4EEAA

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-gal-beta1,4-glc-beta
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4eeaA00
3U2XA 2VS3A 5FU8A 4Y64A 1IINA 4B5BA 4HO2A 5C1GA 2Y4LA 3PKQA 2VD4A 2Z87A 4B4GA 1H5RA 3SX7A 2JCLA 2PGVA 1JYKA 1XHBA 5C4DA 4Y6UA 2WEEA 3RMWA 3SPTA 1MP4A 2GGOA 1H7EA 3QVBA 2VXMA 4KC1A 2D7RA 2I5KA 3CU0A 3U2UA 3D98A 3ZGGA 2XWNA 1H7GA 1QGSA 1OMXA 2AE7A 4LW6A 1FWYA 4KNRA 5AJNA 1G0RA 1ZI3A 2O1GA 4M28A 1VM8A 1V83A 1NF5B 1FG5N 1JV3A 4M2BA 5EIYA 1H7QA 4MNDA 1ZI1A 4B4BA 3K8EA 5CQLX 3V0PA 1G95A 3PNNA 5CQMX 3Q4SA 2OI7A 1H3MA 5C49A 5C4BA 2VS4A 5C8RA 2W0VA 4ASYA 2RJ7A 1ZCTA 2X5ZA 1PZTA 1JYLA 2W0WA 1NMMB 1WT2A 4Y7UA 1LZJA 2GGQA 1HV9A 5IDSA 1GX0A 5FTVA 1S4PA 3SXCA 1VH1A 3SXAA 3CKQA 1XZ6A 4FREA 1V82A 3ZF8A 1R7UA 1ZHJA 2V0LA 1H7FA 3E25A 2FY7A 5CMHA 2NXVA 4EEGA 5BXCA 5C3DA 1ZJ3A 1G97A 1W77A 1S4NA 4AYJA 1PZYB 3E26A 3I0IX 2RJ6A 1GWWA 4D48A 4J18A 3RSBA 4MYBA 4IRQA 2AM5A 1TW1A 4ZDQA 1O7QA 1G1LA 3I0DA 5FV9A 4HO8A 1GQCA 2YC5A 3CKVA 3SXBA 2OEFA 5CMIA 2XMEA 2VXLA 2ICXA 2Y4KA 4B2WA 3SXEA 5C1LA 2RJ9A 3ZLKA 5EJ1A 2V0JA 3F1CA 4Y6NA 1FR9A 3F1YA 2XWMA 2FYBA 1FZWA 2FYDB 2RJ0A 3LW6A 4DE7A 1FXJA 1FO8A 2A8UA 4M4KA 1H7LA 5JQQA 2OI6A 2FFUA 2FFVA 2QGIA 4JISA 4DDZA 4KPZA 2BO7A 2X65A 3FOQA 4B3UA 1H4CA 2FYAA 2AM3A 3JTJA 4G3QA 3TQDA 4LW3A 2AM4A 1E5KA 1VZUA 4EE3A 2WVLA 1NQIB 3DUVA 1OMZA 5EJZA 1LVWA 1MP3A 3I0FA 2V0KA 4EE5A 1ZDGA 5CMFX 1FXOA 1G23A 4EEOA 3CGXA 2VSHA 4HG6A 4FROA 4L41C 1YP4A 5DDTA 1H5RB 1TVYA 2X60A 1ZJ1A 1HM8A 1VGTA 1WT0A 4FQWA 3USRA 4AC3A 2D7IA 3I0EA 1NHEB 2AGDA 1JV1A 2A8WA 2RJ8A 4YS8A 4HO0A 5I1FA 4FCUA 1YP3A 2RJ1A 2DPWA 2Y4JA 4Y7FA 1VZXA 2RIXA 4Y7VA 5AJOA 1R7TA 3OH1A 3T7NA 4HO4A 4B42A 5FYEA 3V0LA 5DDVA 5L6SA 1O0RA 3GUEA 2UX8A 1V84A 4D0TA 3OGZA 3I0JA 4FCEA 1Z90A 4HO9A 1LZ0A 1YROB 2QKXA 1VGUA 4EVWA 3FWWA 1H7HA 1H5SD 3V0MA 1EZIA 2YESA 3U0XA 4KPXA 4KQLA 2E8BA 1WSZA 4NALA 3EE5A 2D0JA 3OH4A 1QGQA 3V0OA 4FRQA 5C4EA 3SX5A 1FRWA 4C2SA 3I0LA 4KC4A 2OI5A 3DJ4A 1H5SA 3I0KA 1R7YA 1VICA 2E3DA 3SXDA 1ZI5A 1ZDFA 2ICYA 1W57A 1FR8A 4FRAA 3I0CA 4DECA 4Y7TA 1ZI4A 1HJJA 1ZCYA 3D5NA 3U2VA 2PX7A 1FO9A 2RITA 4ECMA 1O23B 1VZTA 4CJBA 4XWIA 4FRMA 1NKHB 2I5EA 4EEAA 3JUKA 1ZIZA 5CQPA 1ZJ2A 2O1HA 1GX4A 3IOJA 1FGXA 4HCQA 4IRPA 4KRVA 4BMAA 5C1HA 3ZLLA 2XMHA 3RMVA 1H5TA 1H5SC 2AH9A 5CQOA 2I7BA 1JVGA 4Y7GA 3N9WA 4G3SA 2RJ4A 2VSIA 3ST8A 1TW5A 1FGGA 1ZJ0A 3Q7UA 1EYRA 4HOCA 5IDTA 3R3IA 1R82A 4CJCA 3U2TA 2O1FA 1G8OA 2Y6PA 2PA4A 1SS9A 4FRHA 2P72A 1HM9A 4NANA 1GA8A 3Q80A 1S4OA 2RIYA 2JCJA 3OC9A 1HM0A 5C3BA 4FRLA 4KT7A 3I0HA 4UEGA 1WT3A 2VS5A 3DK5A 3IOIA 3R2WA 5AJPA 1MP5A 4Y62A 2P6WA 4Y9XA 5C4CA 4NAKA 3HL3A 4FRBA 2WVKA 3V0NA 1H4DA 4G3PA 2AESA 1I52A 4B4MA 2AECA 2YC3A 4R7PA 1W55A 3BRKX 1VPAA 3OAMA 4FRDA 3CKJA 4HO5A 3D8VA 2WGZA 2BO4A 4E1KA 1ZCUA 2Q4JA 4K6RA 2Y4MA 3V8ZA 1FOAA 2WE9A 1LZ7A 1INIA 3NGWA 1K4VA 2BO6A 4P02A 5C48A 3SXGA 1R7XA 3I0GA 5C4FA 1QG8A 1QWJA 2WAWA 4CJ8A 2YQHA 1KWSA 3U0YA 2YQJA 5FUHA 2ZU8A 4D11A 3SX8A 4AAWA 2XWLA 1ZJOA 2RJ5A 1LL3A 4EEMA 3OH2A 3V8YA 1LZIA 3V91A 4AYLA 2WVMA 1VGWA 5CQNX 5C3AA 1MC3A 5J49A 2JCKA 4Y63A 2CU2A 3SX3A 2V0IA 2OEGA 5CMGX 4KXOA 3USQA 4M2AA 1VGZA 2MZBA 3BCVA 3O3PA 3OH0A 4G87A 1G9RA 2VFZA 2PGYA 3ZGFA 1JVDA 3CKNA 2X5SA 3U2WA 3JUJA 3K8DA 2V0HA 1H5SB 2FYCB 2RIZA 3T7OA 1TZFA 1GWVA 2BO8A 5IFYA 1LL0A 1ZCVA 5CMJA 2APCA 2YQSA 3T7MA 4FRPA 2JCOA 3V90A 4KC2A 2QH5A 4HO3A 4JD0A 1ON6A 4CVHA 4D11C 2ZU7A 4HO6A 5C36A 1R80A 5FTSA 5L6VA 3TZTA 3PKPA 5C47A 1LL2A 2YQCA 4KNXA 3POLA 4P00A 1VH3A 1ZJPA 4EE4A 1IIMA 1G3LA 1WT1A 3OKRA 2Z86A 3V0QA 3KIAA 4GBPA 1G93A 1HJLA 2Y7AA 4B2XA 1H7TA 4ARWA 1R7VA 2ZU9A 4ASJA 3OH3A 4BQHA 1GQ9A 1R81A 1WVCA 2P73A 5FU0A 3IOHA 1H5TB 4D0ZA 1G2VA 1OQMB 4NAIA 1H4EA 3CKOA 1YP2A 5C38A 5HS2A 1NWGB 2YCMA 1INJA 1ON8A 1O7OA
