4CJCA

Orthorhombic crystal form of bogt6a e192q in complex with udp-galnac, udp, galnac
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
241
structure length
241
Chain Sequence
MRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQYGGHEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products.
pubmed doi rcsb
source organism Bacteroides ovatus
molecule tags Transferase
total genus 59
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cjcA00
1VH3A 1WT0A 1HM9A 1W57A 1R82A 1YP3A 3SXCA 1H7TA 3HL3A 1VGWA 4Y64A 1TZFA 1FO9A 3ZF8A 3PKQA 2RJ7A 4Y9XA 3U0YA 3BCVA 1LZ0A 5AJNA 4B4MA 1IINA 1H7GA 3RMWA 1YP2A 2O1HA 5IFYA 1JV1A 1FO8A 4FRLA 3JTJA 2VD4A 4GBPA 3FWWA 4M2BA 4MYBA 3RSBA 4Y7TA 4HO0A 1H5TB 1V83A 1EYRA 2JCOA 2YC5A 1PZYB 1W77A 4EEMA 5C49A 4D0TA 3ZLKA 1JYLA 1ZJ1A 1HJJA 5FTVA 5C4DA 4G87A 1GA8A 3V0MA 2AM4A 1S4PA 5C4EA 2E8BA 4B2XA 3R2WA 3OGZA 4HOCA 4NAKA 2RJ6A 1H5SA 4FCEA 1VH1A 2X5SA 2FYBA 4M2AA 4LW6A 1GQ9A 1VGZA 3PNNA 2WVMA 4Y7FA 3PKPA 2RIXA 4CJ8A 2YCMA 4B4BA 4K6RA 3EE5A 1KWSA 4NANA 3KIAA 2I5KA 2RJ5A 3V0PA 1G1LA 2D7IA 1FXOA 1V84A 3OKRA 2WEEA 1INJA 2YQJA 3CKJA 4G3PA 1O0RA 3SX7A 2E3DA 1FWYA 1ZJ3A 3Q80A 2PGYA 4CVHA 2OI7A 2X60A 3TZTA 3V91A 4CJCA 2XWLA 2ICYA 2Y6PA 1GX0A 5J49A 1ZJOA 3V0NA 5IDSA 5I1FA 3D5NA 1MP3A 2FYAA 3E25A 4AC3A 2XMEA 3T7NA 1G0RA 1WT2A 1ZJPA 5FU8A 1XZ6A 5C1HA 2ZU7A 3SX5A 3SXEA 5BXCA 1JV3A 1H7QA 2YC3A 1Z90A 2VS4A 5CMGX 2CU2A 4HCQA 5AJPA 1H5SC 2P6WA 2V0HA 3D8VA 2PX7A 2YESA 1LL2A 3CKNA 1H7EA 1VGUA 1H5RB 2I5EA 2Y4LA 5CQNX 4KNRA 5CQLX 1I52A 4L41C 1WT3A 1FG5N 4D48A 1ZIZA 4KC1A 4DDZA 4B3UA 1S4NA 1VGTA 3F1YA 4XWIA 1IIMA 4IRQA 1NMMB 1FGGA 3SXDA 3DUVA 4BMAA 2AECA 5CQOA 1HV9A 5C3AA 3OH3A 2AH9A 1GWVA 2BO4A 2Y4KA 3OAMA 4KRVA 3POLA 4Y7VA 1NQIB 2BO8A 2FYDB 4KNXA 2GGQA 3SPTA 4CJBA 1GQCA 2D0JA 1H4EA 3CU0A 3D98A 4EEOA 2WAWA 1ZJ2A 1ZDGA 4BQHA 4Y6UA 2VXLA 4JISA 5JQQA 3V90A 3CGXA 3OH4A 4C2SA 4HO8A 1G3LA 3K8EA 2ZU8A 1MP4A 1ZCYA 2V0JA 5CQPA 2Y4MA 1XHBA 5C3BA 3TQDA 3USRA 5C38A 2A8WA 2YQHA 3V0LA 1WSZA 3I0IX 4D11A 4HO3A 4KPXA 1W55A 1FXJA 1VZTA 1ZDFA 1WT1A 4Y62A 4KXOA 1ZCVA 3U2TA 4Y6NA 3CKQA 1FOAA 1H5SB 1H5TA 1R7YA 2O1GA 4ASJA 5FV9A 2I7BA 1G93A 4EVWA 2XWNA 2PGVA 1NHEB 2VXMA 1ZCTA 1E5KA 1QWJA 2JCKA 4FRBA 2WGZA 3T7OA 2GGOA 2WVLA 1R7UA 2JCJA 3Q4SA 5C4FA 2ZU9A 4DECA 1OQMB 5CQMX 1WVCA 2FYCB 2Y7AA 2QKXA 5CMHA 2BO7A 1ON8A 5C47A 5FYEA 1S4OA 3V8ZA 4EEGA 5EJ1A 1MC3A 2PA4A 3FOQA 1QG8A 2OI5A 1LZ7A 1FR9A 5C8RA 2VS3A 4FCUA 4DE7A 4YS8A 4Y7GA 1TW1A 5C4CA 4UEGA 2Q4JA 2P72A 4FREA 5L6VA 2D7RA 1H3MA 3OH0A 4D11C 3DK5A 1V82A 3USQA 4G3QA 1NF5B 4NAIA 4NALA 3JUKA 5FU0A 3RMVA 4EE5A 2A8UA 1R7XA 4G3SA 5CMJA 4ECMA 2FFUA 5DDTA 4FQWA 3V8YA 4P00A 4ASYA 1FZWA 2VSIA 2AM5A 1JVDA 2XWMA 3R3IA 2DPWA 2XMHA 2X65A 4M4KA 2UX8A 4ARWA 4FRQA 1G2VA 2AGDA 3ST8A 2YQCA 1O7OA 1K4VA 1GWWA 3I0DA 1H4DA 1VICA 3Q7UA 3GUEA 3I0CA 3F1CA 1LZIA 2RJ4A 2AM3A 3U2XA 4B42A 3U2UA 1ZI1A 4JD0A 4AAWA 2VFZA 4B2WA 5CMFX 4J18A 1ZJ0A 2Z87A 4IRPA 4EE3A 4HO9A 1H5RA 1FRWA 2V0IA 3I0KA 3NGWA 3CKOA 3SX8A 3I0LA 1G8OA 2RITA 1FGXA 1VPAA 5HS2A 1NKHB 2X5ZA 3DJ4A 2W0VA 5DDVA 1ZI3A 4FRMA 4KQLA 3IOJA 3BRKX 2ICXA 3O3PA 4HO2A 4FRAA 2OEGA 4AYLA 3SXBA 3OH1A 3V0QA 2MZBA 1ZI5A 4KT7A 1HM8A 3ZLLA 4M28A 1LL0A 4MNDA 1VZXA 1H4CA 1JVGA 1ZHJA 1GX4A 5C48A 2V0KA 4B5BA 5FTSA 1LZJA 1PZTA 3T7MA 2WE9A 1R7TA 1G95A 3LW6A 1R80A 3U2VA 4FROA 4FRDA 1G97A 1R7VA 2Y4JA 4KC2A 2APCA 3I0EA 2RJ0A 2AE7A 3OH2A 5C3DA 3QVBA 2RJ8A 3N9WA 1JYKA 4R7PA 4P02A 2RJ9A 3IOHA 1EZIA 1HJLA 2VS5A 2QGIA 2OEFA 1LVWA 1NWGB 1O7QA 1ZCUA 1ZI4A 1YP4A 2VSHA 