4EEAA

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-gal-beta1,4-glc-beta
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4eeaA00
2BO8A 4EEOA 2RIYA 4FROA 1GX4A 4E1KA 1GWWA 3Q4SA 4HO6A 4DDZA 1VH3A 1MP3A 3V0OA 4HO9A 1GA8A 3TZTA 2W0VA 4FRQA 3R2WA 4Y63A 1MP5A 1JYLA 1R7UA 2RITA 3PKQA 4LW6A 1HV9A 2AM5A 2V0KA 1K4VA 2UX8A 2Y6PA 2WVLA 4Y6UA 4C2SA 1PZYB 3FOQA 4P00A 1ZI3A 1G9RA 3CU0A 1H5SB 4ARWA 4D0TA 2Z87A 2JCLA 3OAMA 3V0MA 1WVCA 3OKRA 3SXEA 4CVHA 4KXOA 4B2XA 1GWVA 1R82A 4KC1A 4DE7A 2BO6A 1JV3A 4AAWA 1XZ6A 4XWIA 3SPTA 2YQHA 5IDSA 3T7NA 5C3AA 1LZ7A 3OH4A 1R7VA 1V84A 1NF5B 2D7RA 3CKNA 4HO3A 5C4FA 4FRDA 2P72A 5JQQA 4G3SA 2YC3A 5FU0A 5C4DA 2X5ZA 1VPAA 4FRAA 1VGWA 1G2VA 2P6WA 2XWLA 5FTVA 3LW6A 3U2UA 2FYDB 1IINA 2QGIA 1V83A 3Q80A 1LVWA 3E25A 2Y4MA 3V90A 4B2WA 4Y7TA 1NQIB 1W55A 1VICA 4G87A 2WAWA 3QVBA 3OH0A 3V8YA 1G97A 2FFVA 3OC9A 3D98A 1I52A 3I0HA 2WVKA 2ZU7A 2V0IA 1G95A 2VS3A 4EEGA 3ZLKA 3I0GA 1VGTA 4B4GA 4D0ZA 2OI7A 3N9WA 4KNRA 5CMHA 4KC2A 2QH5A 1GQCA 5CQOA 2YQSA 4MNDA 1QWJA 2CU2A 2AE7A 1PZTA 1WSZA 1FGGA 4Y62A 3D5NA 2ZU8A 2YCMA 3ZGGA 1NMMB 2X60A 3SX7A 4Y6NA 1WT2A 1H4EA 2Z86A 4KPXA 3U0XA 1JV1A 1VGZA 1FZWA 1H5RA 1G3LA 1ZCUA 2VSIA 1ZCTA 3ZF8A 3K8EA 2VD4A 5AJPA 2WGZA 3CKOA 3V0QA 4M4KA 4HO4A 2GGQA 2ICYA 1FGXA 5FUHA 2O1GA 2PA4A 4G3PA 2X5SA 4MYBA 2OEGA 2NXVA 4M2AA 1FO8A 3I0EA 1G23A 2I5EA 2Y4JA 1YROB 4GBPA 1H5TA 4FRPA 5CMIA 5C36A 1WT0A 1QGQA 1QG8A 3RSBA 1Z90A 1NWGB 2FYCB 5C4BA 1FRWA 3JUJA 1HM0A 3GUEA 4EVWA 1GQ9A 1QGSA 4NAKA 5C8RA 5C4EA 3POLA 4FRBA 4Y64A 4Y7GA 4J18A 2RJ5A 4EE5A 1HJLA 1JYKA 3F1CA 2OI5A 5CQNX 4KT7A 1R7XA 1S4OA 1VZUA 4M2BA 5FTSA 1H5SC 1LZ0A 1HM8A 2XWNA 4EEAA 4KPZA 1ZI4A 2JCKA 1ZJOA 1R80A 3V0NA 2PGYA 4FCUA 4Y7FA 3SXAA 4DECA 2FFUA 4HO0A 2MZBA 3RMWA 1TW1A 3BRKX 2AESA 4HOCA 3F1YA 1LL3A 3IOHA 5FU8A 2AGDA 2BO7A 5C3DA 4B4MA 2XWMA 1OQMB 3D8VA 2DPWA 2WEEA 3T7MA 2BO4A 1ZCYA 2XMEA 4FRMA 1ZDFA 5EIYA 2RJ1A 3CKVA 1H5SA 1MC3A 3I0KA 2OI6A 5C1GA 1XHBA 1YP3A 2V0HA 3USQA 5CMJA 1H5SD 1TW5A 5BXCA 3U2VA 3I0DA 3OH1A 3PKPA 1ZDGA 1VZXA 2RJ6A 2O1FA 1WT1A 3SX5A 1VH1A 3ZGFA 2RIXA 4B5BA 2VXLA 2Y7AA 3SXCA 4KNXA 4FRHA 5CQMX 1H5RB 2FYAA 2W0WA 3SX3A 5EJ1A 5I1FA 2X65A 2VSHA 3JTJA 3CGXA 3IOJA 4YS8A 2D0JA 5C47A 5FV9A 1ZJ0A 2VFZA 2ZU9A 2FYBA 1TVYA 4EE3A 3SXDA 5J49A 2PGVA 2ICXA 4LW3A 3Q7UA 4ASYA 1H5TB 3PNNA 1GX0A 1LZIA 3IOIA 3DJ4A 2VS4A 3OH3A 2OEFA 4HO8A 1INIA 4NAIA 4HO2A 3USRA 1IIMA 1H3MA 1TZFA 1O7QA 1VZTA 4JD0A 5FYEA 2VXMA 3I0LA 2O1HA 3CKQA 5C49A 4FRLA 1NHEB 4FREA 5L6SA 3RMVA 4NANA 5CQPA 4EEMA 2V0LA 3HL3A 2RJ0A 3I0FA 5AJNA 4Y7UA 1R81A 2JCOA 5C38A 1HM9A 2A8UA 3I0CA 1LZJA 5C48A 1EYRA 4HO5A 1WT3A 1KWSA 1ZJ3A 1FG5N 4KQLA 3T7OA 5AJOA 2FY7A 1JVDA 2AECA 4AC3A 3U2WA 2XMHA 1W77A 4KC4A 2RJ9A 3I0JA 3OGZA 3R3IA 2I7BA 1G0RA 1VM8A 3I0IX 4CJBA 1LL2A 1ON8A 2QKXA 2V0JA 2GGOA 1FXJA 4JISA 4L41C 2VS5A 3KIAA 3V0LA 1H7FA 1LL0A 1G1LA 4B3UA 3U2TA 3SX8A 4BMAA 4AYLA 1YP4A 3O3PA 5CMFX 4G3QA 2AM4A 2AM3A 2D7IA 4M28A 1S4NA 3V91A 4CJ8A 1H4CA 1H7LA 4B4BA 3DUVA 4D48A 1O23B 1ZHJA 1ZJ2A 2E3DA 2YC5A 4BQHA 1H7QA 3TQDA 5IDTA 2YQJA 4ASJA 5L6VA 4CJCA 2Y4LA 2A8WA 1ZJ1A 2WE9A 3ZLLA 5C3BA 1H7GA 1VGUA 1OMXA 1MP4A 2I5KA 3E26A 3ST8A 4FQWA 2JCJA 2AH9A 1ZIZA 1SS9A 4UEGA 2RIZA 1H4DA 1H7EA 1FR8A 5C1HA 4IRQA 3U0YA 5C4CA 1FO9A 2PX7A 4P02A 1ZCVA 4HG6A 3SXBA 5CMGX 1ZI1A 4KRVA 2P73A 4D11C 1R7TA 5CQLX 3SXGA 1OMZA 3U2XA 4K6RA 1EZIA 4EE4A 1O7OA 1H7HA 3DK5A 4AYJA 5IFYA 1E5KA 4Y9XA 1NKHB 5DDVA 2Y4KA 3K8DA 4B42A 1FXOA 4NALA 3V8ZA 1S4PA 1ON6A 1ZJPA 3V0PA 1FOAA 1O0RA 4ECMA 1YP2A 2YQCA 5C1LA 3FWWA 2RJ7A 1INJA 2E8BA 3CKJA 1JVGA 3OH2A 2Q4JA 2YESA 2RJ8A 4R7PA 1R7YA 1V82A 4IRPA 3NGWA 4D11A 1FWYA 1FR9A 1W57A 3EE5A 2APCA 3JUKA 5HS2A 5EJZA 4HCQA 1G8OA 1HJJA 2WVMA 5DDTA 1ZI5A 1H7TA 4ZDQA 1G93A 3BCVA 4FCEA 4Y7VA 2RJ4A
chains in the Genus database with same CATH superfamily
2BO8A 4EEOA 2RIYA 4FROA 1GX4A 4E1KA 1GWWA 3Q4SA 4HO6A 4DDZA 1VH3A 1MP3A 3V0OA 4HO9A 1GA8A 3TZTA 2W0VA 4FRQA 3R2WA 4Y63A 1MP5A 1JYLA 1R7UA 2RITA 3PKQA 4LW6A 1HV9A 2AM5A 2V0KA 1K4VA 2UX8A 2Y6PA 2WVLA 4Y6UA 4C2SA 1PZYB 3FOQA 4P00A 1ZI3A 1G9RA 3CU0A 1H5SB 4ARWA 4D0TA 2Z87A 2JCLA 3OAMA 3V0MA 1WVCA 3OKRA 3SXEA 4CVHA 4KXOA 4B2XA 1GWVA 1R82A 4KC1A 4DE7A 2BO6A 1JV3A 4AAWA 1XZ6A 4XWIA 3SPTA 2YQHA 5IDSA 3T7NA 5C3AA 1LZ7A 3OH4A 1R7VA 1V84A 1NF5B 2D7RA 3CKNA 4HO3A 5C4FA 4FRDA 2P72A 5JQQA 4G3SA 2YC3A 5FU0A 5C4DA 2X5ZA 1VPAA 4FRAA 1VGWA 1G2VA 2P6WA 2XWLA 5FTVA 3LW6A 3U2UA 2FYDB 1IINA 2QGIA 1V83A 3Q80A 1LVWA 3E25A 2Y4MA 3V90A 4B2WA 4Y7TA 1NQIB 1W55A 1VICA 4G87A 2WAWA 3QVBA 3OH0A 3V8YA 1G97A 2FFVA 3OC9A 3D98A 1I52A 3I0HA 2WVKA 2ZU7A 2V0IA 1G95A 2VS3A 4EEGA 3ZLKA 3I0GA 1VGTA 4B4GA 4D0ZA 2OI7A 3N9WA 4KNRA 5CMHA 4KC2A 2QH5A 1GQCA 5CQOA 2YQSA 4MNDA 1QWJA 2CU2A 5D91A 2AE7A 1PZTA 1WSZA 1FGGA 4Y62A 3D5NA 2ZU8A 2YCMA 3ZGGA 1NMMB 2X60A 3SX7A 4Y6NA 1WT2A 1H4EA 2Z86A 4KPXA 3U0XA 1JV1A 1VGZA 1FZWA 1H5RA 1G3LA 1ZCUA 2VSIA 1ZCTA 3ZF8A 3K8EA 2VD4A 5AJPA 2WGZA 3CKOA 3V0QA 4M4KA 4FIXA 4HO4A 2GGQA 2ICYA 1FGXA 5FUHA 2O1GA 2PA4A 4G3PA 2X5SA 4MYBA 2OEGA 2NXVA 4M2AA 1FO8A 3I0EA 1G23A 2I5EA 2Y4JA 1YROB 4GBPA 1H5TA 4FRPA 5CMIA 5C36A 1WT0A 1QGQA 1QG8A 3RSBA 1Z90A 1NWGB 4O6NA 2FYCB 5C4BA 1FRWA 3JUJA 1HM0A 3GUEA 4EVWA 1GQ9A 1QGSA 4NAKA 5C8RA 5C4EA 3POLA 