chains in the Genus database with same CATH superfamily
3U2XA 2VS3A 5FU8A 4Y64A 1IINA 4B5BA 4HO2A 5C1GA 2Y4LA 3PKQA 2VD4A 2Z87A 4B4GA 1H5RA 2VK9A 3SX7A 4FIXA 2JCLA 2PGVA 1JYKA 1XHBA 5C4DA 4Y6UA 2WEEA 3RMWA 3SPTA 1MP4A 2GGOA 1H7EA 3QVBA 2VXMA 4KC1A 2D7RA 2I5KA 3CU0A 3U2UA 3D98A 2J0AA 3ZGGA 2XWNA 1H7GA 1QGSA 1OMXA 2AE7A 4LW6A 1FWYA 4KNRA 5AJNA 1G0RA 1ZI3A 2O1GA 4O6MA 4M28A 1VM8A 1V83A 1NF5B 1FG5N 1JV3A 4M2BA 5EIYA 1H7QA 4MNDA 1ZI1A 4B4BA 3K8EA 5CQLX 3V0PA 1G95A 3PNNA 5CQMX 3Q4SA 2OI7A 1H3MA 5C49A 5C4BA 2VS4A 5C8RA 2W0VA 4ASYA 2RJ7A 1ZCTA 2X5ZA 1PZTA 1JYLA 2W0WA 1NMMB 1WT2A 5D92A 4Y7UA 1LZJA 2GGQA 1HV9A 5IDSA 1GX0A 5FTVA 1S4PA 3SXCA 1VH1A 3SXAA 3CKQA 1XZ6A 4FREA 1V82A 3ZF8A 1R7UA 1ZHJA 2V0LA 1H7FA 3E25A 2FY7A 5CMHA 2NXVA 4EEGA 5BXCA 5C3DA 1ZJ3A 1G97A 1W77A 1S4NA 4AYJA 1PZYB 3E26A 3I0IX 2J0BA 2RJ6A 1GWWA 4D48A 4J18A 3RSBA 4MYBA 4IRQA 2AM5A 1TW1A 4ZDQA 1O7QA 1G1LA 3I0DA 5FV9A 4HO8A 1GQCA 2YC5A 3CKVA 3SXBA 2OEFA 5CMIA 2XMEA 2VXLA 2ICXA 2Y4KA 4B2WA 3SXEA 5C1LA 2RJ9A 3ZLKA 5EJ1A 2V0JA 3F1CA 4Y6NA 1FR9A 3F1YA 2XWMA 2FYBA 1FZWA 2FYDB 2RJ0A 3LW6A 4DE7A 1FXJA 4Q7CA 1FO8A 2A8UA 4M4KA 1H7LA 5JQQA 2OI6A 2FFUA 2FFVA 2QGIA 4JISA 4DDZA 4KPZA 2BO7A 2X65A 3FOQA 4B3UA 1H4CA 2FYAA 2AM3A 3JTJA 4G3QA 3TQDA 4LW3A 2AM4A 1E5KA 1VZUA 4EE3A 2WVLA 1NQIB 3DUVA 1OMZA 5EJZA 1LVWA 1MP3A 3I0FA 2V0KA 4EE5A 1ZDGA 5CMFX 1FXOA 1G23A 4EEOA 3CGXA 2VSHA 4HG6A 4FROA 4L41C 1YP4A 5DDTA 1H5RB 1TVYA 2X60A 1ZJ1A 1HM8A 1VGTA 1WT0A 4FQWA 3USRA 4AC3A 2D7IA 3I0EA 1NHEB 2AGDA 1JV1A 2A8WA 2RJ8A 4YS8A 4HO0A 5I1FA 4FCUA 1YP3A 2RJ1A 2DPWA 2Y4JA 4Y7FA 1VZXA 2RIXA 4Y7VA 5AJOA 1R7TA 3OH1A 3T7NA 4HO4A 4B42A 5FYEA 3V0LA 5DDVA 5L6SA 1O0RA 3GUEA 2UX8A 1V84A 4D0TA 3OGZA 4FIYA 3I0JA 4FCEA 1Z90A 4HO9A 1LZ0A 1YROB 2QKXA 1VGUA 4EVWA 3FWWA 1H7HA 1H5SD 3V0MA 1EZIA 2YESA 3U0XA 4KPXA 4KQLA 2E8BA 1WSZA 4NALA 3EE5A 2D0JA 3OH4A 1QGQA 3V0OA 4FRQA 4MIXA 5C4EA 3SX5A 1FRWA 4C2SA 3I0LA 4KC4A 2OI5A 3DJ4A 1H5SA 3I0KA 1R7YA 1VICA 2E3DA 3SXDA 1ZI5A 1ZDFA 2ICYA 1W57A 1FR8A 4FRAA 3I0CA 4DECA 4Y7TA 1ZI4A 1HJJA 1ZCYA 3D5NA 3U2VA 2PX7A 1FO9A 2RITA 4ECMA 1O23B 1VZTA 4CJBA 4XWIA 4FRMA 1NKHB 2I5EA 4EEAA 3JUKA 1ZIZA 5CQPA 1ZJ2A 2O1HA 1GX4A 3IOJA 1FGXA 4HCQA 4IRPA 4KRVA 4BMAA 5C1HA 3ZLLA 2XMHA 3RMVA 1H5TA 1H5SC 2AH9A 5CQOA 2I7BA 1JVGA 4Y7GA 3N9WA 4G3SA 2RJ4A 2VSIA 3ST8A 1TW5A 1FGGA 1ZJ0A 3Q7UA 1EYRA 4HOCA 5IDTA 3R3IA 1R82A 4CJCA 3U2TA 2O1FA 1G8OA 2Y6PA 2PA4A 1SS9A 4FRHA 2P72A 1HM9A 4NANA 1GA8A 3Q80A 1S4OA 2RIYA 2JCJA 3OC9A 1HM0A 5D91A 5C3BA 4FRLA 4KT7A 3I0HA 4UEGA 1WT3A 2C0NA 2VS5A 3DK5A 3IOIA 3R2WA 5AJPA 1MP5A 4Y62A 2P6WA 4Y9XA 5C4CA 4NAKA 3HL3A 4FRBA 2WVKA 3V0NA 1H4DA 4G3PA 2AESA 1I52A 4B4MA 2AECA 2YC3A 4R7PA 1W55A 3BRKX 1VPAA 3OAMA 4FRDA 3CKJA 4HO5A 3D8VA 2WGZA 2BO4A 4E1KA 1ZCUA 2Q4JA 4O6NA 4K6RA 2Y4MA 3V8ZA 1FOAA 2WE9A 1LZ7A 1INIA 3NGWA 1K4VA 2BO6A 4P02A 5C48A 3SXGA 1R7XA 3I0GA 5C4FA 1QG8A 1QWJA 2WAWA 4CJ8A 2YQHA 1KWSA 3U0YA 2YQJA 5FUHA 2ZU8A 4D11A 3SX8A 4AAWA 2XWLA 1ZJOA 2RJ5A 1LL3A 4EEMA 3OH2A 3V8YA 1LZIA 3V91A 4AYLA 2WVMA 1VGWA 5CQNX 5C3AA 1MC3A 5J49A 2JCKA 4Y63A 2CU2A 3SX3A 2V0IA 2OEGA 5CMGX 4KXOA 3USQA 4M2AA 1VGZA 2MZBA 3BCVA 3O3PA 3OH0A 4G87A 1G9RA 2VFZA 2PGYA 3ZGFA 1JVDA 3CKNA 2X5SA 3U2WA 3JUJA 3K8DA 2V0HA 1H5SB 2FYCB 2RIZA 3T7OA 1TZFA 1GWVA 2BO8A 5IFYA 1LL0A 1ZCVA 5CMJA 2APCA 2YQSA 3T7MA 4FRPA 2JCOA 3V90A 4KC2A 2QH5A 4HO3A 4JD0A 1ON6A 4CVHA 4D11C 2ZU7A 4HO6A 5C36A 1R80A 5FTSA 5L6VA 3TZTA 3PKPA 5C47A 1LL2A 2YQCA 4KNXA 3POLA 4P00A 1VH3A 1ZJPA 4EE4A 1IIMA 1G3LA 1WT1A 3OKRA 2Z86A 3V0QA 3KIAA 4GBPA 1G93A 1HJLA 2Y7AA 4B2XA 1H7TA 4ARWA 1R7VA 2ZU9A 4ASJA 3OH3A 4BQHA 1GQ9A 1R81A 1WVCA 2P73A 5FU0A 3IOHA 1H5TB 4D0ZA 1G2VA 1OQMB 4NAIA 1H4EA 3CKOA 1YP2A 5C38A 5HS2A 1NWGB 2YCMA 1INJA 1ON8A 1O7OA
