 5C4EA 5C4CA 3I0EA 1FR9A 3U2VA 1TW1A 1WSZA 4G3QA 2APCA 1H7TA 2ICYA 5D92A 3E26A 2AM5A 3OKRA 1JYKA 1IIMA 2OEGA 4MNDA 3RMVA 5C1HA 2D7RA 4EE3A 3F1CA 2XWLA 3NGWA 4ASJA 2YCMA 4FRPA 3IOHA 4AAWA 5C4DA 1VM8A 2FYCB 1O7QA 1VGWA 4O6MA 3OH0A 3USRA 2WVKA 2O1HA 1MP3A 1G97A 2GGOA 2QH5A 3OH2A 4O6NA 4B4MA 4ZDQA 2AGDA 4Y6UA 1ZDFA 3CKVA 4ECMA 1WT0A 2UX8A 4JISA 3IOIA 4HO8A 4Y7UA 5C3DA 1MC3A 1FR8A 1FXOA 3I0HA 5EJ1A 4IRPA 1FGGA 1YROB 5J49A 2FY7A 4EEAA 1FWYA 1ZJOA 2I5KA 5AJOA 2XMHA 5CMJA 4P02A 1LZ7A 3SXCA 1ZI3A 1FO8A 3ZLKA 2X5ZA 1FGXA 5HS2A 5CQPA 5C1LA 2FFVA 3SXGA 3OH3A 1H7EA 1JVGA 5C38A 2QGIA 3CGXA 3I0LA 1G2VA 3U2WA 2I5EA 2VS5A 3D8VA 1QWJA 4Y64A 5CQMX 1S4NA 3R3IA 1NF5B 1QGSA 2CU2A 1ZJ3A 2X60A 4G87A 5IFYA 4FQWA 1OQMB 4Y6NA 1KWSA 1IINA 2RJ9A 4D0TA 3V8YA 1PZTA 2JCLA 4Y7GA 1H5RB 4M28A 3I0KA 1HM0A 4HO4A 1H5RA 1ZCYA 3FOQA 1ZCVA 3U0XA 2WAWA 3SXDA 1ZI4A 2X65A 4KC4A 1R7VA 2Y7AA 5C4FA 4KPZA 2BO7A 2PA4A 2MZBA 4HO5A 3JUJA 4FREA 1S4PA 4HO2A 5BXCA 1H7QA 3I0GA 5C1GA 1FO9A 2OI5A 3R2WA 1R82A 2AH9A 4KNXA 5D91A 1LVWA 3SX3A 1G8OA 5FU0A 4B4BA 4FRLA 4ASYA 1H3MA 3IOJA 2J0BA 3CKQA 1PZYB 4AYLA 1JV1A 3I0DA 3T7NA 1H5TB 2V0HA 2W0WA 2YQSA 3I0CA 1VZTA 3JTJA 2Y4LA 1H5TA 1H4CA 1O7OA 4DE7A 2VSIA 1WT3A 2XWMA 3DJ4A 1VGTA 4D48A 4KPXA 4HO0A 1S4OA 5C8RA 1TZFA 4KT7A 3OH1A 2WVMA 2OI6A 4LW3A 1FG5N 2VS3A 3RMWA 1HJLA 4FRQA 2RIXA 4KC2A 3BCVA 1NHEB 1GWVA 2JCKA 3TZTA 5C49A 1W55A 2RITA 3OC9A 1GQCA 1R7YA 1YP3A 1ZHJA 2VSHA 4FCUA 4G3SA 2YESA 1E5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SX8 A;  1YP4 A;  2YC3 A;  4KNR A;  2RJ6 A;  2BO8 A;  3I0F A;  1ZJ1 A;  1XHB A;  2WGZ A;  2Y4K A;  1WVC A;  4YS8 A;  2I7B A;  4HO3 A;  2OEF A;  2Y4M A;  3D5N A;  3SXB A;  4B42 A;  3ZGG A;  1H4D A;  2W0V A;  4BQH A;  2QKX A;  1LL2 A;  4L41 C;  2AES A;  2XWN A;  1W77 A;  1SS9 A;  5I1F A;  4MYB A;  5DDV A;  1O0R A;  3U2T A;  1WT2 A;  4Y62 A;  4DDZ A;  1H5S D;  4B3U A;  1VH1 A;  1MP4 A;  2P73 A;  3OGZ A;  2D0J A;  1JYL A;  3K8E A;  4EEM A;  4LW6 A;  2VS4 A;  1NKH B;  3USQ A;  1INJ A;  1ZI5 A;  2JCJ A;  4JD0 A;  4DEC A;  3PKQ A;  4GBP A;  2OI7 A;  1K4V A;  2ICX A;  2E3D A;  2P72 A;  3DUV A;  3ZF8 A;  1W57 A;  5CMI A;  2E8B A;  2V0K A;  2V0J A;  5FU8 A;  3T7M A;  2RIY A;  4CJB A;  1QG8 A;  3V90 A;  3SXA A;  4EE4 