3K8DA 5FUHA 4EE4A 1TVYA 5C1GA 2AESA 2WVKA 2QH5A 5C4BA 2RIZA 5L6SA 1VZUA 5C1LA 5AJOA 1H7HA 4Y7UA 4Y63A 2P73A 2BO6A 1H7FA 3I0JA 5EJZA 4HO4A 1G9RA 2W0WA 4HO6A 4LW3A 4EEAA 5C36A 1OMZA 1R81A 2FFVA 1MP5A 3SX3A 1O23B 1H5SD 2YQSA 1SS9A 1INIA 4D0ZA 5EIYA 1QGSA 3E26A 3JUJA 2FY7A 3U0XA 4FRPA 3I0HA 5CMIA 1ON6A 1QGQA 4KPZA 3V0OA 2V0LA 3SXAA 4HG6A 1YROB 4HO5A 1HM0A 1TW5A 2JCLA 2RJ1A 2O1FA 3U2WA 4AYJA 5IDTA 2NXVA 1FR8A 2Z86A 1H7LA 2RIYA 4E1KA 3SXGA 3ZGFA 1LL3A 4FRHA 2OI6A 3ZGGA 3CKVA 4B4GA 1VM8A 4ZDQA 3I0GA 3OC9A 3I0FA 3IOIA 1G23A 4KC4A 1OMXA
chains in the Genus database with same CATH superfamily
1VH3A 1WT0A 1HM9A 1W57A 1R82A 1YP3A 3SXCA 1H7TA 3HL3A 1VGWA 4Y64A 1TZFA 1FO9A 3ZF8A 3PKQA 2RJ7A 4Y9XA 3U0YA 3BCVA 1LZ0A 5AJNA 4B4MA 1IINA 1H7GA 3RMWA 1YP2A 2O1HA 5IFYA 1JV1A 1FO8A 4FRLA 3JTJA 2VD4A 4GBPA 3FWWA 4M2BA 4MYBA 3RSBA 4Y7TA 4HO0A 1H5TB 1V83A 1EYRA 2JCOA 2YC5A 1PZYB 2J0AA 1W77A 4EEMA 5C49A 4D0TA 3ZLKA 1JYLA 2J0BA 1ZJ1A 1HJJA 5FTVA 5C4DA 4G87A 1GA8A 3V0MA 2AM4A 1S4PA 5C4EA 2E8BA 4B2XA 3R2WA 3OGZA 4HOCA 4NAKA 2RJ6A 1H5SA 4FCEA 1VH1A 2X5SA 2FYBA 4M2AA 4LW6A 1GQ9A 1VGZA 3PNNA 2WVMA 4Y7FA 3PKPA 2RIXA 4CJ8A 2C0NA 2YCMA 4B4BA 4K6RA 3EE5A 1KWSA 4NANA 5D92A 3KIAA 2I5KA 2RJ5A 3V0PA 1G1LA 2D7IA 4Q7CA 1FXOA 1V84A 3OKRA 2WEEA 1INJA 2YQJA 3CKJA 4G3PA 1O0RA 3SX7A 2E3DA 1FWYA 1ZJ3A 3Q80A 2PGYA 4CVHA 2OI7A 2X60A 3TZTA 3V91A 4CJCA 2XWLA 2ICYA 2Y6PA 1GX0A 5J49A 1ZJOA 3V0NA 5IDSA 5I1FA 3D5NA 1MP3A 2FYAA 3E25A 4AC3A 2XMEA 3T7NA 1G0RA 1WT2A 1ZJPA 5FU8A 1XZ6A 5C1HA 2ZU7A 3SX5A 3SXEA 5BXCA 1JV3A 1H7QA 2YC3A 1Z90A 2VS4A 5CMGX 2CU2A 4HCQA 5AJPA 1H5SC 2P6WA 2V0HA 3D8VA 2PX7A 2YESA 1LL2A 3CKNA 1H7EA 1VGUA 1H5RB 2I5EA 2Y4LA 5CQNX 4KNRA 5CQLX 1I52A 4L41C 1WT3A 1FG5N 4D48A 1ZIZA 4KC1A 4DDZA 4B3UA 1S4NA 1VGTA 3F1YA 4XWIA 1IIMA 4IRQA 1NMMB 1FGGA 3SXDA 3DUVA 4BMAA 2AECA 5CQOA 1HV9A 5C3AA 3OH3A 2AH9A 1GWVA 2BO4A 2Y4KA 3OAMA 4KRVA 3POLA 4Y7VA 1NQIB 2BO8A 2FYDB 4KNXA 2GGQA 3SPTA 4CJBA 1GQCA 2D0JA 1H4EA 4FIYA 3CU0A 3D98A 4EEOA 2WAWA 1ZJ2A 1ZDGA 4BQHA 2VK9A 4Y6UA 2VXLA 4JISA 5JQQA 3V90A 3CGXA 3OH4A 4C2SA 4HO8A 1G3LA 3K8EA 2ZU8A 1MP4A 1ZCYA 2V0JA 5CQPA 2Y4MA 1XHBA 5C3BA 3TQDA 3USRA 5C38A 2A8WA 2YQHA 3V0LA 1WSZA 3I0IX 4D11A 4HO3A 4KPXA 1W55A 1FXJA 1VZTA 1ZDFA 1WT1A 4Y62A 4KXOA 1ZCVA 3U2TA 4Y6NA 3CKQA 1FOAA 1H5SB 1H5TA 1R7YA 2O1GA 4O6NA 4ASJA 5FV9A 2I7BA 1G93A 4EVWA 2XWNA 2PGVA 1NHEB 4MIXA 2VXMA 1ZCTA 1E5KA 1QWJA 2JCKA 4FRBA 2WGZA 3T7OA 2GGOA 2WVLA 1R7UA 2JCJA 3Q4SA 5C4FA 2ZU9A 4DECA 1OQMB 5CQMX 1WVCA 2FYCB 2Y7AA 2QKXA 5CMHA 2BO7A 1ON8A 5C47A 5FYEA 1S4OA 3V8ZA 4EEGA 5EJ1A 1MC3A 2PA4A 3FOQA 1QG8A 2OI5A 1LZ7A 1FR9A 5C8RA 2VS3A 4FCUA 4DE7A 4YS8A 4Y7GA 1TW1A 5C4CA 4UEGA 2Q4JA 2P72A 4FREA 5L6VA 2D7RA 1H3MA 3OH0A 4D11C 3DK5A 1V82A 3USQA 4G3QA 1NF5B 4NAIA 4NALA 4O6MA 3JUKA 5FU0A 3RMVA 4EE5A 2A8UA 1R7XA 4G3SA 5CMJA 4ECMA 2FFUA 5DDTA 4FQWA 3V8YA 4P00A 4ASYA 1FZWA 2VSIA 2AM5A 1JVDA 2XWMA 3R3IA 2DPWA 2XMHA 2X65A 4M4KA 2UX8A 4ARWA 4FRQA 1G2VA 2AGDA 3ST8A 2YQCA 1O7OA 1K4VA 1GWWA 3I0DA 1H4DA 1VICA 3Q7UA 3GUEA 3I0CA 3F1CA 1LZIA 2RJ4A 2AM3A 3U2XA 4B42A 3U2UA 1ZI1A 4JD0A 4AAWA 2VFZA 4B2WA 5CMFX 4J18A 1ZJ0A 2Z87A 4IRPA 4EE3A 4HO9A 1H5RA 1FRWA 2V0IA 3I0KA 3NGWA 3CKOA 3SX8A 3I0LA 1G8OA 2RITA 1FGXA 1VPAA 5HS2A 1NKHB 2X5ZA 3DJ4A 2W0VA 5DDVA 1ZI3A 4FRMA 4KQLA 3IOJA 3BRKX 2ICXA 3O3PA 4HO2A 4FRAA 2OEGA 4AYLA 3SXBA 3OH1A 3V0QA 2MZBA 1ZI5A 4KT7A 1HM8A 3ZLLA 4M28A 1LL0A 4MNDA 1VZXA 1H4CA 1JVGA 1ZHJA 1GX4A 5C48A 2V0KA 4B5BA 5FTSA 1LZJA 1PZTA 3T7MA 2WE9A 1R7TA 1G95A 3LW6A 1R80A 3U2VA 4FROA 