chains in the Genus database with same CATH topology
3U2XA 2VS3A 5FU8A 4Y64A 1IINA 4B5BA 4HO2A 5C1GA 2Y4LA 3PKQA 2VD4A 2Z87A 4B4GA 1H5RA 2VK9A 3SX7A 4FIXA 2JCLA 2PGVA 1JYKA 1XHBA 5C4DA 4Y6UA 2WEEA 3RMWA 3SPTA 1MP4A 2GGOA 1H7EA 3QVBA 2VXMA 4KC1A 2D7RA 2I5KA 3CU0A 3U2UA 3D98A 2J0AA 3ZGGA 2XWNA 1H7GA 1QGSA 1OMXA 2AE7A 4LW6A 1FWYA 4KNRA 5AJNA 1G0RA 1ZI3A 2O1GA 4O6MA 4M28A 1VM8A 1V83A 1NF5B 1FG5N 1JV3A 4M2BA 5EIYA 1H7QA 4MNDA 1ZI1A 4B4BA 3K8EA 5CQLX 3V0PA 1G95A 3PNNA 5CQMX 3Q4SA 2OI7A 1H3MA 5C49A 5C4BA 2VS4A 5C8RA 2W0VA 4ASYA 2RJ7A 1ZCTA 2X5ZA 1PZTA 1JYLA 2W0WA 1NMMB 1WT2A 5D92A 4Y7UA 1LZJA 2GGQA 1HV9A 5IDSA 1GX0A 5FTVA 1S4PA 3SXCA 1VH1A 3SXAA 3CKQA 1XZ6A 4FREA 1V82A 3ZF8A 1R7UA 1ZHJA 2V0LA 1H7FA 3E25A 2FY7A 5CMHA 2NXVA 4EEGA 5BXCA 5C3DA 1ZJ3A 1G97A 1W77A 1S4NA 4AYJA 1PZYB 3E26A 3I0IX 2J0BA 2RJ6A 1GWWA 4D48A 4J18A 3RSBA 4MYBA 4IRQA 2AM5A 1TW1A 4ZDQA 1O7QA 1G1LA 3I0DA 5FV9A 4HO8A 1GQCA 2YC5A 3CKVA 3SXBA 2OEFA 5CMIA 2XMEA 2VXLA 2ICXA 2Y4KA 4B2WA 3SXEA 5C1LA 2RJ9A 3ZLKA 5EJ1A 2V0JA 3F1CA 4Y6NA 1FR9A 3F1YA 2XWMA 2FYBA 1FZWA 2FYDB 2RJ0A 3LW6A 4DE7A 1FXJA 4Q7CA 1FO8A 2A8UA 4M4KA 1H7LA 5JQQA 2OI6A 2FFUA 2FFVA 2QGIA 4JISA 4DDZA 4KPZA 2BO7A 2X65A 3FOQA 4B3UA 1H4CA 2FYAA 2AM3A 3JTJA 4G3QA 3TQDA 4LW3A 2AM4A 1E5KA 1VZUA 4EE3A 2WVLA 1NQIB 3DUVA 1OMZA 5EJZA 1LVWA 1MP3A 3I0FA 2V0KA 4EE5A 1ZDGA 5CMFX 1FXOA 1G23A 4EEOA 3CGXA 2VSHA 4HG6A 4FROA 4L41C 1YP4A 5DDTA 1H5RB 1TVYA 2X60A 1ZJ1A 1HM8A 1VGTA 1WT0A 4FQWA 3USRA 4AC3A 2D7IA 3I0EA 1NHEB 2AGDA 1JV1A 2A8WA 2RJ8A 4YS8A 4HO0A 5I1FA 4FCUA 1YP3A 2RJ1A 2DPWA 2Y4JA 4Y7FA 1VZXA 2RIXA 4Y7VA 5AJOA 1R7TA 3OH1A 3T7NA 4HO4A 4B42A 5FYEA 3V0LA 5DDVA 5L6SA 1O0RA 3GUEA 2UX8A 1V84A 4D0TA 3OGZA 4FIYA 3I0JA 4FCEA 1Z90A 4HO9A 1LZ0A 1YROB 2QKXA 1VGUA 4EVWA 3FWWA 1H7HA 1H5SD 3V0MA 1EZIA 2YESA 3U0XA 4KPXA 4KQLA 2E8BA 1WSZA 4NALA 3EE5A 2D0JA 3OH4A 1QGQA 3V0OA 4FRQA 4MIXA 5C4EA 3SX5A 1FRWA 4C2SA 3I0LA 4KC4A 2OI5A 3DJ4A 1H5SA 3I0KA 1R7YA 1VICA 2E3DA 3SXDA 1ZI5A 1ZDFA 2ICYA 1W57A 1FR8A 4FRAA 3I0CA 4DECA 4Y7TA 1ZI4A 1HJJA 1ZCYA 3D5NA 3U2VA 2PX7A 1FO9A 2RITA 4ECMA 1O23B 1VZTA 4CJBA 4XWIA 4FRMA 1NKHB 2I5EA 4EEAA 3JUKA 1ZIZA 5CQPA 1ZJ2A 2O1HA 1GX4A 3IOJA 1FGXA 4HCQA 4IRPA 4KRVA 4BMAA 5C1HA 3ZLLA 2XMHA 3RMVA 1H5TA 1H5SC 2AH9A 5CQOA 2I7BA 1JVGA 4Y7GA 3N9WA 4G3SA 2RJ4A 2VSIA 3ST8A 1TW5A 1FGGA 1ZJ0A 3Q7UA 1EYRA 4HOCA 5IDTA 3R3IA 1R82A 4CJCA 3U2TA 2O1FA 1G8OA 2Y6PA 2PA4A 1SS9A 4FRHA 2P72A 1HM9A 4NANA 1GA8A 3Q80A 1S4OA 2RIYA 2JCJA 3OC9A 1HM0A 5D91A 5C3BA 4FRLA 4KT7A 3I0HA 4UEGA 1WT3A 2C0NA 2VS5A 3DK5A 3IOIA 3R2WA 5AJPA 1MP5A 4Y62A 2P6WA 4Y9XA 5C4CA 4NAKA 3HL3A 4FRBA 2WVKA 3V0NA 1H4DA 4G3PA 2AESA 1I52A 4B4MA 2AECA 2YC3A 4R7PA 1W55A 3BRKX 1VPAA 3OAMA 4FRDA 3CKJA 4HO5A 3D8VA 2WGZA 2BO4A 4E1KA 1ZCUA 2Q4JA 4O6NA 4K6RA 2Y4MA 3V8ZA 1FOAA 2WE9A 1LZ7A 1INIA 3NGWA 1K4VA 2BO6A 4P02A 5C48A 3SXGA 1R7XA 3I0GA 5C4FA 1QG8A 1QWJA 2WAWA 4CJ8A 2YQHA 1KWSA 3U0YA 2YQJA 5FUHA 2ZU8A 4D11A 3SX8A 4AAWA 2XWLA 1ZJOA 