A;  2VD4 A;  4D11 A;  3OH4 A;  5C36 A;  4M2B A;  2ZU9 A;  4IRQ A;  3CU0 A;  5FYE A;  1VH3 A;  4KQL A;  4BMA A;  3FWW A;  5CQN X;  2AEC A;  1QGQ A;  1EYR A;  3SPT A;  5EIY A;  3OAM A;  1GQ9 A;  3QVB A;  2PGY A;  1R7T A;  1ZI1 A;  2VXM A;  3D98 A;  3ST8 A;  1ZIZ A;  4UEG A;  4CJ8 A;  1G23 A;  1R80 A;  5C47 A;  5CMH A;  4R7P A;  2WEE A;  1HM8 A;  2FYD B;  3V0M A;  2DPW A;  2Y4J A;  3Q4S A;  1G0R A;  4EEG A;  1H5S A;  1V82 A;  2V0I A;  3V91 A;  2Y6P A;  3I0J A;  1FZW A;  1TW5 A;  4HG6 A;  2YQH A;  2NXV A;  3KIA A;  2AM4 A;  1H7F A;  3U0Y A;  3SX5 A;  1LL0 A;  2RJ5 A;  1H7G A;  1O23 B;  3POL A;  4NAN A;  1JV3 A;  3JUK A;  1WT1 A;  1NWG B;  1LL3 A;  4FRM A;  1VPA A;  1FOA A;  1GA8 A;  2O1G A;  3U2X A;  2YQC A;  4B2X A;  1R7X A;  2Z86 A;  4G3P A;  1GX4 A;  1H7L A;  1VIC A;  2BO4 A;  2FYA A;  1INI A;  1H4E A;  4FRB A;  2A8U A;  3RSB A;  5CQO A;  4B5B A;  1G9R A;  1H7H A;  4ARW A;  4EEO A;  3CKJ A;  2VFZ A;  2PX7 A;  4KC1 A;  4D0Z A;  4FRA A;  2P6W A;  3V0N A;  5L6V A;  1YP2 A;  2XME A;  2Z87 A;  3EE5 A;  1LZI A;  3N9W A;  5IDT A;  3PKP A;  2AM3 A;  5DDT A;  4Y7F A;  1ON8 A;  1FRW A;  1VGU A;  1NQI B;  1H5S C;  1ZJ0 A;  4KRV A;  3E25 A;  1MP5 A;  2A8W A;  4KXO A;  3ZLL A;  2X5S A;  1ZCT A;  3I0I X;  2RJ7 A;  1I52 A;  3SXE A;  4XWI A;  3T7O A;  4CJC A;  3CKN A;  5FTS A;  1G3L A;  3V0Q A;  3SX7 A;  4Y7V A;  1FXJ A;  4Y9X A;  3V0O A;  1R81 A;  4FRH A;  5AJN A;  2RJ1 A;  3DK5 A;  1OMX A;  3TQD A;  3BRK X;  1ON6 A;  1NMM B;  4Y63 A;  2YC5 A;  4AC3 A;  4HO9 A;  2Q4J A;  1V83 A;  2ZU7 A;  2RJ4 A;  5C48 A;  1GWW A;  4EVW A;  4NAK A;  4HOC A;  4Y7T A;  1XZ6 A;  4B4G A;  1LZJ A;  5EJZ A;  3V0P A;  5FV9 A;  5CQL X;  5C3B A;  5IDS A;  1V84 A;  4B2W A;  3HL3 A;  2PGV A;  3CKO A;  3LW6 A;  1HJJ A;  2FYB A;  1ZDG A;  2WVL A;  5CMF X;  1VZU A;  4NAL A;  5AJP A;  5FTV A;  1VZX A;  5C3A A;  2ZU8 A;  4EE5 A;  3PNN A;  4M2A A;  4C2S A;  4HCQ A;  4NAI A;  1H5S B;  2JCO A;  5L6S A;  2V0L A;  3ZGF A;  5C4B A;  3K8D A;  3U2U A;  1GX0 A;  3O3P A;  1JVD A;  4P00 A;  5CMG X;  3V8Z A;  2RJ8 A;  2YQJ A;  4K6R A;  5FUH A;  2AE7 A;  1G93 A;  1G95 A;  2WE9 A;  4J18 A;  1G1L A;  3GUE A;  4E1K A;  2RIZ A;  4HO6 A;  1VGZ A;  2FFU A;  2BO6 A;  2VXL A;  1ZJ2 A;  1OMZ A;  1HM9 A;  4CVH A;  2D7I A;  1Z90 A;  2GGQ A;  2O1F A;  1LZ0 A;  1ZCU A;  4D11 C;  3F1Y A;  1TVY A;  1ZJP A;  4FCE A;  5JQQ A;  3Q80 A;  2RJ0 A;  4FRO A;  4M4K A;  3V0L A;  4FRD A;  1EZI A;  4AYJ A;  1R7U A;  1HV9 A;  3Q7U A;  5C4E A;  5C4C A;  3I0E A;  1FR9 A;  3U2V A;  1TW1 A;  1WSZ A;  4G3Q A;  2APC A;  1H7T A;  2ICY A;  3E26 A;  2AM5 A;  3OKR A;  1JYK A;  1IIM A;  2OEG A;  4MND A;  3RMV A;  5C1H A;  2D7R A;  4EE3 A;  3F1C A;  2XWL A;  3NGW A;  4ASJ A;  2YCM A;  4FRP A;  3IOH A;  4AAW A;  5C4D A;  1VM8 A;  2FYC B;  1O7Q A;  1VGW A;  3OH0 A;  3USR A;  2WVK A;  2O1H A;  1MP3 A;  1G97 A;  2GGO A;  2QH5 A;  3OH2 A;  4B4M A;  4ZDQ A;  2AGD A;  4Y6U A;  1ZDF A;  3CKV A;  4ECM A;  1WT0 A;  2UX8 A;  4JIS A;  3IOI A;  4HO8 A;  4Y7U A;  5C3D A;  1MC3 A;  1FR8 A;  1FXO A;  3I0H A;  5EJ1 A;  4IRP A;  1FGG A;  1YRO B;  5J49 A;  2FY7 A;  4EEA A;  1FWY A;  1ZJO A;  2I5K A;  5AJO A;  2XMH A;  5CMJ A;  4P02 A;  1LZ7 A;  3SXC A;  1ZI3 A;  1FO8 A;  3ZLK A;  2X5Z A;  1FGX A;  5HS2 A;  5CQP A;  5C1L A;  2FFV A;  3SXG A;  3OH3 A;  1H7E A;  1JVG A;  5C38 A;  2QGI A;  3CGX A;  3I0L A;  1G2V A;  3U2W A;  2I5E A;  2VS5 A;  3D8V A;  1QWJ A;  4Y64 A;  5CQM X;  1S4N A;  3R3I A;  1NF5 B;  1QGS A;  2CU2 A;  1ZJ3 A;  2X60 A;  4G87 A;  5IFY A;  4FQW A;  1OQM B;  4Y6N A;  1KWS A;  1IIN A;  2RJ9 A;  4D0T A;  3V8Y A;  1PZT A;  2JCL A;  4Y7G A;  1H5R B;  4M28 A;  3I0K A;  1HM0 A;  4HO4 A;  1H5R A;  1ZCY A;  3FOQ A;  1ZCV A;  3U0X A;  2WAW A;  3SXD A;  1ZI4 A;  2X65 A;  4KC4 A;  1R7V A;  2Y7A A;  5C4F A;  4KPZ A;  2BO7 A;  2PA4 A;  2MZB A;  4HO5 A;  3JUJ A;  4FRE A;  1S4P A;  4HO2 A;  5BXC A;  1H7Q A;  3I0G A;  5C1G A;  1FO9 A;  2OI5 A;  3R2W A;  1R82 A;  2AH9 A;  4KNX A;  1LVW A;  3SX3 A;  1G8O A;  5FU0 A;  4B4B A;  4FRL A;  4ASY A;  1H3M A;  3IOJ A;  3CKQ A;  1PZY B;  4AYL A;  1JV1 A;  3I0D A;  3T7N A;  1H5T B;  2V0H A;  2W0W A;  2YQS A;  3I0C A;  1VZT A;  3JTJ A;  2Y4L A;  1H5T A;  1H4C A;  1O7O A;  4DE7 A;  2VSI A;  1WT3 A;  2XWM A;  3DJ4 A;  1VGT A;  4D48 A;  4KPX A;  4HO0 A;  1S4O A;  5C8R A;  1TZF A;  4KT7 A;  3OH1 A;  2WVM A;  2OI6 A;  4LW3 A;  1FG5 N;  2VS3 A;  3RMW A;  1HJL A;  4FRQ A;  2RIX A;  4KC2 A;  3BCV A;  1NHE B;  1GWV A;  2JCK A;  3TZT A;  5C49 A;  1W55 A;  2RIT A;  3OC9 A;  1GQC A;  1R7Y A;  1YP3 A;  1ZHJ A;  2VSH A;  4FCU A;  4G3S A;  2YES A;  1E5K A; 