4FRBA 4Y64A 4Y7GA 4J18A 2RJ5A 4EE5A 1HJLA 1JYKA 3F1CA 2OI5A 5CQNX 4KT7A 1R7XA 1S4OA 1VZUA 4M2BA 5FTSA 1H5SC 1LZ0A 1HM8A 2XWNA 4EEAA 4KPZA 1ZI4A 2JCKA 1ZJOA 1R80A 3V0NA 2PGYA 4FCUA 4Y7FA 4FIYA 3SXAA 4DECA 2FFUA 4HO0A 2MZBA 3RMWA 1TW1A 3BRKX 2AESA 4HOCA 3F1YA 1LL3A 3IOHA 5FU8A 2AGDA 2BO7A 5C3DA 4B4MA 2XWMA 1OQMB 3D8VA 2DPWA 2WEEA 3T7MA 2BO4A 1ZCYA 2XMEA 4FRMA 1ZDFA 5EIYA 2RJ1A 3CKVA 1H5SA 1MC3A 3I0KA 2OI6A 5C1GA 1XHBA 1YP3A 2V0HA 3USQA 5CMJA 1H5SD 1TW5A 5BXCA 3U2VA 3I0DA 3OH1A 3PKPA 1ZDGA 1VZXA 2RJ6A 2O1FA 1WT1A 3SX5A 1VH1A 3ZGFA 2RIXA 4B5BA 2VXLA 2Y7AA 3SXCA 4KNXA 4FRHA 5CQMX 4Q7CA 1H5RB 2FYAA 2W0WA 3SX3A 5EJ1A 5I1FA 2X65A 2VSHA 3JTJA 3CGXA 3IOJA 4YS8A 2D0JA 5C47A 5FV9A 1ZJ0A 2VFZA 2ZU9A 2FYBA 1TVYA 4EE3A 3SXDA 5J49A 2PGVA 2ICXA 4LW3A 3Q7UA 4ASYA 1H5TB 3PNNA 1GX0A 1LZIA 3IOIA 3DJ4A 2VS4A 3OH3A 2OEFA 4HO8A 1INIA 4NAIA 4HO2A 3USRA 1IIMA 1H3MA 1TZFA 1O7QA 1VZTA 4JD0A 5FYEA 2VXMA 3I0LA 2O1HA 3CKQA 5C49A 4FRLA 1NHEB 4FREA 5L6SA 3RMVA 4NANA 5CQPA 4EEMA 2J0BA 2V0LA 3HL3A 2RJ0A 3I0FA 5AJNA 4Y7UA 1R81A 2JCOA 5C38A 1HM9A 2A8UA 3I0CA 1LZJA 5C48A 1EYRA 4HO5A 1WT3A 1KWSA 1ZJ3A 1FG5N 4KQLA 3T7OA 5AJOA 2FY7A 1JVDA 2AECA 4AC3A 3U2WA 2XMHA 1W77A 4KC4A 2RJ9A 3I0JA 3OGZA 3R3IA 2I7BA 1G0RA 1VM8A 3I0IX 4CJBA 1LL2A 1ON8A 2QKXA 2V0JA 2GGOA 1FXJA 4JISA 4L41C 2VS5A 3KIAA 2C0NA 3V0LA 1H7FA 1LL0A 1G1LA 4B3UA 3U2TA 3SX8A 4BMAA 4AYLA 1YP4A 3O3PA 5CMFX 4G3QA 2AM4A 2AM3A 2D7IA 4M28A 1S4NA 3V91A 4CJ8A 1H4CA 1H7LA 4B4BA 3DUVA 4D48A 1O23B 1ZHJA 1ZJ2A 2E3DA 2YC5A 4BQHA 1H7QA 4MIXA 3TQDA 5IDTA 2YQJA 4ASJA 5L6VA 4CJCA 2Y4LA 2A8WA 1ZJ1A 2WE9A 3ZLLA 5C3BA 1H7GA 1VGUA 1OMXA 1MP4A 2I5KA 3E26A 3ST8A 4FQWA 2JCJA 2AH9A 1ZIZA 1SS9A 4UEGA 2RIZA 1H4DA 1H7EA 1FR8A 4O6MA 2VK9A 5C1HA 4IRQA 3U0YA 5C4CA 1FO9A 2PX7A 4P02A 1ZCVA 4HG6A 3SXBA 5CMGX 1ZI1A 4KRVA 2P73A 4D11C 1R7TA 5CQLX 3SXGA 1OMZA 3U2XA 4K6RA 1EZIA 4EE4A 1O7OA 1H7HA 3DK5A 4AYJA 5IFYA 1E5KA 4Y9XA 1NKHB 5DDVA 2Y4KA 3K8DA 4B42A 1FXOA 4NALA 3V8ZA 1S4PA 1ON6A 1ZJPA 3V0PA 1FOAA 2J0AA 1O0RA 4ECMA 1YP2A 2YQCA 5C1LA 3FWWA 2RJ7A 1INJA 2E8BA 3CKJA 1JVGA 3OH2A 2Q4JA 2YESA 2RJ8A 4R7PA 1R7YA 1V82A 4IRPA 3NGWA 4D11A 1FWYA 1FR9A 1W57A 5D92A 3EE5A 2APCA 3JUKA 5HS2A 5EJZA 4HCQA 1G8OA 1HJJA 2WVMA 5DDTA 1ZI5A 1H7TA 4ZDQA 1G93A 3BCVA 4FCEA 4Y7VA 2RJ4A
chains in the Genus database with same CATH topology