2RJ5A 1LL3A 4EEMA 3OH2A 3V8YA 1LZIA 3V91A 4AYLA 2WVMA 1VGWA 5CQNX 5C3AA 1MC3A 5J49A 2JCKA 4Y63A 2CU2A 3SX3A 2V0IA 2OEGA 5CMGX 4KXOA 3USQA 4M2AA 1VGZA 2MZBA 3BCVA 3O3PA 3OH0A 4G87A 1G9RA 2VFZA 2PGYA 3ZGFA 1JVDA 3CKNA 2X5SA 3U2WA 3JUJA 3K8DA 2V0HA 1H5SB 2FYCB 2RIZA 3T7OA 1TZFA 1GWVA 2BO8A 5IFYA 1LL0A 1ZCVA 5CMJA 2APCA 2YQSA 3T7MA 4FRPA 2JCOA 3V90A 4KC2A 2QH5A 4HO3A 4JD0A 1ON6A 4CVHA 4D11C 2ZU7A 4HO6A 5C36A 1R80A 5FTSA 5L6VA 3TZTA 3PKPA 5C47A 1LL2A 2YQCA 4KNXA 3POLA 4P00A 1VH3A 1ZJPA 4EE4A 1IIMA 1G3LA 1WT1A 3OKRA 2Z86A 3V0QA 3KIAA 4GBPA 1G93A 1HJLA 2Y7AA 4B2XA 1H7TA 4ARWA 1R7VA 2ZU9A 4ASJA 3OH3A 4BQHA 1GQ9A 1R81A 1WVCA 2P73A 5FU0A 3IOHA 1H5TB 4D0ZA 1G2VA 1OQMB 4NAIA 1H4EA 3CKOA 1YP2A 5C38A 5HS2A 1NWGB 2YCMA 1INJA 1ON8A 1O7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2X A;  2VS3 A;  5FU8 A;  4Y64 A;  1IIN A;  4B5B A;  4HO2 A;  5C1G A;  2Y4L A;  3PKQ A;  2VD4 A;  2Z87 A;  4B4G A;  1H5R A;  3SX7 A;  2JCL A;  2PGV A;  1JYK A;  1XHB A;  5C4D A;  4Y6U A;  2WEE A;  3RMW A;  3SPT A;  1MP4 A;  2GGO A;  1H7E A;  3QVB A;  2VXM A;  4KC1 A;  2D7R A;  2I5K A;  3CU0 A;  3U2U A;  3D98 A;  3ZGG A;  2XWN A;  1H7G A;  1QGS A;  1OMX A;  2AE7 A;  4LW6 A;  1FWY A;  4KNR A;  5AJN A;  1G0R A;  1ZI3 A;  2O1G A;  4M28 A;  1VM8 A;  1V83 A;  1NF5 B;  1FG5 N;  1JV3 A;  4M2B A;  5EIY A;  1H7Q A;  4MND A;  1ZI1 A;  4B4B A;  3K8E A;  5CQL X;  3V0P A;  1G95 A;  3PNN A;  5CQM X;  3Q4S A;  2OI7 A;  1H3M A;  5C49 A;  5C4B A;  2VS4 A;  5C8R A;  2W0V A;  4ASY A;  2RJ7 A;  1ZCT A;  2X5Z A;  1PZT A;  1JYL A;  2W0W A;  1NMM B;  1WT2 A;  4Y7U A;  1LZJ A;  2GGQ A;  1HV9 A;  5IDS A;  1GX0 A;  5FTV A;  1S4P A;  3SXC A;  1VH1 A;  3SXA A;  3CKQ A;  1XZ6 A;  4FRE A;  1V82 A;  3ZF8 A;  1R7U A;  1ZHJ A;  2V0L A;  1H7F A;  3E25 A;  2FY7 A;  5CMH A;  2NXV A;  4EEG A;  5BXC A;  5C3D A;  1ZJ3 A;  1G97 A;  1W77 A;  1S4N A;  4AYJ A;  1PZY B;  3E26 A;  3I0I X;  2RJ6 A;  1GWW A;  4D48 A;  4J18 A;  3RSB A;  4MYB A;  4IRQ A;  2AM5 A;  1TW1 A;  4ZDQ A;  1O7Q A;  1G1L A;  3I0D A;  5FV9 A;  4HO8 A;  1GQC A;  2YC5 A;  3CKV A;  3SXB A;  2OEF A;  5CMI A;  2XME A;  2VXL A;  2ICX A;  2Y4K A;  4B2W A;  3SXE A;  5C1L A;  2RJ9 A;  3ZLK A;  5EJ1 A;  2V0J A;  3F1C A;  4Y6N A;  1FR9 A;  3F1Y A;  2XWM A;  2FYB A;  1FZW A;  2FYD B;  2RJ0 A;  3LW6 A;  4DE7 A;  1FXJ A;  1FO8 A;  2A8U A;  4M4K A;  1H7L A;  5JQQ A;  2OI6 A;  2FFU A;  2FFV A;  2QGI A;  4JIS A;  4DDZ A;  4KPZ A;  2BO7 A;  2X65 A;  3FOQ A;  4B3U A;  1H4C A;  2FYA A;  2AM3 A;  3JTJ A;  4G3Q A;  3TQD A;  4LW3 A;  2AM4 A;  1E5K A;  1VZU A;  4EE3 A;  2WVL A;  1NQI B;  3DUV A;  1OMZ A;  5EJZ A;  1LVW A;  1MP3 A;  3I0F A;  2V0K A;  4EE5 A;  1ZDG A;  5CMF X;  1FXO A;  1G23 A;  4EEO A;  3CGX A;  2VSH A;  4HG6 A;  4FRO A;  4L41 C;  1YP4 A;  5DDT A;  1H5R B;  1TVY A;  2X60 A;  1ZJ1 A;  1HM8 A;  1VGT A;  1WT0 A;  4FQW A;  3USR A;  4AC3 A;  2D7I A;  3I0E A;  1NHE B;  2AGD A;  1JV1 A;  2A8W A;  2RJ8 A;  4YS8 A;  4HO0 A;  5I1F A;  4FCU A;  1YP3 A;  2RJ1 A;  2DPW A;  2Y4J A;  4Y7F A;  1VZX A;  2RIX A;  4Y7V A;  5AJO A;  1R7T A;  3OH1 A;  3T7N A;  4HO4 A;  4B42 A;  5FYE A;  3V0L A;  5DDV A;  5L6S A;  1O0R A;  3GUE A;  2UX8 A;  1V84 A;  4D0T A;  3OGZ A;  3I0J A;  4FCE A;  1Z90 A;  4HO9 A;  1LZ0 A;  1YRO B;  2QKX A;  1VGU A;  4EVW A;  3FWW A;  1H7H A;  1H5S D;  3V0M A;  1EZI A;  2YES A;  3U0X A;  4KPX A;  4KQL A;  2E8B A;  1WSZ A;  4NAL A;  3EE5 A;  2D0J A;  3OH4 A;  1QGQ A;  3V0O A;  4FRQ A;  5C4E A;  3SX5 A;  1FRW A;  4C2S A;  3I0L A;  4KC4 A;  2OI5 A;  3DJ4 A;  1H5S A;  3I0K A;  1R7Y A;  1VIC A;  2E3D A;  3SXD A;  1ZI5 A;  1ZDF A;  2ICY A;  1W57 A;  1FR8 A;  4FRA A;  3I0C A;  4DEC A;  4Y7T A;  1ZI4 A;  1HJJ A;  1ZCY A;  3D5N A;  3U2V A;  2PX7 A;  1FO9 A;  2RIT A;  4ECM A;  1O23 B;  1VZT A;  4CJB A;  4XWI A;  4FRM A;  1NKH B;  2I5E A;  4EEA A;  3JUK A;  1ZIZ A;  5CQP A;  1ZJ2 A;  2O1H A;  1GX4 A;  3IOJ A;  1FGX A;  4HCQ A;  4IRP A;  4KRV A;  4BMA A;  5C1H A;  3ZLL A;  2XMH A;  3RMV A;  1H5T A;  1H5S C;  2AH9 A;  5CQO A;  2I7B A;  1JVG A;  4Y7G A;  3N9W A;  4G3S A;  2RJ4 A;  2VSI A;  3ST8 A;  1TW5 A;  1FGG A;  1ZJ0 A;  3Q7U A;  1EYR A;  4HOC A;  5IDT A;  3R3I A;  1R82 A;  4CJC A;  3U2T A;  2O1F A;  1G8O A;  2Y6P A;  2PA4 A;  1SS9 A;  4FRH A;  2P72 A;  1HM9 A;  4NAN A;  1GA8 A;  3Q80 A;  1S4O A;  2RIY A;  2JCJ A;  3OC9 A;  1HM0 A;  5C3B A;  4FRL A;  4KT7 A;  3I0H A;  4UEG A;  1WT3 A;  2VS5 A;  3DK5 A;  3IOI A;  3R2W A;  5AJP A;  1MP5 A;  4Y62 A;  2P6W A;  4Y9X A;  5C4C A;  4NAK A;  3HL3 A;  4FRB A;  2WVK A;  3V0N A;  1H4D A;  4G3P A;  2AES A;  1I52 A;  4B4M A;  2AEC A;  2YC3 A;  4R7P A;  1W55 A;  3BRK X;  1VPA A;  3OAM A;  4FRD A;  3CKJ A;  4HO5 A;  3D8V A;  2WGZ A;  2BO4 A;  4E1K A;  1ZCU A;  2Q4J A;  4K6R A;  2Y4M A;  3V8Z A;  1FOA A;  2WE9 A;  1LZ7 A;  1INI A;  3NGW A;  1K4V A;  2BO6 A;  4P02 A;  5C48 A;  3SXG A;  1R7X A;  3I0G A;  5C4F A;  1QG8 A;  1QWJ A;  2WAW A;  4CJ8 A;  2YQH A;  1KWS A;  3U0Y A;  2YQJ A;  5FUH A;  2ZU8 A;  4D11 A;  3SX8 A;  4AAW A;  2XWL A;  1ZJO A;  2RJ5 A;  1LL3 A;  4EEM A;  3OH2 A;  3V8Y A;  1LZI A;  3V91 A;  4AYL A;  2WVM A;  1VGW A;  5CQN X;  5C3A A;  1MC3 A;  5J49 A;  2JCK A;  4Y63 A;  2CU2 A;  3SX3 A;  2V0I A;  2OEG A;  5CMG X;  4KXO A;  3USQ A;  4M2A A;  1VGZ A;  2MZB A;  3BCV A;  3O3P A;  3OH0 A;  4G87 A;  1G9R A;  2VFZ A;  2PGY A;  3ZGF A;  1JVD A;  3CKN A;  2X5S A;  3U2W A;  3JUJ A;  3K8D A;  2V0H A;  1H5S B;  2FYC B;  2RIZ A;  3T7O A;  1TZF A;  1GWV A;  2BO8 A;  5IFY A;  1LL0 A;  1ZCV A;  5CMJ A;  2APC A;  2YQS A;  3T7M A;  4FRP A;  2JCO A;  3V90 A;  4KC2 A;  2QH5 A;  4HO3 A;  4JD0 A;  1ON6 A;  4CVH A;  4D11 C;  2ZU7 A;  4HO6 A;  5C36 A;  1R80 A;  5FTS A;  5L6V A;  3TZT A;  3PKP A;  5C47 A;  1LL2 A;  2YQC A;  4KNX A;  3POL A;  4P00 A;  1VH3 A;  1ZJP A;  4EE4 A;  1IIM A;  1G3L A;  1WT1 A;  3OKR A;  2Z86 A;  3V0Q A;  3KIA A;  4GBP A;  1G93 A;  1HJL A;  2Y7A A;  4B2X A;  1H7T A;  4ARW A;  1R7V A;  2ZU9 A;  4ASJ A;  3OH3 A;  4BQH A;  1GQ9 A;  1R81 A;  1WVC A;  2P73 A;  5FU0 A;  3IOH A;  1H5T B;  4D0Z A;  1G2V A;  1OQM B;  4NAI A;  1H4E A;  3CKO A;  1YP2 A;  5C38 A;  5HS2 A;  1NWG B;  2YCM A;  1INJ A;  1ON8 A;  1O7O A; 
#chains in the Genus database with same CATH topology
 3U2X A;  2VS3 A;  5FU8 A;  4Y64 A;  1IIN A;  4B5B A;  4HO2 A;  5C1G A;  2Y4L A;  3PKQ A;  2VD4 A;  2Z87 A;  4B4G A;  1H5R A;  2VK9 A;  3SX7 A;  4FIX A;  2JCL A;  2PGV A;  1JYK A;  1XHB A;  5C4D A;  4Y6U A;  2WEE A;  3RMW A;  3SPT A;  1MP4 A;  2GGO A;  1H7E A;  3QVB A;  2VXM A;  4KC1 A;  2D7R A;  2I5K A;  3CU0 A;  3U2U A;  3D98 A;  2J0A A;  3ZGG A;  2XWN A;  1H7G A;  1QGS A;  1OMX A;  2AE7 A;  4LW6 A;  1FWY A;  4KNR A;  5AJN A;  1G0R A;  1ZI3 A;  2O1G A;  4O6M A;  4M28 A;  1VM8 A;  1V83 A;  1NF5 B;  1FG5 N;  1JV3 A;  4M2B A;  5EIY A;  1H7Q A;  4MND A;  1ZI1 A;  4B4B A;  3K8E A;  5CQL X;  3V0P A;  1G95 A;  3PNN A;  5CQM X;  3Q4S A;  2OI7 A;  1H3M A;  