#chains in the Genus database with same CATH topology
 3SX8 A;  1YP4 A;  2C0N A;  2YC3 A;  4KNR A;  2RJ6 A;  2BO8 A;  3I0F A;  1ZJ1 A;  1XHB A;  2Y4K A;  2WGZ A;  2VK9 A;  1WVC A;  4YS8 A;  2I7B A;  4HO3 A;  2OEF A;  2Y4M A;  3D5N A;  3SXB A;  4B42 A;  3ZGG A;  1H4D A;  2W0V A;  4BQH A;  2QKX A;  1LL2 A;  4L41 C;  2AES A;  2XWN A;  1W77 A;  1SS9 A;  5I1F A;  4MYB A;  5DDV A;  1O0R A;  3U2T A;  1WT2 A;  4Y62 A;  4DDZ A;  1H5S D;  4B3U A;  1VH1 A;  1MP4 A;  2P73 A;  3OGZ A;  2D0J A;  1JYL A;  3K8E A;  4EEM A;  4LW6 A;  2VS4 A;  1NKH B;  3USQ A;  1INJ A;  1ZI5 A;  2JCJ A;  4JD0 A;  4DEC A;  3PKQ A;  4GBP A;  2OI7 A;  1K4V A;  2ICX A;  2E3D A;  2P72 A;  3DUV A;  3ZF8 A;  1W57 A;  5CMI A;  2E8B A;  2V0K A;  2V0J A;  5FU8 A;  3T7M A;  2RIY A;  4CJB A;  1QG8 A;  3V90 A;  3SXA A;  4EE4 A;  2VD4 A;  4D11 A;  3OH4 A;  5C36 A;  4M2B A;  2ZU9 A;  4IRQ A;  3CU0 A;  5FYE A;  1VH3 A;  4KQL A;  4BMA A;  3FWW A;  5CQN X;  2AEC A;  1QGQ A;  1EYR A;  3SPT A;  5EIY A;  3OAM A;  1GQ9 A;  3QVB A;  2PGY A;  1R7T A;  1ZI1 A;  2VXM A;  3D98 A;  3ST8 A;  1ZIZ A;  4UEG A;  4CJ8 A;  1G23 A;  1R80 A;  5C47 A;  5CMH A;  4R7P A;  2WEE A;  1HM8 A;  2FYD B;  3V0M A;  2DPW A;  2Y4J A;  3Q4S A;  1G0R A;  4EEG A;  1H5S A;  4FIX A;  1V82 A;  2V0I A;  3V91 A;  2Y6P A;  3I0J A;  1FZW A;  1TW5 A;  4HG6 A;  2YQH A;  2NXV A;  3KIA A;  2AM4 A;  1H7F A;  3U0Y A;  3SX5 A;  1LL0 A;  2RJ5 A;  1H7G A;  1O23 B;  3POL A;  4NAN A;  1JV3 A;  3JUK A;  1WT1 A;  1NWG B;  1LL3 A;  4FRM A;  1VPA A;  1FOA A;  1GA8 A;  2O1G A;  3U2X A;  2YQC A;  2J0A A;  4B2X A;  1R7X A;  2Z86 A;  4G3P A;  1GX4 A;  1H7L A;  1VIC A;  2BO4 A;  2FYA A;  1INI A;  1H4E A;  4FRB A;  2A8U A;  3RSB A;  5CQO A;  4B5B A;  1G9R A;  1H7H A;  4ARW A;  4EEO A;  3CKJ A;  2VFZ A;  2PX7 A;  4KC1 A;  4D0Z A;  4FRA A;  2P6W A;  3V0N A;  5L6V A;  1YP2 A;  2XME A;  2Z87 A;  3EE5 A;  1LZI A;  3N9W A;  5IDT A;  3PKP A;  2AM3 A;  5DDT A;  4Q7C A;  4Y7F A;  1ON8 A;  1FRW A;  1VGU A;  1NQI B;  1H5S C;  1ZJ0 A;  4KRV A;  3E25 A;  1MP5 A;  2A8W A;  4KXO A;  3ZLL A;  2X5S A;  1ZCT A;  3I0I X;  2RJ7 A;  4FIY A;  1I52 A;  3SXE A;  4XWI A;  3T7O A;  4CJC A;  3CKN A;  5FTS A;  1G3L A;  3V0Q A;  3SX7 A;  4Y7V A;  1FXJ A;  4Y9X A;  3V0O A;  1R81 A;  4FRH A;  5AJN A;  2RJ1 A;  3DK5 A;  1OMX A;  3TQD A;  3BRK X;  1ON6 A;  1NMM B;  4Y63 A;  2YC5 A;  4AC3 A;  4HO9 A;  2Q4J A;  1V83 A;  2ZU7 A;  2RJ4 A;  5C48 A;  1GWW A;  4EVW A;  4NAK A;  4HOC A;  4Y7T A;  1XZ6 A;  4B4G A;  1LZJ A;  5EJZ A;  3V0P A;  5FV9 A;  5CQL X;  5C3B A;  5IDS A;  1V84 A;  4B2W A;  3HL3 A;  2PGV A;  3CKO A;  3LW6 A;  1HJJ A;  2FYB A;  1ZDG A;  2WVL A;  5CMF X;  1VZU A;  4NAL A;  5AJP A;  5FTV A;  1VZX A;  5C3A A;  2ZU8 A;  4EE5 A;  3PNN A;  4M2A A;  4C2S A;  4HCQ A;  4MIX A;  4NAI A;  1H5S B;  2JCO A;  5L6S A;  2V0L A;  3ZGF A;  5C4B A;  3K8D A;  3U2U A;  1GX0 A;  3O3P A;  1JVD A;  4P00 A;  5CMG X;  3V8Z A;  2RJ8 A;  2YQJ A;  4K6R A;  5FUH A;  2AE7 A;  1G93 A;  1G95 A;  2WE9 A;  4J18 A;  1G1L A;  3GUE A;  4E1K A;  2RIZ A;  4HO6 A;  1VGZ A;  2FFU A;  2BO6 A;  2VXL A;  1ZJ2 A;  1OMZ A;  1HM9 A;  4CVH A;  2D7I A;  1Z90 A;  2GGQ A;  2O1F A;  1LZ0 A;  1ZCU A;  4D11 C;  3F1Y A;  1TVY A;  1ZJP A;  4FCE A;  5JQQ A;  3Q80 A;  2RJ0 A;  4FRO A;  4M4K A;  3V0L A;  4FRD A;  1EZI A;  4AYJ A;  1R7U A;  1HV9 A;  3Q7U A;  5C4E A;  5C4C A;  3I0E A;  1FR9 A;  3U2V A;  1TW1 A;  1WSZ A;  4G3Q A;  2APC A;  1H7T A;  2ICY A;  5D92 A;  3E26 A;  2AM5 A;  3OKR A;  1JYK A;  1IIM A;  2OEG A;  4MND A;  3RMV A;  5C1H A;  2D7R A;  4EE3 A;  3F1C A;  2XWL A;  3NGW A;  4ASJ A;  2YCM A;  4FRP A;  3IOH A;  4AAW A;  5C4D A;  1VM8 A;  2FYC B;  1O7Q A;  1VGW A;  4O6M A;  3OH0 A;  3USR A;  2WVK A;  2O1H A;  1MP3 A;  1G97 A;  2GGO A;  2QH5 A;  3OH2 A;  4O6N A;  4B4M A;  4ZDQ A;  2AGD A;  4Y6U A;  1ZDF A;  3CKV A;  4ECM A;  1WT0 A;  2UX8 A;  4JIS A;  3IOI A;  4HO8 A;  4Y7U A;  5C3D A;  1MC3 A;  1FR8 A;  1FXO A;  3I0H A;  5EJ1 A;  4IRP A;  1FGG A;  1YRO B;  5J49 A;  2FY7 A;  4EEA A;  1FWY A;  1ZJO A;  2I5K A;  5AJO A;  2XMH A;  5CMJ A;  4P02 A;  1LZ7 A;  3SXC A;  1ZI3 A;  1FO8 A;  3ZLK A;  2X5Z A;  1FGX A;  5HS2 A;  5CQP A;  5C1L A;  2FFV A;  3SXG A;  3OH3 A;  1H7E A;  1JVG A;  5C38 A;  2QGI A;  3CGX A;  3I0L A;  1G2V A;  3U2W A;  2I5E A;  2VS5 A;  3D8V A;  1QWJ A;  4Y64 A;  5CQM X;  1S4N A;  3R3I A;  1NF5 B;  