4FRDA 1G97A 1R7VA 4FIXA 2Y4JA 4KC2A 2APCA 3I0EA 2RJ0A 2AE7A 3OH2A 5C3DA 3QVBA 2RJ8A 3N9WA 1JYKA 4R7PA 4P02A 2RJ9A 3IOHA 1EZIA 1HJLA 2VS5A 2QGIA 2OEFA 1LVWA 1NWGB 1O7QA 1ZCUA 1ZI4A 1YP4A 2VSHA 3K8DA 5FUHA 4EE4A 1TVYA 5C1GA 2AESA 2WVKA 2QH5A 5C4BA 2RIZA 5L6SA 1VZUA 5C1LA 5AJOA 1H7HA 4Y7UA 4Y63A 2P73A 2BO6A 1H7FA 3I0JA 5EJZA 4HO4A 1G9RA 2W0WA 4HO6A 4LW3A 4EEAA 5C36A 1OMZA 1R81A 2FFVA 1MP5A 3SX3A 1O23B 1H5SD 2YQSA 1SS9A 1INIA 4D0ZA 5EIYA 1QGSA 3E26A 3JUJA 2FY7A 3U0XA 4FRPA 3I0HA 5CMIA 1ON6A 1QGQA 4KPZA 3V0OA 2V0LA 3SXAA 4HG6A 1YROB 4HO5A 1HM0A 1TW5A 2JCLA 2RJ1A 2O1FA 3U2WA 4AYJA 5IDTA 2NXVA 1FR8A 2Z86A 1H7LA 2RIYA 4E1KA 3SXGA 3ZGFA 1LL3A 4FRHA 2OI6A 3ZGGA 3CKVA 4B4GA 1VM8A 4ZDQA 3I0GA 3OC9A 3I0FA 5D91A 3IOIA 1G23A 4KC4A 1OMXA
chains in the Genus database with same CATH topology
1VH3A 1WT0A 1HM9A 1W57A 1R82A 1YP3A 3SXCA 1H7TA 3HL3A 1VGWA 4Y64A 1TZFA 1FO9A 3ZF8A 3PKQA 2RJ7A 4Y9XA 3U0YA 3BCVA 1LZ0A 5AJNA 4B4MA 1IINA 1H7GA 3RMWA 1YP2A 2O1HA 5IFYA 1JV1A 1FO8A 4FRLA 3JTJA 2VD4A 4GBPA 3FWWA 4M2BA 4MYBA 3RSBA 4Y7TA 4HO0A 1H5TB 1V83A 1EYRA 2JCOA 2YC5A 1PZYB 2J0AA 1W77A 4EEMA 5C49A 4D0TA 3ZLKA 1JYLA 2J0BA 1ZJ1A 1HJJA 5FTVA 5C4DA 4G87A 1GA8A 3V0MA 2AM4A 1S4PA 5C4EA 2E8BA 4B2XA 3R2WA 3OGZA 4HOCA 4NAKA 2RJ6A 1H5SA 4FCEA 1VH1A 2X5SA 2FYBA 4M2AA 4LW6A 1GQ9A 1VGZA 3PNNA 2WVMA 4Y7FA 3PKPA 2RIXA 4CJ8A 2C0NA 2YCMA 4B4BA 4K6RA 3EE5A 1KWSA 4NANA 5D92A 3KIAA 2I5KA 2RJ5A 3V0PA 1G1LA 2D7IA 4Q7CA 1FXOA 1V84A 3OKRA 2WEEA 1INJA 2YQJA 3CKJA 4G3PA 1O0RA 3SX7A 2E3DA 1FWYA 1ZJ3A 3Q80A 2PGYA 4CVHA 2OI7A 2X60A 3TZTA 3V91A 4CJCA 2XWLA 2ICYA 2Y6PA 1GX0A 5J49A 1ZJOA 3V0NA 5IDSA 5I1FA 3D5NA 1MP3A 2FYAA 3E25A 4AC3A 2XMEA 3T7NA 1G0RA 1WT2A 1ZJPA 5FU8A 1XZ6A 5C1HA 2ZU7A 3SX5A 3SXEA 5BXCA 1JV3A 1H7QA 2YC3A 1Z90A 2VS4A 5CMGX 2CU2A 4HCQA 5AJPA 1H5SC 2P6WA 2V0HA 3D8VA 2PX7A 2YESA 1LL2A 3CKNA 1H7EA 1VGUA 1H5RB 2I5EA 2Y4LA 5CQNX 4KNRA 5CQLX 1I52A 4L41C 1WT3A 1FG5N 4D48A 1ZIZA 4KC1A 4DDZA 4B3UA 1S4NA 1VGTA 3F1YA 4XWIA 1IIMA 4IRQA 1NMMB 1FGGA 3SXDA 3DUVA 4BMAA 2AECA 5CQOA 1HV9A 5C3AA 3OH3A 2AH9A 1GWVA 2BO4A 2Y4KA 3OAMA 4KRVA 3POLA 4Y7VA 1NQIB 2BO8A 2FYDB 4KNXA 2GGQA 3SPTA 4CJBA 1GQCA 2D0JA 1H4EA 4FIYA 3CU0A 3D98A 4EEOA 2WAWA 1ZJ2A 1ZDGA 4BQHA 2VK9A 4Y6UA 2VXLA 4JISA 5JQQA 3V90A 3CGXA 3OH4A 4C2SA 4HO8A 1G3LA 3K8EA 2ZU8A 1MP4A 1ZCYA 2V0JA 5CQPA 2Y4MA 1XHBA 5C3BA 3TQDA 3USRA 5C38A 2A8WA 2YQHA 3V0LA 1WSZA 3I0IX 4D11A 4HO3A 4KPXA 1W55A 1FXJA 1VZTA 1ZDFA 1WT1A 4Y62A 4KXOA 1ZCVA 3U2TA 4Y6NA 3CKQA 1FOAA 1H5SB 1H5TA 1R7YA 2O1GA 4O6NA 4ASJA 5FV9A 2I7BA 1G93A 4EVWA 2XWNA 2PGVA 1NHEB 4MIXA 2VXMA 1ZCTA 1E5KA 1QWJA 2JCKA 4FRBA 2WGZA 3T7OA 2GGOA 2WVLA 1R7UA 2JCJA 3Q4SA 5C4FA 2ZU9A 4DECA 1OQMB 5CQMX 1WVCA 2FYCB 2Y7AA 2QKXA 5CMHA 2BO7A 1ON8A 5C47A 5FYEA 1S4OA 3V8ZA 4EEGA 5EJ1A 1MC3A 2PA4A 3FOQA 1QG8A 2OI5A 1LZ7A 1FR9A 5C8RA 2VS3A 4FCUA 4DE7A 4YS8A 4Y7GA 1TW1A 5C4CA 4UEGA 2Q4JA 2P72A 4FREA 5L6VA 2D7RA 1H3MA 3OH0A 4D11C 3DK5A 1V82A 3USQA 4G3QA 1NF5B 4NAIA 4NALA 4O6MA 3JUKA 5FU0A 3RMVA 4EE5A 2A8UA 1R7XA 4G3SA 5CMJA 4ECMA 2FFUA 5DDTA 4FQWA 3V8YA 4P00A 4ASYA 1FZWA 2VSIA 2AM5A 1JVDA 2XWMA 3R3IA 2DPWA 2XMHA 2X65A 4M4KA 2UX8A 4ARWA 4FRQA 1G2VA 2AGDA 3ST8A 2YQCA 1O7OA 1K4VA 1GWWA 3I0DA 1H4DA 1VICA 3Q7UA 3GUEA 3I0CA 3F1CA 1LZIA 2RJ4A 2AM3A 3U2XA 4B42A 3U2UA 1ZI1A 4JD0A 4AAWA 2VFZA 4B2WA 5CMFX 4J18A 1ZJ0A 2Z87A 4IRPA 4EE3A 4HO9A 1H5RA 1FRWA 2V0IA 3I0KA 3NGWA 3CKOA 3SX8A 3I0LA 1G8OA 2RITA 1FGXA 1VPAA 5HS2A 1NKHB 2X5ZA 3DJ4A 2W0VA 5DDVA 1ZI3A 4FRMA 4KQLA 3IOJA 3BRKX 2ICXA 3O3PA 4HO2A 