5C49 A;  5C4B A;  2VS4 A;  5C8R A;  2W0V A;  4ASY A;  2RJ7 A;  1ZCT A;  2X5Z A;  1PZT A;  1JYL A;  2W0W A;  1NMM B;  1WT2 A;  5D92 A;  4Y7U A;  1LZJ A;  2GGQ A;  1HV9 A;  5IDS A;  1GX0 A;  5FTV A;  1S4P A;  3SXC A;  1VH1 A;  3SXA A;  3CKQ A;  1XZ6 A;  4FRE A;  1V82 A;  3ZF8 A;  1R7U A;  1ZHJ A;  2V0L A;  1H7F A;  3E25 A;  2FY7 A;  5CMH A;  2NXV A;  4EEG A;  5BXC A;  5C3D A;  1ZJ3 A;  1G97 A;  1W77 A;  1S4N A;  4AYJ A;  1PZY B;  3E26 A;  3I0I X;  2J0B A;  2RJ6 A;  1GWW A;  4D48 A;  4J18 A;  3RSB A;  4MYB A;  4IRQ A;  2AM5 A;  1TW1 A;  4ZDQ A;  1O7Q A;  1G1L A;  3I0D A;  5FV9 A;  4HO8 A;  1GQC A;  2YC5 A;  3CKV A;  3SXB A;  2OEF A;  5CMI A;  2XME A;  2VXL A;  2ICX A;  2Y4K A;  4B2W A;  3SXE A;  5C1L A;  2RJ9 A;  3ZLK A;  5EJ1 A;  2V0J A;  3F1C A;  4Y6N A;  1FR9 A;  3F1Y A;  2XWM A;  2FYB A;  1FZW A;  2FYD B;  2RJ0 A;  3LW6 A;  4DE7 A;  1FXJ A;  4Q7C A;  1FO8 A;  2A8U A;  4M4K A;  1H7L A;  5JQQ A;  2OI6 A;  2FFU A;  2FFV A;  2QGI A;  4JIS A;  4DDZ A;  4KPZ A;  2BO7 A;  2X65 A;  3FOQ A;  4B3U A;  1H4C A;  2FYA A;  2AM3 A;  3JTJ A;  4G3Q A;  3TQD A;  4LW3 A;  2AM4 A;  1E5K A;  1VZU A;  4EE3 A;  2WVL A;  1NQI B;  3DUV A;  1OMZ A;  5EJZ A;  1LVW A;  1MP3 A;  3I0F A;  2V0K A;  4EE5 A;  1ZDG A;  5CMF X;  1FXO A;  1G23 A;  4EEO A;  3CGX A;  2VSH A;  4HG6 A;  4FRO A;  4L41 C;  1YP4 A;  5DDT A;  1H5R B;  1TVY A;  2X60 A;  1ZJ1 A;  1HM8 A;  1VGT A;  1WT0 A;  4FQW A;  3USR A;  4AC3 A;  2D7I A;  3I0E A;  1NHE B;  2AGD A;  1JV1 A;  2A8W A;  2RJ8 A;  4YS8 A;  4HO0 A;  5I1F A;  4FCU A;  1YP3 A;  2RJ1 A;  2DPW A;  2Y4J A;  4Y7F A;  1VZX A;  2RIX A;  4Y7V A;  5AJO A;  1R7T A;  3OH1 A;  3T7N A;  4HO4 A;  4B42 A;  5FYE A;  3V0L A;  5DDV A;  5L6S A;  1O0R A;  3GUE A;  2UX8 A;  1V84 A;  4D0T A;  3OGZ A;  4FIY A;  3I0J A;  4FCE A;  1Z90 A;  4HO9 A;  1LZ0 A;  1YRO B;  2QKX A;  1VGU A;  4EVW A;  3FWW A;  1H7H A;  1H5S D;  3V0M A;  1EZI A;  2YES A;  3U0X A;  4KPX A;  4KQL A;  2E8B A;  1WSZ A;  4NAL A;  3EE5 A;  2D0J A;  3OH4 A;  1QGQ A;  3V0O A;  4FRQ A;  4MIX A;  5C4E A;  3SX5 A;  1FRW A;  4C2S A;  3I0L A;  4KC4 A;  2OI5 A;  3DJ4 A;  1H5S A;  3I0K A;  1R7Y A;  1VIC A;  2E3D A;  3SXD A;  1ZI5 A;  1ZDF A;  2ICY A;  1W57 A;  1FR8 A;  4FRA A;  3I0C A;  4DEC A;  4Y7T A;  1ZI4 A;  1HJJ A;  1ZCY A;  3D5N A;  3U2V A;  2PX7 A;  1FO9 A;  2RIT A;  4ECM A;  1O23 B;  1VZT A;  4CJB A;  4XWI A;  4FRM A;  1NKH B;  2I5E A;  4EEA A;  3JUK A;  1ZIZ A;  5CQP A;  1ZJ2 A;  2O1H A;  1GX4 A;  3IOJ A;  1FGX A;  4HCQ A;  4IRP A;  4KRV A;  4BMA A;  5C1H A;  3ZLL A;  2XMH A;  3RMV A;  1H5T A;  1H5S C;  2AH9 A;  5CQO A;  2I7B A;  1JVG A;  4Y7G A;  3N9W A;  4G3S A;  2RJ4 A;  2VSI A;  3ST8 A;  1TW5 A;  1FGG A;  1ZJ0 A;  3Q7U A;  1EYR A;  4HOC A;  5IDT A;  3R3I A;  1R82 A;  4CJC A;  3U2T A;  2O1F A;  1G8O A;  2Y6P A;  2PA4 A;  1SS9 A;  4FRH A;  2P72 A;  1HM9 A;  4NAN A;  1GA8 A;  3Q80 A;  1S4O A;  2RIY A;  2JCJ A;  3OC9 A;  1HM0 A;  5D91 A;  5C3B A;  4FRL A;  4KT7 A;  3I0H A;  4UEG A;  1WT3 A;  2C0N A;  2VS5 A;  3DK5 A;  3IOI A;  3R2W A;  5AJP A;  1MP5 A;  4Y62 A;  2P6W A;  4Y9X A;  5C4C A;  4NAK A;  3HL3 A;  4FRB A;  2WVK A;  3V0N A;  1H4D A;  4G3P A;  2AES A;  1I52 A;  4B4M A;  2AEC A;  2YC3 A;  4R7P A;  1W55 A;  3BRK X;  1VPA A;  3OAM A;  4FRD A;  3CKJ A;  4HO5 A;  3D8V A;  2WGZ A;  2BO4 A;  4E1K A;  1ZCU A;  2Q4J A;  4O6N A;  4K6R A;  2Y4M A;  3V8Z A;  1FOA A;  2WE9 A;  1LZ7 A;  1INI A;  3NGW A;  1K4V A;  2BO6 A;  4P02 