1QGS A;  2CU2 A;  1ZJ3 A;  2X60 A;  4G87 A;  5IFY A;  4FQW A;  1OQM B;  4Y6N A;  1KWS A;  1IIN A;  2RJ9 A;  4D0T A;  3V8Y A;  1PZT A;  2JCL A;  4Y7G A;  1H5R B;  4M28 A;  3I0K A;  1HM0 A;  4HO4 A;  1H5R A;  1ZCY A;  3FOQ A;  1ZCV A;  3U0X A;  2WAW A;  3SXD A;  1ZI4 A;  2X65 A;  4KC4 A;  1R7V A;  2Y7A A;  5C4F A;  4KPZ A;  2BO7 A;  2PA4 A;  2MZB A;  4HO5 A;  3JUJ A;  4FRE A;  1S4P A;  4HO2 A;  5BXC A;  1H7Q A;  3I0G A;  5C1G A;  1FO9 A;  2OI5 A;  3R2W A;  1R82 A;  2AH9 A;  4KNX A;  5D91 A;  1LVW A;  3SX3 A;  1G8O A;  5FU0 A;  4B4B A;  4FRL A;  4ASY A;  1H3M A;  3IOJ A;  2J0B A;  3CKQ A;  1PZY B;  4AYL A;  1JV1 A;  3I0D A;  3T7N A;  1H5T B;  2V0H A;  2W0W A;  2YQS A;  3I0C A;  1VZT A;  3JTJ A;  2Y4L A;  1H5T A;  1H4C A;  1O7O A;  4DE7 A;  2VSI A;  1WT3 A;  2XWM A;  3DJ4 A;  1VGT A;  4D48 A;  4KPX A;  4HO0 A;  1S4O A;  5C8R A;  1TZF A;  4KT7 A;  3OH1 A;  2WVM A;  2OI6 A;  4LW3 A;  1FG5 N;  2VS3 A;  3RMW A;  1HJL A;  4FRQ A;  2RIX A;  4KC2 A;  3BCV A;  1NHE B;  1GWV A;  2JCK A;  3TZT A;  5C49 A;  1W55 A;  2RIT A;  3OC9 A;  1GQC A;  1R7Y A;  1YP3 A;  1ZHJ A;  2VSH A;  4FCU A;  4G3S A;  2YES A;  1E5K A; 
#chains in the Genus database with same CATH homology
 3SX8 A;  1YP4 A;  2C0N A;  2YC3 A;  4KNR A;  2RJ6 A;  2BO8 A;  3I0F A;  1ZJ1 A;  1XHB A;  2Y4K A;  2WGZ A;  2VK9 A;  1WVC A;  4YS8 A;  2I7B A;  4HO3 A;  2OEF A;  2Y4M A;  3D5N A;  3SXB A;  4B42 A;  3ZGG A;  1H4D A;  2W0V A;  4BQH A;  2QKX A;  1LL2 A;  4L41 C;  2AES A;  2XWN A;  1W77 A;  1SS9 A;  5I1F A;  4MYB A;  5DDV A;  1O0R A;  3U2T A;  1WT2 A;  4Y62 A;  4DDZ A;  1H5S D;  4B3U A;  1VH1 A;  1MP4 A;  2P73 A;  3OGZ A;  2D0J A;  1JYL A;  3K8E A;  4EEM A;  4LW6 A;  2VS4 A;  1NKH B;  3USQ A;  1INJ A;  1ZI5 A;  2JCJ A;  4JD0 A;  4DEC A;  3PKQ A;  4GBP A;  2OI7 A;  1K4V A;  2ICX A;  2E3D A;  2P72 A;  3DUV A;  3ZF8 A;  1W57 A;  5CMI A;  2E8B A;  2V0K A;  2V0J A;  5FU8 A;  3T7M A;  2RIY A;  4CJB A;  1QG8 A;  3V90 A;  3SXA A;  4EE4 A;  2VD4 A;  4D11 A;  3OH4 A;  5C36 A;  4M2B A;  2ZU9 A;  4IRQ A;  3CU0 A;  5FYE A;  1VH3 A;  4KQL A;  4BMA A;  3FWW A;  5CQN X;  2AEC A;  1QGQ A;  1EYR A;  3SPT A;  5EIY A;  3OAM A;  1GQ9 A;  3QVB A;  2PGY A;  1R7T A;  1ZI1 A;  2VXM A;  3D98 A;  3ST8 A;  