4FRAA 2OEGA 4AYLA 3SXBA 3OH1A 3V0QA 2MZBA 1ZI5A 4KT7A 1HM8A 3ZLLA 4M28A 1LL0A 4MNDA 1VZXA 1H4CA 1JVGA 1ZHJA 1GX4A 5C48A 2V0KA 4B5BA 5FTSA 1LZJA 1PZTA 3T7MA 2WE9A 1R7TA 1G95A 3LW6A 1R80A 3U2VA 4FROA 4FRDA 1G97A 1R7VA 4FIXA 2Y4JA 4KC2A 2APCA 3I0EA 2RJ0A 2AE7A 3OH2A 5C3DA 3QVBA 2RJ8A 3N9WA 1JYKA 4R7PA 4P02A 2RJ9A 3IOHA 1EZIA 1HJLA 2VS5A 2QGIA 2OEFA 1LVWA 1NWGB 1O7QA 1ZCUA 1ZI4A 1YP4A 2VSHA 3K8DA 5FUHA 4EE4A 1TVYA 5C1GA 2AESA 2WVKA 2QH5A 5C4BA 2RIZA 5L6SA 1VZUA 5C1LA 5AJOA 1H7HA 4Y7UA 4Y63A 2P73A 2BO6A 1H7FA 3I0JA 5EJZA 4HO4A 1G9RA 2W0WA 4HO6A 4LW3A 4EEAA 5C36A 1OMZA 1R81A 2FFVA 1MP5A 3SX3A 1O23B 1H5SD 2YQSA 1SS9A 1INIA 4D0ZA 5EIYA 1QGSA 3E26A 3JUJA 2FY7A 3U0XA 4FRPA 3I0HA 5CMIA 1ON6A 1QGQA 4KPZA 3V0OA 2V0LA 3SXAA 4HG6A 1YROB 4HO5A 1HM0A 1TW5A 2JCLA 2RJ1A 2O1FA 3U2WA 4AYJA 5IDTA 2NXVA 1FR8A 2Z86A 1H7LA 2RIYA 4E1KA 3SXGA 3ZGFA 1LL3A 4FRHA 2OI6A 3ZGGA 3CKVA 4B4GA 1VM8A 4ZDQA 3I0GA 3OC9A 3I0FA 5D91A 3IOIA 1G23A 4KC4A 1OMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH3 A;  1WT0 A;  1HM9 A;  1W57 A;  1R82 A;  1YP3 A;  3SXC A;  1H7T A;  3HL3 A;  1VGW A;  4Y64 A;  1TZF A;  1FO9 A;  3ZF8 A;  3PKQ A;  2RJ7 A;  4Y9X A;  3U0Y A;  3BCV A;  1LZ0 A;  5AJN A;  4B4M A;  1IIN A;  1H7G A;  3RMW A;  1YP2 A;  2O1H A;  5IFY A;  1JV1 A;  1FO8 A;  4FRL A;  3JTJ A;  2VD4 A;  4GBP A;  3FWW A;  4M2B A;  4MYB A;  3RSB A;  4Y7T A;  4HO0 A;  1H5T B;  1V83 A;  1EYR A;  2JCO A;  2YC5 A;  1PZY B;  1W77 A;  4EEM A;  5C49 A;  4D0T A;  3ZLK A;  1JYL A;  1ZJ1 A;  1HJJ A;  5FTV A;  5C4D A;  4G87 A;  1GA8 A;  3V0M A;  2AM4 A;  1S4P A;  5C4E A;  2E8B A;  4B2X A;  3R2W A;  3OGZ A;  4HOC A;  4NAK A;  2RJ6 A;  1H5S A;  4FCE A;  1VH1 A;  2X5S A;  2FYB A;  4M2A A;  4LW6 A;  1GQ9 A;  1VGZ A;  3PNN A;  2WVM A;  4Y7F A;  3PKP A;  2RIX A;  4CJ8 A;  2YCM A;  4B4B A;  4K6R A;  3EE5 A;  1KWS A;  4NAN A;  3KIA A;  2I5K A;  2RJ5 A;  3V0P A;  1G1L A;  2D7I A;  1FXO A;  1V84 A;  3OKR A;  2WEE A;  1INJ A;  2YQJ A;  3CKJ A;  4G3P A;  1O0R A;  3SX7 A;  2E3D A;  1FWY A;  1ZJ3 A;  3Q80 A;  2PGY A;  4CVH A;  2OI7 A;  2X60 A;  3TZT A;  3V91 A;  4CJC A;  2XWL A;  2ICY A;  2Y6P A;  1GX0 A;  5J49 A;  1ZJO A;  3V0N A;  5IDS A;  5I1F A;  3D5N A;  1MP3 A;  2FYA A;  3E25 A;  4AC3 A;  2XME A;  3T7N A;  1G0R A;  1WT2 A;  1ZJP A;  5FU8 A;  1XZ6 A;  5C1H A;  2ZU7 A;  3SX5 A;  3SXE A;  5BXC A;  1JV3 A;  1H7Q A;  2YC3 A;  1Z90 A;  2VS4 A;  5CMG X;  2CU2 A;  4HCQ A;  5AJP A;  1H5S C;  2P6W A;  2V0H A;  3D8V A;  2PX7 A;  2YES A;  1LL2 A;  3CKN A;  1H7E A;  1VGU A;  1H5R B;  2I5E A;  2Y4L A;  5CQN X;  4KNR A;  5CQL X;  1I52 A;  4L41 C;  1WT3 A;  1FG5 N;  4D48 A;  1ZIZ A;  4KC1 A;  4DDZ A;  4B3U A;  1S4N A;  1VGT A;  3F1Y A;  4XWI A;  1IIM A;  4IRQ A;  1NMM B;  1FGG A;  3SXD A;  3DUV A;  4BMA A;  2AEC A;  5CQO A;  1HV9 A;  5C3A A;  3OH3 A;  2AH9 A;  1GWV A;  2BO4 A;  2Y4K A;  3OAM A;  4KRV A;  3POL A;  4Y7V A;  1NQI B;  2BO8 A;  2FYD B;  4KNX A;  2GGQ A;  3SPT A;  4CJB A;  1GQC A;  2D0J A;  1H4E A;  3CU0 A;  3D98 A;  4EEO A;  2WAW A;  1ZJ2 A;  1ZDG A;  4BQH A;  4Y6U A;  2VXL A;  4JIS A;  5JQQ A;  3V90 A;  3CGX A;  3OH4 A;  4C2S A;  4HO8 A;  1G3L A;  3K8E A;  2ZU8 A;  1MP4 A;  1ZCY A;  2V0J A;  5CQP A;  2Y4M A;  1XHB A;  5C3B A;  3TQD A;  3USR A;  5C38 A;  2A8W A;  2YQH A;  3V0L A;  1WSZ A;  3I0I X;  4D11 A;  4HO3 A;  4KPX A;  1W55 A;  1FXJ A;  1VZT A;  1ZDF A;  1WT1 A;  4Y62 A;  4KXO A;  1ZCV A;  3U2T A;  4Y6N A;  3CKQ A;  1FOA A;  1H5S B;  1H5T A;  1R7Y A;  2O1G A;  4ASJ A;  