A;  5C48 A;  3SXG A;  1R7X A;  3I0G A;  5C4F A;  1QG8 A;  1QWJ A;  2WAW A;  4CJ8 A;  2YQH A;  1KWS A;  3U0Y A;  2YQJ A;  5FUH A;  2ZU8 A;  4D11 A;  3SX8 A;  4AAW A;  2XWL A;  1ZJO A;  2RJ5 A;  1LL3 A;  4EEM A;  3OH2 A;  3V8Y A;  1LZI A;  3V91 A;  4AYL A;  2WVM A;  1VGW A;  5CQN X;  5C3A A;  1MC3 A;  5J49 A;  2JCK A;  4Y63 A;  2CU2 A;  3SX3 A;  2V0I A;  2OEG A;  5CMG X;  4KXO A;  3USQ A;  4M2A A;  1VGZ A;  2MZB A;  3BCV A;  3O3P A;  3OH0 A;  4G87 A;  1G9R A;  2VFZ A;  2PGY A;  3ZGF A;  1JVD A;  3CKN A;  2X5S A;  3U2W A;  3JUJ A;  3K8D A;  2V0H A;  1H5S B;  2FYC B;  2RIZ A;  3T7O A;  1TZF A;  1GWV A;  2BO8 A;  5IFY A;  1LL0 A;  1ZCV A;  5CMJ A;  2APC A;  2YQS A;  3T7M A;  4FRP A;  2JCO A;  3V90 A;  4KC2 A;  2QH5 A;  4HO3 A;  4JD0 A;  1ON6 A;  4CVH A;  4D11 C;  2ZU7 A;  4HO6 A;  5C36 A;  1R80 A;  5FTS A;  5L6V A;  3TZT A;  3PKP A;  5C47 A;  1LL2 A;  2YQC A;  4KNX A;  3POL A;  4P00 A;  1VH3 A;  1ZJP A;  4EE4 A;  1IIM A;  1G3L A;  1WT1 A;  3OKR A;  2Z86 A;  3V0Q A;  3KIA A;  4GBP A;  1G93 A;  1HJL A;  2Y7A A;  4B2X A;  1H7T A;  4ARW A;  1R7V A;  2ZU9 A;  4ASJ A;  3OH3 A;  4BQH A;  1GQ9 A;  1R81 A;  1WVC A;  2P73 A;  5FU0 A;  3IOH A;  1H5T B;  4D0Z A;  1G2V A;  1OQM B;  4NAI A;  1H4E A;  3CKO A;  1YP2 A;  5C38 A;  5HS2 A;  1NWG B;  2YCM A;  1INJ A;  1ON8 A;  1O7O A; 
#chains in the Genus database with same CATH homology
 3U2X A;  2VS3 A;  5FU8 A;  4Y64 A;  1IIN A;  4B5B A;  4HO2 A;  5C1G A;  2Y4L A;  3PKQ A;  2VD4 A;  2Z87 A;  4B4G A;  1H5R A;  2VK9 A;  3SX7 A;  4FIX A;  2JCL A;  2PGV A;  1JYK A;  1XHB A;  5C4D A;  4Y6U A;  2WEE A;  3RMW A;  3SPT A;  1MP4 A;  2GGO A;  1H7E A;  3QVB A;  2VXM A;  4KC1 A;  2D7R A;  2I5K A;  3CU0 A;  3U2U A;  3D98 A;  2J0A A;  3ZGG A;  2XWN A;  1H7G A;  1QGS A;  1OMX A;  2AE7 A;  4LW6 A;  1FWY A;  4KNR A;  5AJN A;  1G0R A;  1ZI3 A;  2O1G A;  4O6M A;  4M28 A;  1VM8 A;  1V83 A;  1NF5 B;  1FG5 N;  1JV3 A;  4M2B A;  5EIY A;  1H7Q A;  4MND A;  1ZI1 A;  4B4B A;  3K8E A;  5CQL X;  3V0P A;  1G95 A;  3PNN A;  5CQM X;  3Q4S A;  2OI7 A;  1H3M A;  5C49 A;  5C4B A;  2VS4 A;  5C8R A;  2W0V A;  4ASY A;  2RJ7 A;  1ZCT A;  2X5Z A;  1PZT A;  1JYL A;  2W0W A;  1NMM B;  1WT2 A;  5D92 A;  4Y7U A;  1LZJ A;  2GGQ A;  1HV9 A;  5IDS A;  1GX0 A;  5FTV A;  1S4P A;  3SXC A;  1VH1 A;  3SXA A;  3CKQ A;  1XZ6 A;  4FRE A;  1V82 A;  3ZF8 A;  1R7U A;  1ZHJ A;  2V0L A;  1H7F A;  3E25 A;  2FY7 A;  5CMH A;  2NXV A;  4EEG A;  5BXC A;  5C3D A;  1ZJ3 A;  1G97 A;  1W77 A;  1S4N A;  4AYJ A;  1PZY B;  3E26 A;  3I0I X;  2J0B A;  2RJ6 A;  1GWW A;  4D48 A;  4J18 A;  3RSB A;  4MYB A;  4IRQ A;  2AM5 A;  1TW1 A;  4ZDQ A;  1O7Q A;  1G1L A;  3I0D A;  5FV9 A;  4HO8 A;  1GQC A;  2YC5 A;  3CKV A;  3SXB A;  2OEF A;  5CMI A;  2XME A;  2VXL A;  2ICX A;  2Y4K A;  4B2W A;  3SXE A;  5C1L A;  2RJ9 A;  3ZLK A;  5EJ1 A;  2V0J A;  3F1C A;  4Y6N A;  1FR9 A;  3F1Y A;  2XWM A;  2FYB A;  1FZW A;  2FYD B;  2RJ0 A;  3LW6 A;  4DE7 A;  1FXJ A;  4Q7C A;  1FO8 A;  2A8U A;  4M4K A;  1H7L A;  5JQQ A;  2OI6 A;  2FFU A;  2FFV A;  2QGI A;  4JIS A;  4DDZ A;  4KPZ A;  2BO7 A;  2X65 A;  3FOQ A;  4B3U A;  1H4C A;  2FYA A;  2AM3 A;  3JTJ A;  4G3Q A;  3TQD A;  4LW3 A;  2AM4 A;  1E5K A;  1VZU A;  4EE3 A;  2WVL A;  1NQI B;  3DUV A;  1OMZ A;  5EJZ A;  1LVW A;  1MP3 A;  3I0F A;  2V0K A;  4EE5 A;  1ZDG A;  5CMF X;  1FXO A;  1G23 A;  4EEO A;  3CGX A;  2VSH A;  4HG6 A;  4FRO A;  4L41 C;  1YP4 A;  5DDT A;  1H5R B;  1TVY A;  2X60 A;  