2BO8A 4EEOA 2RIYA 4FROA 1GX4A 4E1KA 1GWWA 3Q4SA 4HO6A 4DDZA 1VH3A 1MP3A 3V0OA 4HO9A 1GA8A 3TZTA 2W0VA 4FRQA 3R2WA 4Y63A 1MP5A 1JYLA 1R7UA 2RITA 3PKQA 4LW6A 1HV9A 2AM5A 2V0KA 1K4VA 2UX8A 2Y6PA 2WVLA 4Y6UA 4C2SA 1PZYB 3FOQA 4P00A 1ZI3A 1G9RA 3CU0A 1H5SB 4ARWA 4D0TA 2Z87A 2JCLA 3OAMA 3V0MA 1WVCA 3OKRA 3SXEA 4CVHA 4KXOA 4B2XA 1GWVA 1R82A 4KC1A 4DE7A 2BO6A 1JV3A 4AAWA 1XZ6A 4XWIA 3SPTA 2YQHA 5IDSA 3T7NA 5C3AA 1LZ7A 3OH4A 1R7VA 1V84A 1NF5B 2D7RA 3CKNA 4HO3A 5C4FA 4FRDA 2P72A 5JQQA 4G3SA 2YC3A 5FU0A 5C4DA 2X5ZA 1VPAA 4FRAA 1VGWA 1G2VA 2P6WA 2XWLA 5FTVA 3LW6A 3U2UA 2FYDB 1IINA 2QGIA 1V83A 3Q80A 1LVWA 3E25A 2Y4MA 3V90A 4B2WA 4Y7TA 1NQIB 1W55A 1VICA 4G87A 2WAWA 3QVBA 3OH0A 3V8YA 1G97A 2FFVA 3OC9A 3D98A 1I52A 3I0HA 2WVKA 2ZU7A 2V0IA 1G95A 2VS3A 4EEGA 3ZLKA 3I0GA 1VGTA 4B4GA 4D0ZA 2OI7A 3N9WA 4KNRA 5CMHA 4KC2A 2QH5A 1GQCA 5CQOA 2YQSA 4MNDA 1QWJA 2CU2A 5D91A 2AE7A 1PZTA 1WSZA 1FGGA 4Y62A 3D5NA 2ZU8A 2YCMA 3ZGGA 1NMMB 2X60A 3SX7A 4Y6NA 1WT2A 1H4EA 2Z86A 4KPXA 3U0XA 1JV1A 1VGZA 1FZWA 1H5RA 1G3LA 1ZCUA 2VSIA 1ZCTA 3ZF8A 3K8EA 2VD4A 5AJPA 2WGZA 3CKOA 3V0QA 4M4KA 4FIXA 4HO4A 2GGQA 2ICYA 1FGXA 5FUHA 2O1GA 2PA4A 4G3PA 2X5SA 4MYBA 2OEGA 2NXVA 4M2AA 1FO8A 3I0EA 1G23A 2I5EA 2Y4JA 1YROB 4GBPA 1H5TA 4FRPA 5CMIA 5C36A 1WT0A 1QGQA 1QG8A 3RSBA 1Z90A 1NWGB 4O6NA 2FYCB 5C4BA 1FRWA 3JUJA 1HM0A 3GUEA 4EVWA 1GQ9A 1QGSA 4NAKA 5C8RA 5C4EA 3POLA 4FRBA 4Y64A 4Y7GA 4J18A 2RJ5A 4EE5A 1HJLA 1JYKA 3F1CA 2OI5A 5CQNX 4KT7A 1R7XA 1S4OA 1VZUA 4M2BA 5FTSA 1H5SC 1LZ0A 1HM8A 2XWNA 4EEAA 4KPZA 1ZI4A 2JCKA 1ZJOA 1R80A 3V0NA 2PGYA 4FCUA 4Y7FA 4FIYA 3SXAA 4DECA 2FFUA 4HO0A 2MZBA 3RMWA 1TW1A 3BRKX 2AESA 4HOCA 3F1YA 1LL3A 3IOHA 5FU8A 2AGDA 2BO7A 5C3DA 4B4MA 2XWMA 1OQMB 3D8VA 2DPWA 2WEEA 3T7MA 2BO4A 1ZCYA 2XMEA 4FRMA 1ZDFA 5EIYA 2RJ1A 3CKVA 1H5SA 1MC3A 3I0KA 2OI6A 5C1GA 1XHBA 1YP3A 2V0HA 3USQA 5CMJA 1H5SD 1TW5A 5BXCA 3U2VA 3I0DA 3OH1A 3PKPA 1ZDGA 1VZXA 2RJ6A 2O1FA 1WT1A 3SX5A 1VH1A 3ZGFA 2RIXA 4B5BA 2VXLA 2Y7AA 3SXCA 4KNXA 4FRHA 5CQMX 4Q7CA 1H5RB 2FYAA 2W0WA 3SX3A 5EJ1A 5I1FA 2X65A 2VSHA 3JTJA 3CGXA 3IOJA 4YS8A 2D0JA 5C47A 5FV9A 1ZJ0A 2VFZA 2ZU9A 2FYBA 1TVYA 4EE3A 3SXDA 5J49A 2PGVA 2ICXA 4LW3A 3Q7UA 4ASYA 1H5TB 3PNNA 1GX0A 1LZIA 3IOIA 3DJ4A 2VS4A 3OH3A 2OEFA 4HO8A 1INIA 4NAIA 4HO2A 3USRA 1IIMA 1H3MA 1TZFA 1O7QA 1VZTA 4JD0A 5FYEA 2VXMA 3I0LA 2O1HA 3CKQA 5C49A 4FRLA 1NHEB 4FREA 5L6SA 3RMVA 4NANA 5CQPA 4EEMA 2J0BA 2V0LA 3HL3A 2RJ0A 3I0FA 5AJNA 4Y7UA 1R81A 2JCOA 5C38A 1HM9A 2A8UA 3I0CA 1LZJA 5C48A 1EYRA 4HO5A 1WT3A 1KWSA 1ZJ3A 1FG5N 4KQLA 3T7OA 5AJOA 2FY7A 1JVDA 2AECA 4AC3A 3U2WA 2XMHA 1W77A 4KC4A 2RJ9A 3I0JA 3OGZA 3R3IA 2I7BA 1G0RA 1VM8A 3I0IX 4CJBA 1LL2A 1ON8A 2QKXA 2V0JA 2GGOA 1FXJA 4JISA 4L41C 2VS5A 3KIAA 2C0NA 3V0LA 1H7FA 1LL0A 1G1LA 4B3UA 3U2TA 3SX8A 4BMAA 4AYLA 1YP4A 3O3PA 5CMFX 4G3QA 2AM4A 2AM3A 2D7IA 4M28A 1S4NA 3V91A 4CJ8A 1H4CA 1H7LA 4B4BA 