1ZIZ A;  4UEG A;  4CJ8 A;  1G23 A;  1R80 A;  5C47 A;  5CMH A;  4R7P A;  2WEE A;  1HM8 A;  2FYD B;  3V0M A;  2DPW A;  2Y4J A;  3Q4S A;  1G0R A;  4EEG A;  1H5S A;  4FIX A;  1V82 A;  2V0I A;  3V91 A;  2Y6P A;  3I0J A;  1FZW A;  1TW5 A;  4HG6 A;  2YQH A;  2NXV A;  3KIA A;  2AM4 A;  1H7F A;  3U0Y A;  3SX5 A;  1LL0 A;  2RJ5 A;  1H7G A;  1O23 B;  3POL A;  4NAN A;  1JV3 A;  3JUK A;  1WT1 A;  1NWG B;  1LL3 A;  4FRM A;  1VPA A;  1FOA A;  1GA8 A;  2O1G A;  3U2X A;  2YQC A;  2J0A A;  4B2X A;  1R7X A;  2Z86 A;  4G3P A;  1GX4 A;  1H7L A;  1VIC A;  2BO4 A;  2FYA A;  1INI A;  1H4E A;  4FRB A;  2A8U A;  3RSB A;  5CQO A;  4B5B A;  1G9R A;  1H7H A;  4ARW A;  4EEO A;  3CKJ A;  2VFZ A;  2PX7 A;  4KC1 A;  4D0Z A;  4FRA A;  2P6W A;  3V0N A;  5L6V A;  1YP2 A;  2XME A;  2Z87 A;  3EE5 A;  1LZI A;  3N9W A;  5IDT A;  3PKP A;  2AM3 A;  5DDT A;  4Q7C A;  4Y7F A;  1ON8 A;  1FRW A;  1VGU A;  1NQI B;  1H5S C;  1ZJ0 A;  4KRV A;  3E25 A;  1MP5 A;  2A8W A;  4KXO A;  3ZLL A;  2X5S A;  1ZCT A;  3I0I X;  2RJ7 A;  4FIY A;  1I52 A;  3SXE A;  4XWI A;  3T7O A;  4CJC A;  3CKN A;  5FTS A;  1G3L A;  3V0Q A;  3SX7 A;  4Y7V A;  1FXJ A;  4Y9X A;  3V0O A;  1R81 A;  4FRH A;  5AJN A;  2RJ1 A;  3DK5 A;  1OMX A;  3TQD A;  3BRK X;  1ON6 A;  1NMM B;  4Y63 A;  2YC5 A;  4AC3 A;  4HO9 A;  2Q4J A;  1V83 A;  2ZU7 A;  2RJ4 A;  5C48 A;  1GWW A;  4EVW A;  4NAK A;  4HOC A;  4Y7T A;  1XZ6 A;  4B4G A;  1LZJ A;  5EJZ A;  3V0P A;  5FV9 A;  5CQL X;  5C3B A;  5IDS A;  1V84 A;  4B2W A;  3HL3 A;  2PGV A;  3CKO A;  3LW6 A;  1HJJ A;  2FYB A;  1ZDG A;  2WVL A;  5CMF X;  1VZU A;  4NAL A;  5AJP A;  5FTV A;  1VZX A;  5C3A A;  2ZU8 A;  4EE5 A;  3PNN A;  4M2A A;  4C2S A;  4HCQ A;  4MIX A;  4NAI A;  1H5S B;  2JCO A;  5L6S A;  2V0L A;  3ZGF A;  5C4B A;  3K8D A;  3U2U A;  1GX0 A;  3O3P A;  1JVD A;  4P00 A;  5CMG X;  3V8Z A;  2RJ8 A;  2YQJ A;  4K6R A;  5FUH A;  2AE7 A;  1G93 A;  1G95 A;  2WE9 A;  4J18 A;  1G1L A;  3GUE A;  4E1K A;  2RIZ A;  4HO6 A;  1VGZ A;  2FFU A;  2BO6 A;  2VXL A;  1ZJ2 A;  1OMZ A;  1HM9 A;  4CVH A;  2D7I A;  1Z90 A;  2GGQ A;  2O1F A;  1LZ0 A;  1ZCU A;  4D11 C;  3F1Y A;  1TVY A;  1ZJP A;  4FCE A;  5JQQ A;  3Q80 A;  2RJ0 A;  4FRO A;  4M4K A;  3V0L A;  4FRD A;  1EZI A;  4AYJ A;  1R7U A;  1HV9 