1ZJ1 A;  1HM8 A;  1VGT A;  1WT0 A;  4FQW A;  3USR A;  4AC3 A;  2D7I A;  3I0E A;  1NHE B;  2AGD A;  1JV1 A;  2A8W A;  2RJ8 A;  4YS8 A;  4HO0 A;  5I1F A;  4FCU A;  1YP3 A;  2RJ1 A;  2DPW A;  2Y4J A;  4Y7F A;  1VZX A;  2RIX A;  4Y7V A;  5AJO A;  1R7T A;  3OH1 A;  3T7N A;  4HO4 A;  4B42 A;  5FYE A;  3V0L A;  5DDV A;  5L6S A;  1O0R A;  3GUE A;  2UX8 A;  1V84 A;  4D0T A;  3OGZ A;  4FIY A;  3I0J A;  4FCE A;  1Z90 A;  4HO9 A;  1LZ0 A;  1YRO B;  2QKX A;  1VGU A;  4EVW A;  3FWW A;  1H7H A;  1H5S D;  3V0M A;  1EZI A;  2YES A;  3U0X A;  4KPX A;  4KQL A;  2E8B A;  1WSZ A;  4NAL A;  3EE5 A;  2D0J A;  3OH4 A;  1QGQ A;  3V0O A;  4FRQ A;  4MIX A;  5C4E A;  3SX5 A;  1FRW A;  4C2S A;  3I0L A;  4KC4 A;  2OI5 A;  3DJ4 A;  1H5S A;  3I0K A;  1R7Y A;  1VIC A;  2E3D A;  3SXD A;  1ZI5 A;  1ZDF A;  2ICY A;  1W57 A;  1FR8 A;  4FRA A;  3I0C A;  4DEC A;  4Y7T A;  1ZI4 A;  1HJJ A;  1ZCY A;  3D5N A;  3U2V A;  2PX7 A;  1FO9 A;  2RIT A;  4ECM A;  1O23 B;  1VZT A;  4CJB A;  4XWI A;  4FRM A;  1NKH B;  2I5E A;  4EEA A;  3JUK A;  1ZIZ A;  5CQP A;  1ZJ2 A;  2O1H A;  1GX4 A;  3IOJ A;  1FGX A;  4HCQ A;  4IRP A;  4KRV A;  4BMA A;  5C1H A;  3ZLL A;  2XMH A;  3RMV A;  1H5T A;  1H5S C;  2AH9 A;  5CQO A;  2I7B A;  1JVG A;  4Y7G A;  3N9W A;  4G3S A;  2RJ4 A;  2VSI A;  3ST8 A;  1TW5 A;  1FGG A;  1ZJ0 A;  3Q7U A;  1EYR A;  4HOC A;  5IDT A;  3R3I A;  1R82 A;  4CJC A;  3U2T A;  2O1F A;  1G8O A;  2Y6P A;  2PA4 A;  1SS9 A;  4FRH A;  2P72 A;  1HM9 A;  4NAN A;  1GA8 A;  3Q80 A;  1S4O A;  2RIY A;  2JCJ A;  3OC9 A;  1HM0 A;  5D91 A;  5C3B A;  4FRL A;  4KT7 A;  3I0H A;  4UEG A;  1WT3 A;  2C0N A;  2VS5 A;  3DK5 A;  3IOI A;  3R2W A;  5AJP A;  1MP5 A;  4Y62 A;  2P6W A;  4Y9X A;  5C4C A;  4NAK A;  3HL3 A;  4FRB A;  2WVK A;  3V0N A;  1H4D A;  4G3P A;  2AES A;  1I52 A;  4B4M A;  2AEC A;  2YC3 A;  4R7P A;  1W55 A;  3BRK X;  1VPA A;  3OAM A;  4FRD A;  3CKJ A;  4HO5 A;  3D8V A;  2WGZ A;  2BO4 A;  4E1K A;  1ZCU A;  2Q4J A;  4O6N A;  4K6R A;  2Y4M A;  3V8Z A;  1FOA A;  2WE9 A;  1LZ7 A;  1INI A;  3NGW A;  1K4V A;  2BO6 A;  4P02 A;  5C48 A;  3SXG A;  1R7X A;  3I0G A;  5C4F A;  1QG8 A;  1QWJ A;  2WAW A;  4CJ8 A;  2YQH A;  1KWS A;  3U0Y A;  2YQJ A;  5FUH A;  2ZU8 A;  4D11 A;  3SX8 A;  4AAW A;  2XWL A;  1ZJO A;  2RJ5 A;  1LL3 A;  4EEM A;  3OH2 A;  3V8Y A;  1LZI A;  3V91 A;  4AYL A;  2WVM A;  1VGW A;  5CQN X;  5C3A A;  1MC3 A;  5J49 A;  2JCK A;  4Y63 A;  2CU2 A;  3SX3 A;  2V0I A;  2OEG A;  5CMG X;  4KXO A;  3USQ A;  4M2A A;  1VGZ A;  2MZB A;  3BCV A;  3O3P A;  3OH0 A;  4G87 A;  1G9R A;  2VFZ A;  2PGY A;  3ZGF A;  1JVD A;  3CKN A;  2X5S A;  3U2W A;  3JUJ A;  3K8D A;  2V0H A;  1H5S B;  2FYC B;  2RIZ A;  3T7O A;  1TZF A;  1GWV A;  2BO8 A;  5IFY A;  1LL0 A;  1ZCV A;  5CMJ A;  2APC A;  2YQS A;  3T7M A;  4FRP A;  2JCO A;  3V90 A;  4KC2 A;  2QH5 A;  4HO3 A;  4JD0 A;  1ON6 A;  4CVH A;  4D11 C;  2ZU7 A;  4HO6 A;  5C36 A;  1R80 A;  5FTS A;  5L6V A;  3TZT A;  3PKP A;  5C47 A;  1LL2 A;  2YQC A;  4KNX A;  3POL A;  4P00 A;  1VH3 A;  1ZJP A;  4EE4 A;  1IIM A;  1G3L A;  1WT1 A;  3OKR A;  2Z86 A;  3V0Q A;  3KIA A;  4GBP A;  1G93 A;  1HJL A;  2Y7A A;  4B2X A;  1H7T A;  4ARW A;  1R7V A;  2ZU9 A;  4ASJ A;  3OH3 A;  4BQH A;  1GQ9 A;  1R81 A;  1WVC A;  2P73 A;  5FU0 A;  3IOH A;  1H5T B;  4D0Z A;  1G2V A;  1OQM B;  4NAI A;  1H4E A;  3CKO A;  1YP2 A;  5C38 A;  5HS2 A;  1NWG B;  2YCM A;  1INJ A;  1ON8 A;  1O7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...