3DUVA 4D48A 1O23B 1ZHJA 1ZJ2A 2E3DA 2YC5A 4BQHA 1H7QA 4MIXA 3TQDA 5IDTA 2YQJA 4ASJA 5L6VA 4CJCA 2Y4LA 2A8WA 1ZJ1A 2WE9A 3ZLLA 5C3BA 1H7GA 1VGUA 1OMXA 1MP4A 2I5KA 3E26A 3ST8A 4FQWA 2JCJA 2AH9A 1ZIZA 1SS9A 4UEGA 2RIZA 1H4DA 1H7EA 1FR8A 4O6MA 2VK9A 5C1HA 4IRQA 3U0YA 5C4CA 1FO9A 2PX7A 4P02A 1ZCVA 4HG6A 3SXBA 5CMGX 1ZI1A 4KRVA 2P73A 4D11C 1R7TA 5CQLX 3SXGA 1OMZA 3U2XA 4K6RA 1EZIA 4EE4A 1O7OA 1H7HA 3DK5A 4AYJA 5IFYA 1E5KA 4Y9XA 1NKHB 5DDVA 2Y4KA 3K8DA 4B42A 1FXOA 4NALA 3V8ZA 1S4PA 1ON6A 1ZJPA 3V0PA 1FOAA 2J0AA 1O0RA 4ECMA 1YP2A 2YQCA 5C1LA 3FWWA 2RJ7A 1INJA 2E8BA 3CKJA 1JVGA 3OH2A 2Q4JA 2YESA 2RJ8A 4R7PA 1R7YA 1V82A 4IRPA 3NGWA 4D11A 1FWYA 1FR9A 1W57A 5D92A 3EE5A 2APCA 3JUKA 5HS2A 5EJZA 4HCQA 1G8OA 1HJJA 2WVMA 5DDTA 1ZI5A 1H7TA 4ZDQA 1G93A 3BCVA 4FCEA 4Y7VA 2RJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO8 A;  4EEO A;  2RIY A;  4FRO A;  1GX4 A;  4E1K A;  1GWW A;  3Q4S A;  4HO6 A;  4DDZ A;  1VH3 A;  1MP3 A;  3V0O A;  4HO9 A;  1GA8 A;  3TZT A;  2W0V A;  4FRQ A;  3R2W A;  4Y63 A;  1MP5 A;  1JYL A;  1R7U A;  2RIT A;  3PKQ A;  4LW6 A;  1HV9 A;  2AM5 A;  2V0K A;  1K4V A;  2UX8 A;  2Y6P A;  2WVL A;  4Y6U A;  4C2S A;  1PZY B;  3FOQ A;  4P00 A;  1ZI3 A;  1G9R A;  3CU0 A;  1H5S B;  4ARW A;  4D0T A;  2Z87 A;  2JCL A;  3OAM A;  3V0M A;  1WVC A;  3OKR A;  3SXE A;  4CVH A;  4KXO A;  4B2X A;  1GWV A;  1R82 A;  4KC1 A;  4DE7 A;  2BO6 A;  1JV3 A;  4AAW A;  1XZ6 A;  4XWI A;  3SPT A;  2YQH A;  5IDS A;  3T7N A;  5C3A A;  1LZ7 A;  3OH4 A;  1R7V A;  1V84 A;  1NF5 B;  2D7R A;  3CKN A;  4HO3 A;  5C4F A;  4FRD A;  2P72 A;  5JQQ A;  4G3S A;  2YC3 A;  5FU0 A;  5C4D A;  2X5Z A;  1VPA A;  4FRA A;  1VGW A;  1G2V A;  2P6W A;  2XWL A;  5FTV A;  3LW6 A;  3U2U A;  2FYD B;  1IIN A;  2QGI A;  1V83 A;  3Q80 A;  1LVW A;  3E25 A;  2Y4M A;  3V90 A;  4B2W A;  4Y7T A;  1NQI B;  1W55 A;  1VIC A;  4G87 A;  2WAW A;  3QVB A;  3OH0 A;  3V8Y A;  1G97 A;  2FFV A;  3OC9 A;  3D98 A;  1I52 A;  3I0H A;  2WVK A;  2ZU7 A;  2V0I A;  1G95 A;  2VS3 A;  4EEG A;  3ZLK A;  3I0G A;  1VGT A;  4B4G A;  4D0Z A;  2OI7 A;  3N9W A;  4KNR A;  5CMH A;  4KC2 A;  2QH5 A;  1GQC A;  5CQO A;  2YQS A;  4MND A;  1QWJ A;  2CU2 A;  2AE7 A;  1PZT A;  1WSZ A;  1FGG A;  4Y62 A;  3D5N A;  2ZU8 A;  2YCM A;  3ZGG A;  1NMM B;  2X60 A;  3SX7 A;  4Y6N A;  1WT2 A;  1H4E A;  2Z86 A;  4KPX A;  3U0X A;  1JV1 A;  1VGZ A;  1FZW A;  1H5R A;  1G3L A;  1ZCU A;  2VSI A;  1ZCT A;  3ZF8 A;  3K8E A;  2VD4 A;  5AJP A;  2WGZ A;  3CKO A;  3V0Q A;  4M4K A;  4HO4 A;  2GGQ A;  2ICY A;  1FGX A;  5FUH A;  2O1G A;  2PA4 A;  4G3P A;  2X5S A;  4MYB