A;  3Q7U A;  5C4E A;  5C4C A;  3I0E A;  1FR9 A;  3U2V A;  1TW1 A;  1WSZ A;  4G3Q A;  2APC A;  1H7T A;  2ICY A;  5D92 A;  3E26 A;  2AM5 A;  3OKR A;  1JYK A;  1IIM A;  2OEG A;  4MND A;  3RMV A;  5C1H A;  2D7R A;  4EE3 A;  3F1C A;  2XWL A;  3NGW A;  4ASJ A;  2YCM A;  4FRP A;  3IOH A;  4AAW A;  5C4D A;  1VM8 A;  2FYC B;  1O7Q A;  1VGW A;  4O6M A;  3OH0 A;  3USR A;  2WVK A;  2O1H A;  1MP3 A;  1G97 A;  2GGO A;  2QH5 A;  3OH2 A;  4O6N A;  4B4M A;  4ZDQ A;  2AGD A;  4Y6U A;  1ZDF A;  3CKV A;  4ECM A;  1WT0 A;  2UX8 A;  4JIS A;  3IOI A;  4HO8 A;  4Y7U A;  5C3D A;  1MC3 A;  1FR8 A;  1FXO A;  3I0H A;  5EJ1 A;  4IRP A;  1FGG A;  1YRO B;  5J49 A;  2FY7 A;  4EEA A;  1FWY A;  1ZJO A;  2I5K A;  5AJO A;  2XMH A;  5CMJ A;  4P02 A;  1LZ7 A;  3SXC A;  1ZI3 A;  1FO8 A;  3ZLK A;  2X5Z A;  1FGX A;  5HS2 A;  5CQP A;  5C1L A;  2FFV A;  3SXG A;  3OH3 A;  1H7E A;  1JVG A;  5C38 A;  2QGI A;  3CGX A;  3I0L A;  1G2V A;  3U2W A;  2I5E A;  2VS5 A;  3D8V A;  1QWJ A;  4Y64 A;  5CQM X;  1S4N A;  3R3I A;  1NF5 B;  1QGS A;  2CU2 A;  1ZJ3 A;  2X60 A;  4G87 A;  5IFY A;  4FQW A;  1OQM B;  4Y6N A;  1KWS A;  1IIN A;  2RJ9 A;  4D0T A;  3V8Y A;  1PZT A;  2JCL A;  4Y7G A;  1H5R B;  4M28 A;  3I0K A;  1HM0 A;  4HO4 A;  1H5R A;  1ZCY A;  3FOQ A;  1ZCV A;  3U0X A;  2WAW A;  3SXD A;  1ZI4 A;  2X65 A;  4KC4 A;  1R7V A;  2Y7A A;  5C4F A;  4KPZ A;  2BO7 A;  2PA4 A;  2MZB A;  4HO5 A;  3JUJ A;  4FRE A;  1S4P A;  4HO2 A;  5BXC A;  1H7Q A;  3I0G A;  5C1G A;  1FO9 A;  2OI5 A;  3R2W A;  1R82 A;  2AH9 A;  4KNX A;  5D91 A;  1LVW A;  3SX3 A;  1G8O A;  5FU0 A;  4B4B A;  4FRL A;  4ASY A;  1H3M A;  3IOJ A;  2J0B A;  3CKQ A;  1PZY B;  4AYL A;  1JV1 A;  3I0D A;  3T7N A;  1H5T B;  2V0H A;  2W0W A;  2YQS A;  3I0C A;  1VZT A;  3JTJ A;  2Y4L A;  1H5T A;  1H4C A;  1O7O A;  4DE7 A;  2VSI A;  1WT3 A;  2XWM A;  3DJ4 A;  1VGT A;  4D48 A;  4KPX A;  4HO0 A;  1S4O A;  5C8R A;  1TZF A;  4KT7 A;  3OH1 A;  2WVM A;  2OI6 A;  4LW3 A;  1FG5 N;  2VS3 A;  3RMW A;  1HJL A;  4FRQ A;  2RIX A;  4KC2 A;  3BCV A;  1NHE B;  1GWV A;  2JCK A;  3TZT A;  5C49 A;  1W55 A;  2RIT A;  3OC9 A;  1GQC A;  1R7Y A;  1YP3 A;  1ZHJ A;  2VSH A;  4FCU A;  4G3S A;  2YES A;  1E5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...