5FV9 A;  2I7B A;  1G93 A;  4EVW A;  2XWN A;  2PGV A;  1NHE B;  2VXM A;  1ZCT A;  1E5K A;  1QWJ A;  2JCK A;  4FRB A;  2WGZ A;  3T7O A;  2GGO A;  2WVL A;  1R7U A;  2JCJ A;  3Q4S A;  5C4F A;  2ZU9 A;  4DEC A;  1OQM B;  5CQM X;  1WVC A;  2FYC B;  2Y7A A;  2QKX A;  5CMH A;  2BO7 A;  1ON8 A;  5C47 A;  5FYE A;  1S4O A;  3V8Z A;  4EEG A;  5EJ1 A;  1MC3 A;  2PA4 A;  3FOQ A;  1QG8 A;  2OI5 A;  1LZ7 A;  1FR9 A;  5C8R A;  2VS3 A;  4FCU A;  4DE7 A;  4YS8 A;  4Y7G A;  1TW1 A;  5C4C A;  4UEG A;  2Q4J A;  2P72 A;  4FRE A;  5L6V A;  2D7R A;  1H3M A;  3OH0 A;  4D11 C;  3DK5 A;  1V82 A;  3USQ A;  4G3Q A;  1NF5 B;  4NAI A;  4NAL A;  3JUK A;  5FU0 A;  3RMV A;  4EE5 A;  2A8U A;  1R7X A;  4G3S A;  5CMJ A;  4ECM A;  2FFU A;  5DDT A;  4FQW A;  3V8Y A;  4P00 A;  4ASY A;  1FZW A;  2VSI A;  2AM5 A;  1JVD A;  2XWM A;  3R3I A;  2DPW A;  2XMH A;  2X65 A;  4M4K A;  2UX8 A;  4ARW A;  4FRQ A;  1G2V A;  2AGD A;  3ST8 A;  2YQC A;  1O7O A;  1K4V A;  1GWW A;  3I0D A;  1H4D A;  1VIC A;  3Q7U A;  3GUE A;  3I0C A;  3F1C A;  1LZI A;  2RJ4 A;  2AM3 A;  3U2X A;  4B42 A;  3U2U A;  1ZI1 A;  4JD0 A;  4AAW A;  2VFZ A;  4B2W A;  5CMF X;  4J18 A;  1ZJ0 A;  2Z87 A;  4IRP A;  4EE3 A;  4HO9 A;  1H5R A;  1FRW A;  2V0I A;  3I0K A;  3NGW A;  3CKO A;  3SX8 A;  3I0L A;  1G8O A;  2RIT A;  1FGX A;  1VPA A;  5HS2 A;  1NKH B;  2X5Z A;  3DJ4 A;  2W0V A;  5DDV A;  1ZI3 A;  4FRM A;  4KQL A;  3IOJ A;  3BRK X;  2ICX A;  3O3P A;  4HO2 A;  4FRA A;  2OEG A;  4AYL A;  3SXB A;  3OH1 A;  3V0Q A;  2MZB A;  1ZI5 A;  4KT7 A;  1HM8 A;  3ZLL A;  4M28 A;  1LL0 A;  4MND A;  1VZX A;  1H4C A;  1JVG A;  1ZHJ A;  1GX4 A;  5C48 A;  2V0K A;  4B5B A;  5FTS A;  1LZJ A;  1PZT A;  3T7M A;  2WE9 A;  1R7T A;  1G95 A;  3LW6 A;  1R80 A;  3U2V A;  4FRO A;  4FRD A;  1G97 A;  1R7V A;  2Y4J A;  4KC2 A;  2APC A;  3I0E A;  2RJ0 A;  2AE7 A;  3OH2 A;  5C3D A;  3QVB A;  2RJ8 A;  3N9W A;  1JYK A;  4R7P A;  4P02 A;  2RJ9 A;  3IOH A;  1EZI A;  1HJL A;  2VS5 A;  2QGI A;  2OEF A;  1LVW A;  1NWG B;  1O7Q A;  1ZCU A;  1ZI4 A;  1YP4 A;  2VSH A;  3K8D A;  5FUH A;  4EE4 A;  1TVY A;  5C1G A;  2AES A;  2WVK A;  2QH5 A;  5C4B A;  2RIZ A;  5L6S A;  1VZU A;  5C1L A;  5AJO A;  1H7H A;  4Y7U A;  4Y63 A;  2P73 A;  2BO6 A;  1H7F A;  3I0J A;  5EJZ A;  4HO4 A;  1G9R A;  2W0W A;  4HO6 A;  4LW3 A;  4EEA A;  5C36 A;  1OMZ A;  1R81 A;  2FFV A;  1MP5 A;  3SX3 A;  1O23 B;  1H5S D;  2YQS A;  1SS9 A;  1INI A;  4D0Z A;  5EIY A;  1QGS A;  3E26 A;  3JUJ A;  2FY7 A;  3U0X A;  4FRP A;  3I0H A;  5CMI A;  1ON6 A;  1QGQ A;  4KPZ A;  3V0O A;  2V0L A;  3SXA A;  4HG6 A;  1YRO B;  4HO5 A;  1HM0 A;  1TW5 A;  2JCL A;  2RJ1 A;  2O1F A;  3U2W A;  4AYJ A;  5IDT A;  2NXV A;  1FR8 A;  2Z86 A;  1H7L A;  2RIY A;  4E1K A;  3SXG A;  3ZGF A;  1LL3 A;  4FRH A;  2OI6 A;  3ZGG A;  3CKV A;  4B4G A;  1VM8 A;  4ZDQ A;  3I0G A;  3OC9 A;  3I0F A;  3IOI A;  1G23 A;  4KC4 A;  1OMX A; 
#chains in the Genus database with same CATH topology
 1VH3 A;  1WT0 A;  1HM9 A;  1W57 A;  1R82 A;  1YP3 A;  3SXC A;  1H7T A;  3HL3 A;  1VGW A;  4Y64 A;  1TZF A;  1FO9 A;  3ZF8 A;  3PKQ A;  2RJ7 A;  4Y9X A;  3U0Y A;  3BCV A;  1LZ0 A;  5AJN A;  4B4M A;  1IIN A;  1H7G A;  3RMW A;  1YP2 A;  2O1H A;  5IFY A;  1JV1 A;  1FO8 A;  4FRL A;  3JTJ A;  2VD4 A;  4GBP A;  3FWW A;  4M2B A;  4MYB A;  3RSB A;  4Y7T A;  4HO0 A;  1H5T B;  1V83 A;  1EYR A;  2JCO A;  2YC5 A;  1PZY B;  2J0A A;  1W77 A;  4EEM A;  5C49 A;  4D0T A;  3ZLK A;  1JYL A;  2J0B A;  1ZJ1 A;  1HJJ A;  5FTV A;  5C4D A;  4G87 A;  1GA8 A;  