A;  2OEG A;  2NXV A;  4M2A A;  1FO8 A;  3I0E A;  1G23 A;  2I5E A;  2Y4J A;  1YRO B;  4GBP A;  1H5T A;  4FRP A;  5CMI A;  5C36 A;  1WT0 A;  1QGQ A;  1QG8 A;  3RSB A;  1Z90 A;  1NWG B;  2FYC B;  5C4B A;  1FRW A;  3JUJ A;  1HM0 A;  3GUE A;  4EVW A;  1GQ9 A;  1QGS A;  4NAK A;  5C8R A;  5C4E A;  3POL A;  4FRB A;  4Y64 A;  4Y7G A;  4J18 A;  2RJ5 A;  4EE5 A;  1HJL A;  1JYK A;  3F1C A;  2OI5 A;  5CQN X;  4KT7 A;  1R7X A;  1S4O A;  1VZU A;  4M2B A;  5FTS A;  1H5S C;  1LZ0 A;  1HM8 A;  2XWN A;  4EEA A;  4KPZ A;  1ZI4 A;  2JCK A;  1ZJO A;  1R80 A;  3V0N A;  2PGY A;  4FCU A;  4Y7F A;  3SXA A;  4DEC A;  2FFU A;  4HO0 A;  2MZB A;  3RMW A;  1TW1 A;  3BRK X;  2AES A;  4HOC A;  3F1Y A;  1LL3 A;  3IOH A;  5FU8 A;  2AGD A;  2BO7 A;  5C3D A;  4B4M A;  2XWM A;  1OQM B;  3D8V A;  2DPW A;  2WEE A;  3T7M A;  2BO4 A;  1ZCY A;  2XME A;  4FRM A;  1ZDF A;  5EIY A;  2RJ1 A;  3CKV A;  1H5S A;  1MC3 A;  3I0K A;  2OI6 A;  5C1G A;  1XHB A;  1YP3 A;  2V0H A;  3USQ A;  5CMJ A;  1H5S D;  1TW5 A;  5BXC A;  3U2V A;  3I0D A;  3OH1 A;  3PKP A;  1ZDG A;  1VZX A;  2RJ6 A;  2O1F A;  1WT1 A;  3SX5 A;  1VH1 A;  3ZGF A;  2RIX A;  4B5B A;  2VXL A;  2Y7A A;  3SXC A;  4KNX A;  4FRH A;  5CQM X;  1H5R B;  2FYA A;  2W0W A;  3SX3 A;  5EJ1 A;  5I1F A;  2X65 A;  2VSH A;  3JTJ A;  3CGX A;  3IOJ A;  4YS8 A;  2D0J A;  5C47 A;  5FV9 A;  1ZJ0 A;  2VFZ A;  2ZU9 A;  2FYB A;  1TVY A;  4EE3 A;  3SXD A;  5J49 A;  2PGV A;  2ICX A;  4LW3 A;  3Q7U A;  4ASY A;  1H5T B;  3PNN A;  1GX0 A;  1LZI A;  3IOI A;  3DJ4 A;  2VS4 A;  3OH3 A;  2OEF A;  4HO8 A;  1INI A;  4NAI A;  4HO2 A;  3USR A;  1IIM A;  1H3M A;  1TZF A;  1O7Q A;  1VZT A;  4JD0 A;  5FYE A;  2VXM A;  3I0L A;  2O1H A;  3CKQ A;  5C49 A;  4FRL A;  1NHE B;  4FRE A;  5L6S A;  3RMV A;  4NAN A;  5CQP A;  4EEM A;  2V0L A;  3HL3 A;  2RJ0 A;  3I0F A;  5AJN A;  4Y7U A;  1R81 A;  2JCO A;  5C38 A;  1HM9 A;  2A8U A;  3I0C A;  1LZJ A;  5C48 A;  1EYR A;  4HO5 A;  1WT3 A;  1KWS A;  1ZJ3 A;  1FG5 N;  4KQL A;  3T7O A;  5AJO A;  2FY7 A;  1JVD A;  2AEC A;  4AC3 A;  3U2W A;  2XMH A;  1W77 A;  4KC4 A;  2RJ9 A;  3I0J A;  3OGZ A;  3R3I A;  2I7B A;  1G0R A;  1VM8 A;  3I0I X;  4CJB A;  1LL2 A;  1ON8 A;  2QKX A;  2V0J A;  2GGO A;  1FXJ A;  4JIS A;  4L41 C;  2VS5 A;  3KIA A;  3V0L A;  1H7F A;  1LL0 A;  1G1L A;  4B3U A;  3U2T A;  3SX8 A;  4BMA A;  4AYL A;  1YP4 A;  3O3P A;  5CMF X;  4G3Q A;  2AM4 A;  2AM3 A;  2D7I A;  4M28 A;  1S4N A;  3V91 A;  4CJ8 A;  1H4C A;  1H7L A;  4B4B A;  3DUV A;  4D48 A;  1O23 B;  1ZHJ A;  1ZJ2 A;  2E3D A;  2YC5 A;  4BQH A;  1H7Q A;  3TQD A;  5IDT A;  2YQJ A;  