3V0M A;  2AM4 A;  1S4P A;  5C4E A;  2E8B A;  4B2X A;  3R2W A;  3OGZ A;  4HOC A;  4NAK A;  2RJ6 A;  1H5S A;  4FCE A;  1VH1 A;  2X5S A;  2FYB A;  4M2A A;  4LW6 A;  1GQ9 A;  1VGZ A;  3PNN A;  2WVM A;  4Y7F A;  3PKP A;  2RIX A;  4CJ8 A;  2C0N A;  2YCM A;  4B4B A;  4K6R A;  3EE5 A;  1KWS A;  4NAN A;  5D92 A;  3KIA A;  2I5K A;  2RJ5 A;  3V0P A;  1G1L A;  2D7I A;  4Q7C A;  1FXO A;  1V84 A;  3OKR A;  2WEE A;  1INJ A;  2YQJ A;  3CKJ A;  4G3P A;  1O0R A;  3SX7 A;  2E3D A;  1FWY A;  1ZJ3 A;  3Q80 A;  2PGY A;  4CVH A;  2OI7 A;  2X60 A;  3TZT A;  3V91 A;  4CJC A;  2XWL A;  2ICY A;  2Y6P A;  1GX0 A;  5J49 A;  1ZJO A;  3V0N A;  5IDS A;  5I1F A;  3D5N A;  1MP3 A;  2FYA A;  3E25 A;  4AC3 A;  2XME A;  3T7N A;  1G0R A;  1WT2 A;  1ZJP A;  5FU8 A;  1XZ6 A;  5C1H A;  2ZU7 A;  3SX5 A;  3SXE A;  5BXC A;  1JV3 A;  1H7Q A;  2YC3 A;  1Z90 A;  2VS4 A;  5CMG X;  2CU2 A;  4HCQ A;  5AJP A;  1H5S C;  2P6W A;  2V0H A;  3D8V A;  2PX7 A;  2YES A;  1LL2 A;  3CKN A;  1H7E A;  1VGU A;  1H5R B;  2I5E A;  2Y4L A;  5CQN X;  4KNR A;  5CQL X;  1I52 A;  4L41 C;  1WT3 A;  1FG5 N;  4D48 A;  1ZIZ A;  4KC1 A;  4DDZ A;  4B3U A;  1S4N A;  1VGT A;  3F1Y A;  4XWI A;  1IIM A;  4IRQ A;  1NMM B;  1FGG A;  3SXD A;  3DUV A;  4BMA A;  2AEC A;  5CQO A;  1HV9 A;  5C3A A;  3OH3 A;  2AH9 A;  1GWV A;  2BO4 A;  2Y4K A;  3OAM A;  4KRV A;  3POL A;  4Y7V A;  1NQI B;  2BO8 A;  2FYD B;  4KNX A;  2GGQ A;  3SPT A;  4CJB A;  1GQC A;  2D0J A;  1H4E A;  4FIY A;  3CU0 A;  3D98 A;  4EEO A;  2WAW A;  1ZJ2 A;  1ZDG A;  4BQH A;  2VK9 A;  4Y6U A;  2VXL A;  4JIS A;  5JQQ A;  3V90 A;  3CGX A;  3OH4 A;  4C2S A;  4HO8 A;  1G3L A;  3K8E A;  2ZU8 A;  1MP4 A;  1ZCY A;  2V0J A;  5CQP A;  2Y4M A;  1XHB A;  5C3B A;  3TQD A;  3USR A;  5C38 A;  2A8W A;  2YQH A;  3V0L A;  1WSZ A;  3I0I X;  4D11 A;  4HO3 A;  4KPX A;  1W55 A;  1FXJ A;  1VZT A;  1ZDF A;  1WT1 A;  4Y62 A;  4KXO A;  1ZCV A;  3U2T A;  4Y6N A;  3CKQ A;  1FOA A;  1H5S B;  1H5T A;  1R7Y A;  2O1G A;  4O6N A;  4ASJ A;  5FV9 A;  2I7B A;  1G93 A;  4EVW A;  2XWN A;  2PGV A;  1NHE B;  4MIX A;  2VXM A;  1ZCT A;  1E5K A;  1QWJ A;  2JCK A;  4FRB A;  2WGZ A;  3T7O A;  2GGO A;  2WVL A;  1R7U A;  2JCJ A;  3Q4S A;  5C4F A;  2ZU9 A;  4DEC A;  1OQM B;  5CQM X;  1WVC A;  2FYC B;  2Y7A A;  2QKX A;  5CMH A;  2BO7 A;  1ON8 A;  5C47 A;  5FYE A;  1S4O A;  3V8Z A;  4EEG A;  5EJ1 A;  1MC3 A;  2PA4 A;  3FOQ A;  1QG8 A;  2OI5 A;  1LZ7 A;  1FR9 A;  5C8R A;  2VS3 A;  4FCU A;  4DE7 A;  4YS8 A;  4Y7G A;  1TW1 A;  5C4C A;  4UEG A;  2Q4J A;  2P72 A;  4FRE A;  5L6V A;  2D7R A;  1H3M A;  3OH0 A;  4D11 C;  3DK5 A;  1V82 A;  3USQ A;  4G3Q A;  1NF5 B;  4NAI A;  4NAL A;  4O6M A;  3JUK A;  5FU0 A;  3RMV A;  4EE5 A;  2A8U A;  1R7X A;  4G3S A;  5CMJ A;  4ECM A;  2FFU A;  5DDT A;  4FQW A;  3V8Y A;  4P00 A;  4ASY A;  1FZW A;  2VSI A;  2AM5 A;  1JVD A;  2XWM A;  3R3I A;  2DPW A;  2XMH A;  2X65 A;  4M4K A;  2UX8 A;  4ARW A;  4FRQ A;  1G2V A;  2AGD A;  3ST8 A;  2YQC A;  1O7O A;  1K4V A;  1GWW A;  3I0D A;  1H4D A;  1VIC A;  3Q7U A;  3GUE A;  3I0C A;  3F1C A;  1LZI A;  2RJ4 A;  2AM3 A;  3U2X A;  4B42 A;  3U2U A;  1ZI1 A;  4JD0 A;  4AAW A;  2VFZ A;  4B2W A;  5CMF X;  4J18 A;  1ZJ0 A;  2Z87 A;  4IRP A;  4EE3 A;  4HO9 A;  1H5R A;  1FRW A;  2V0I A;  3I0K A;  3NGW A;  3CKO A;  3SX8 A;  3I0L A;  1G8O A;  2RIT A;  1FGX A;  1VPA A;  5HS2 A;  1NKH B;  2X5Z A;  3DJ4 A;  2W0V A;  5DDV A;  1ZI3 A;  4FRM A;  4KQL A;  3IOJ A;  3BRK X;  2ICX A;  3O3P A;  4HO2 A;  4FRA A;  2OEG A;  4AYL A;  3SXB A;  