4ASJ A;  5L6V A;  4CJC A;  2Y4L A;  2A8W A;  1ZJ1 A;  2WE9 A;  3ZLL A;  5C3B A;  1H7G A;  1VGU A;  1OMX A;  1MP4 A;  2I5K A;  3E26 A;  3ST8 A;  4FQW A;  2JCJ A;  2AH9 A;  1ZIZ A;  1SS9 A;  4UEG A;  2RIZ A;  1H4D A;  1H7E A;  1FR8 A;  5C1H A;  4IRQ A;  3U0Y A;  5C4C A;  1FO9 A;  2PX7 A;  4P02 A;  1ZCV A;  4HG6 A;  3SXB A;  5CMG X;  1ZI1 A;  4KRV A;  2P73 A;  4D11 C;  1R7T A;  5CQL X;  3SXG A;  1OMZ A;  3U2X A;  4K6R A;  1EZI A;  4EE4 A;  1O7O A;  1H7H A;  3DK5 A;  4AYJ A;  5IFY A;  1E5K A;  4Y9X A;  1NKH B;  5DDV A;  2Y4K A;  3K8D A;  4B42 A;  1FXO A;  4NAL A;  3V8Z A;  1S4P A;  1ON6 A;  1ZJP A;  3V0P A;  1FOA A;  1O0R A;  4ECM A;  1YP2 A;  2YQC A;  5C1L A;  3FWW A;  2RJ7 A;  1INJ A;  2E8B A;  3CKJ A;  1JVG A;  3OH2 A;  2Q4J A;  2YES A;  2RJ8 A;  4R7P A;  1R7Y A;  1V82 A;  4IRP A;  3NGW A;  4D11 A;  1FWY A;  1FR9 A;  1W57 A;  3EE5 A;  2APC A;  3JUK A;  5HS2 A;  5EJZ A;  4HCQ A;  1G8O A;  1HJJ A;  2WVM A;  5DDT A;  1ZI5 A;  1H7T A;  4ZDQ A;  1G93 A;  3BCV A;  4FCE A;  4Y7V A;  2RJ4 A; 
#chains in the Genus database with same CATH topology
 2BO8 A;  4EEO A;  2RIY A;  4FRO A;  1GX4 A;  4E1K A;  1GWW A;  3Q4S A;  4HO6 A;  4DDZ A;  1VH3 A;  1MP3 A;  3V0O A;  4HO9 A;  1GA8 A;  3TZT A;  2W0V A;  4FRQ A;  3R2W A;  4Y63 A;  1MP5 A;  1JYL A;  1R7U A;  2RIT A;  3PKQ A;  4LW6 A;  1HV9 A;  2AM5 A;  2V0K A;  1K4V A;  2UX8 A;  2Y6P A;  2WVL A;  4Y6U A;  4C2S A;  1PZY B;  3FOQ A;  4P00 A;  1ZI3 A;  1G9R A;  3CU0 A;  1H5S B;  4ARW A;  4D0T A;  2Z87 A;  2JCL A;  3OAM A;  3V0M A;  1WVC A;  3OKR A;  3SXE A;  4CVH A;  4KXO A;  4B2X A;  1GWV A;  1R82 A;  4KC1 A;  4DE7 A;  2BO6 A;  1JV3 A;  4AAW A;  1XZ6 A;  4XWI A;  3SPT A;  2YQH A;  5IDS A;  3T7N A;  5C3A A;  1LZ7 A;  3OH4 A;  1R7V A;  1V84 A;  1NF5 B;  2D7R A;  3CKN A;  4HO3 A;  5C4F A;  4FRD A;  2P72 A;  5JQQ A;  4G3S A;  2YC3 A;  5FU0 A;  5C4D A;  2X5Z A;  1VPA A;  4FRA A;  1VGW A;  1G2V A;  2P6W A;  2XWL A;  5FTV A;  3LW6 A;  3U2U A;  2FYD B;  1IIN A;  2QGI A;  1V83 A;  3Q80 A;  1LVW A;  3E25 A;  2Y4M A;  3V90 A;  4B2W A;  4Y7T A;  1NQI B;  1W55 A;  1VIC A;  4G87 A;  2WAW A;  3QVB A;  3OH0 A;  3V8Y A;  1G97 A;  2FFV A;  3OC9 A;  3D98 A;  1I52 A;  3I0H A;  2WVK A;  2ZU7 A;  2V0I A;  1G95 A;  2VS3 A;  4EEG A;  3ZLK A;  3I0G A;  1VGT A;  4B4G A;  4D0Z A;  2OI7 A;  3N9W A;  4KNR A;  5CMH A;  4KC2 A;  2QH5 A;  1GQC A;  5CQO A;  2YQS A;  4MND A;  1QWJ A;  2CU2 A;  5D91 A;  2AE7 A;  1PZT A;  1WSZ A;  1FGG A;  4Y62 A;  3D5N A;  2ZU8 A;  2YCM A;  3ZGG A;  1NMM B;  2X60 A;  3SX7 A;  4Y6N A;  1WT2 A;  1H4E A;  2Z86 A;  