3OH1 A;  3V0Q A;  2MZB A;  1ZI5 A;  4KT7 A;  1HM8 A;  3ZLL A;  4M28 A;  1LL0 A;  4MND A;  1VZX A;  1H4C A;  1JVG A;  1ZHJ A;  1GX4 A;  5C48 A;  2V0K A;  4B5B A;  5FTS A;  1LZJ A;  1PZT A;  3T7M A;  2WE9 A;  1R7T A;  1G95 A;  3LW6 A;  1R80 A;  3U2V A;  4FRO A;  4FRD A;  1G97 A;  1R7V A;  4FIX A;  2Y4J A;  4KC2 A;  2APC A;  3I0E A;  2RJ0 A;  2AE7 A;  3OH2 A;  5C3D A;  3QVB A;  2RJ8 A;  3N9W A;  1JYK A;  4R7P A;  4P02 A;  2RJ9 A;  3IOH A;  1EZI A;  1HJL A;  2VS5 A;  2QGI A;  2OEF A;  1LVW A;  1NWG B;  1O7Q A;  1ZCU A;  1ZI4 A;  1YP4 A;  2VSH A;  3K8D A;  5FUH A;  4EE4 A;  1TVY A;  5C1G A;  2AES A;  2WVK A;  2QH5 A;  5C4B A;  2RIZ A;  5L6S A;  1VZU A;  5C1L A;  5AJO A;  1H7H A;  4Y7U A;  4Y63 A;  2P73 A;  2BO6 A;  1H7F A;  3I0J A;  5EJZ A;  4HO4 A;  1G9R A;  2W0W A;  4HO6 A;  4LW3 A;  4EEA A;  5C36 A;  1OMZ A;  1R81 A;  2FFV A;  1MP5 A;  3SX3 A;  1O23 B;  1H5S D;  2YQS A;  1SS9 A;  1INI A;  4D0Z A;  5EIY A;  1QGS A;  3E26 A;  3JUJ A;  2FY7 A;  3U0X A;  4FRP A;  3I0H A;  5CMI A;  1ON6 A;  1QGQ A;  4KPZ A;  3V0O A;  2V0L A;  3SXA A;  4HG6 A;  1YRO B;  4HO5 A;  1HM0 A;  1TW5 A;  2JCL A;  2RJ1 A;  2O1F A;  3U2W A;  4AYJ A;  5IDT A;  2NXV A;  1FR8 A;  2Z86 A;  1H7L A;  2RIY A;  4E1K A;  3SXG A;  3ZGF A;  1LL3 A;  4FRH A;  2OI6 A;  3ZGG A;  3CKV A;  4B4G A;  1VM8 A;  4ZDQ A;  3I0G A;  3OC9 A;  3I0F A;  5D91 A;  3IOI A;  1G23 A;  4KC4 A;  1OMX A; 
#chains in the Genus database with same CATH homology
 1VH3 A;  1WT0 A;  1HM9 A;  1W57 A;  1R82 A;  1YP3 A;  3SXC A;  1H7T A;  3HL3 A;  1VGW A;  4Y64 A;  1TZF A;  1FO9 A;  3ZF8 A;  3PKQ A;  2RJ7 A;  4Y9X A;  3U0Y A;  3BCV A;  1LZ0 A;  5AJN A;  4B4M A;  1IIN A;  1H7G A;  3RMW A;  1YP2 A;  2O1H A;  5IFY A;  1JV1 A;  1FO8 A;  4FRL A;  3JTJ A;  2VD4 A;  4GBP A;  3FWW A;  4M2B A;  4MYB A;  3RSB A;  4Y7T A;  4HO0 A;  1H5T B;  1V83 A;  1EYR A;  2JCO A;  2YC5 A;  1PZY B;  2J0A A;  1W77 A;  4EEM A;  5C49 A;  4D0T A;  3ZLK A;  1JYL A;  2J0B A;  1ZJ1 A;  1HJJ A;  5FTV A;  5C4D A;  4G87 A;  1GA8 A;  3V0M A;  2AM4 A;  1S4P A;  5C4E A;  2E8B A;  4B2X A;  3R2W A;  3OGZ A;  4HOC A;  4NAK A;  2RJ6 A;  1H5S A;  4FCE A;  1VH1 A;  2X5S A;  2FYB A;  4M2A A;  4LW6 A;  1GQ9 A;  1VGZ A;  3PNN A;  2WVM A;  4Y7F A;  3PKP A;  2RIX A;  4CJ8 A;  2C0N A;  2YCM A;  4B4B A;  4K6R A;  3EE5 A;  1KWS A;  4NAN A;  5D92 A;  3KIA A;  2I5K A;  2RJ5 A;  3V0P A;  1G1L A;  2D7I A;  4Q7C A;  1FXO A;  1V84 A;  3OKR A;  2WEE A;  1INJ A;  2YQJ A;  3CKJ A;  4G3P A;  1O0R A;  3SX7 A;  2E3D A;  1FWY A;  1ZJ3 A;  3Q80 A;  2PGY A;  4CVH A;  2OI7 A;  2X60 A;  3TZT A;  3V91 A;  4CJC A;  2XWL A;  2ICY A;  2Y6P A;  1GX0 A;  5J49 A;  1ZJO A;  3V0N A;  5IDS A;  5I1F A;  3D5N A;  1MP3 A;  2FYA A;  3E25 A;  4AC3 A;  2XME A;  3T7N A;  1G0R A;  1WT2 A;  1ZJP A;  5FU8 A;  1XZ6 A;  5C1H A;  2ZU7 A;  3SX5 A;  3SXE A;  5BXC A;  1JV3 A;  1H7Q A;  2YC3 A;  1Z90 A;  2VS4 A;  5CMG X;  2CU2 A;  4HCQ A;  5AJP A;  1H5S C;  2P6W A;  2V0H A;  3D8V A;  2PX7 A;  2YES A;  1LL2 A;  3CKN A;  1H7E A;  1VGU A;  1H5R B;  2I5E A;  2Y4L A;  5CQN X;  4KNR A;  5CQL X;  1I52 A;  4L41 C;  1WT3 A;  1FG5 N;  4D48 A;  1ZIZ A;  4KC1 A;  4DDZ A;  4B3U A;  1S4N A;  1VGT A;  3F1Y A;  4XWI A;  1IIM A;  4IRQ A;  1NMM B;  1FGG A;  3SXD A;  3DUV A;  4BMA A;  2AEC A;  5CQO A;  1HV9 A;  5C3A A;  3OH3 A;  2AH9 A;  1GWV A;  2BO4 A;  2Y4K A;  3OAM A;  4KRV A;  3POL A;  4Y7V A;  1NQI B;  2BO8 A;  2FYD B;  4KNX A;  2GGQ A;  3SPT A;  4CJB A;  1GQC A;  2D0J A;  1H4E A;  4FIY A;  3CU0 A;  3D98 A;  4EEO A;  2WAW A;  1ZJ2 A;  1ZDG A;  4BQH A;  2VK9 A;  4Y6U A;  2VXL A;  4JIS A;  5JQQ A;  3V90 A;  3CGX A;  3OH4 A;  4C2S A;  4HO8 A;  1G3L A;  3K8E A;  2ZU8 A;  1MP4 A;  1ZCY A;  2V0J A;  5CQP A;  2Y4M A;  1XHB A;  5C3B A;  3TQD A;  3USR A;  5C38 A;  2A8W A;  2YQH A;  3V0L A;  1WSZ A;  3I0I X;  4D11 A;  4HO3 A;  4KPX A;  1W55 A;  1FXJ A;  1VZT A;  1ZDF A;  1WT1 A;  4Y62 A;  4KXO A;  1ZCV A;  3U2T A;  4Y6N A;  3CKQ A;  1FOA A;  1H5S B;  1H5T A;  1R7Y A;  2O1G A;  4O6N A;  4ASJ A;  5FV9 A;  2I7B A;  1G93 A;  4EVW A;  2XWN A;  2PGV A;  1NHE B;  4MIX A;  2VXM A;  1ZCT A;  1E5K A;  1QWJ A;  2JCK A;  4FRB A;  2WGZ A;  3T7O A;  2GGO A;  2WVL A;  1R7U A;  2JCJ A;  3Q4S A;  5C4F A;  2ZU9 A;  4DEC A;  1OQM B;  5CQM X;  1WVC A;  2FYC B;  2Y7A A;  2QKX A;  5CMH A;  2BO7 A;  1ON8 A;  5C47 A;  5FYE A;  1S4O A;  3V8Z A;  4EEG A;  5EJ1 A;  1MC3 A;  2PA4 A;  3FOQ A;  1QG8 A;  2OI5 A;  1LZ7 A;  1FR9 A;  5C8R A;  2VS3 A;  4FCU A;  4DE7 A;  4YS8 A;  4Y7G A;  1TW1 A;  5C4C A;  4UEG A;  2Q4J A;  2P72 A;  4FRE A;  5L6V A;  2D7R A;  1H3M A;  3OH0 A;  4D11 C;  3DK5 A;  1V82 A;  3USQ A;  4G3Q A;  1NF5 B;  4NAI A;  4NAL A;  4O6M A;  3JUK A;  5FU0 A;  3RMV A;  4EE5 A;  2A8U A;  1R7X A;  4G3S A;  5CMJ A;  4ECM A;  2FFU A;  5DDT A;  4FQW A;  3V8Y A;  4P00 A;  4ASY A;  1FZW A;  2VSI A;  2AM5 A;  1JVD A;  2XWM A;  3R3I A;  2DPW A;  2XMH A;  2X65 A;  4M4K A;  2UX8 A;  4ARW A;  4FRQ A;  1G2V A;  2AGD A;  3ST8 A;  2YQC A;  1O7O A;  1K4V A;  1GWW A;  3I0D A;  1H4D A;  1VIC A;  3Q7U A;  3GUE A;  3I0C A;  3F1C A;  1LZI A;  2RJ4 A;  2AM3 A;  3U2X A;  4B42 A;  3U2U A;  1ZI1 A;  4JD0 A;  4AAW A;  2VFZ A;  4B2W A;  5CMF X;  4J18 A;  1ZJ0 A;  2Z87 A;  4IRP A;  4EE3 A;  4HO9 A;  1H5R A;  1FRW A;  2V0I A;  3I0K A;  3NGW A;  3CKO A;  3SX8 A;  3I0L A;  1G8O A;  2RIT A;  1FGX A;  1VPA A;  5HS2 A;  1NKH B;  2X5Z A;  3DJ4 A;  2W0V A;  5DDV A;  1ZI3 A;  4FRM A;  4KQL A;  3IOJ A;  3BRK X;  2ICX A;  3O3P A;  4HO2 A;  4FRA A;  2OEG A;  4AYL A;  3SXB A;  3OH1 A;  3V0Q A;  2MZB A;  1ZI5 A;  4KT7 A;  1HM8 A;  3ZLL A;  4M28 A;  1LL0 A;  4MND A;  1VZX A;  1H4C A;  1JVG A;  1ZHJ A;  1GX4 A;  5C48 A;  2V0K A;  4B5B A;  5FTS A;  1LZJ A;  1PZT A;  3T7M A;  2WE9 A;  1R7T A;  1G95 A;  3LW6 A;  1R80 A;  3U2V A;  4FRO A;  4FRD A;  1G97 A;  1R7V A;  4FIX A;  2Y4J A;  4KC2 A;  2APC A;  3I0E A;  2RJ0 A;  2AE7 A;  3OH2 A;  5C3D A;  3QVB A;  2RJ8 A;  3N9W A;  1JYK A;  4R7P A;  4P02 A;  2RJ9 A;  3IOH A;  1EZI A;  1HJL A;  2VS5 A;  2QGI A;  2OEF A;  1LVW A;  1NWG B;  1O7Q A;  1ZCU A;  1ZI4 A;  1YP4 A;  2VSH A;  3K8D A;  5FUH A;  4EE4 A;  1TVY A;  5C1G A;  2AES A;  2WVK A;  2QH5 A;  5C4B A;  2RIZ A;  5L6S A;  1VZU A;  5C1L A;  5AJO A;  1H7H A;  4Y7U A;  4Y63 A;  2P73 A;  2BO6 A;  1H7F A;  3I0J A;  5EJZ A;  4HO4 A;  1G9R A;  2W0W A;  4HO6 A;  4LW3 A;  4EEA A;  5C36 A;  1OMZ A;  1R81 A;  2FFV A;  1MP5 A;  3SX3 A;  1O23 B;  1H5S D;  2YQS A;  1SS9 A;  1INI A;  4D0Z A;  5EIY A;  1QGS A;  3E26 A;  3JUJ A;  2FY7 A;  3U0X A;  4FRP A;  3I0H A;  5CMI A;  1ON6 A;  1QGQ A;  4KPZ A;  3V0O A;  2V0L A;  3SXA A;  4HG6 A;  1YRO B;  4HO5 A;  1HM0 A;  1TW5 A;  2JCL A;  2RJ1 A;  2O1F A;  3U2W A;  4AYJ A;  5IDT A;  2NXV A;  1FR8 A;  2Z86 A;  1H7L A;  2RIY A;  4E1K A;  3SXG A;  3ZGF A;  1LL3 A;  4FRH A;  2OI6 A;  3ZGG A;  3CKV A;  4B4G A;  1VM8 A;  4ZDQ A;  3I0G A;  3OC9 A;  3I0F A;  5D91 A;  3IOI A;  1G23 A;  4KC4 A;  1OMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...