4KPX A;  3U0X A;  1JV1 A;  1VGZ A;  1FZW A;  1H5R A;  1G3L A;  1ZCU A;  2VSI A;  1ZCT A;  3ZF8 A;  3K8E A;  2VD4 A;  5AJP A;  2WGZ A;  3CKO A;  3V0Q A;  4M4K A;  4FIX A;  4HO4 A;  2GGQ A;  2ICY A;  1FGX A;  5FUH A;  2O1G A;  2PA4 A;  4G3P A;  2X5S A;  4MYB A;  2OEG A;  2NXV A;  4M2A A;  1FO8 A;  3I0E A;  1G23 A;  2I5E A;  2Y4J A;  1YRO B;  4GBP A;  1H5T A;  4FRP A;  5CMI A;  5C36 A;  1WT0 A;  1QGQ A;  1QG8 A;  3RSB A;  1Z90 A;  1NWG B;  4O6N A;  2FYC B;  5C4B A;  1FRW A;  3JUJ A;  1HM0 A;  3GUE A;  4EVW A;  1GQ9 A;  1QGS A;  4NAK A;  5C8R A;  5C4E A;  3POL A;  4FRB A;  4Y64 A;  4Y7G A;  4J18 A;  2RJ5 A;  4EE5 A;  1HJL A;  1JYK A;  3F1C A;  2OI5 A;  5CQN X;  4KT7 A;  1R7X A;  1S4O A;  1VZU A;  4M2B A;  5FTS A;  1H5S C;  1LZ0 A;  1HM8 A;  2XWN A;  4EEA A;  4KPZ A;  1ZI4 A;  2JCK A;  1ZJO A;  1R80 A;  3V0N A;  2PGY A;  4FCU A;  4Y7F A;  4FIY A;  3SXA A;  4DEC A;  2FFU A;  4HO0 A;  2MZB A;  3RMW A;  1TW1 A;  3BRK X;  2AES A;  4HOC A;  3F1Y A;  1LL3 A;  3IOH A;  5FU8 A;  2AGD A;  2BO7 A;  5C3D A;  4B4M A;  2XWM A;  1OQM B;  3D8V A;  2DPW A;  2WEE A;  3T7M A;  2BO4 A;  1ZCY A;  2XME A;  4FRM A;  1ZDF A;  5EIY A;  2RJ1 A;  3CKV A;  1H5S A;  1MC3 A;  3I0K A;  2OI6 A;  5C1G A;  1XHB A;  1YP3 A;  2V0H A;  3USQ A;  5CMJ A;  1H5S D;  1TW5 A;  5BXC A;  3U2V A;  3I0D A;  3OH1 A;  3PKP A;  1ZDG A;  1VZX A;  2RJ6 A;  2O1F A;  1WT1 A;  3SX5 A;  1VH1 A;  3ZGF A;  2RIX A;  4B5B A;  2VXL A;  2Y7A A;  3SXC A;  4KNX A;  4FRH A;  5CQM X;  4Q7C A;  1H5R B;  2FYA A;  2W0W A;  3SX3 A;  5EJ1 A;  5I1F A;  2X65 A;  2VSH A;  3JTJ A;  3CGX A;  3IOJ A;  4YS8 A;  2D0J A;  5C47 A;  5FV9 A;  1ZJ0 A;  2VFZ A;  2ZU9 A;  2FYB A;  1TVY A;  4EE3 A;  3SXD A;  5J49 A;  2PGV A;  2ICX A;  4LW3 A;  3Q7U A;  4ASY A;  1H5T B;  3PNN A;  1GX0 A;  1LZI A;  3IOI A;  3DJ4 A;  2VS4 A;  3OH3 A;  2OEF A;  4HO8 A;  1INI A;  4NAI A;  4HO2 A;  3USR A;  1IIM A;  1H3M A;  1TZF A;  1O7Q A;  1VZT A;  4JD0 A;  5FYE A;  2VXM A;  3I0L A;  2O1H A;  3CKQ A;  5C49 A;  4FRL A;  1NHE B;  4FRE A;  5L6S A;  3RMV A;  4NAN A;  5CQP A;  4EEM A;  2J0B A;  2V0L A;  3HL3 A;  2RJ0 A;  3I0F A;  5AJN A;  4Y7U A;  1R81 A;  2JCO A;  5C38 A;  1HM9 A;  2A8U A;  3I0C A;  1LZJ A;  5C48 A;  1EYR A;  4HO5 A;  1WT3 A;  1KWS A;  1ZJ3 A;  1FG5 N;  4KQL A;  3T7O A;  5AJO A;  2FY7 A;  1JVD A;  2AEC A;  4AC3 A;  3U2W A;  2XMH A;  1W77 A;  4KC4 A;  2RJ9 A;  3I0J A;  3OGZ A;  3R3I A;  2I7B A;  1G0R A;  1VM8 A;  3I0I X;  4CJB A;  1LL2 A;  1ON8 A;  2QKX A;  2V0J A;  2GGO A;  1FXJ A;  4JIS A;  4L41 C;  2VS5 A;  3KIA A;  2C0N A;  3V0L A;  1H7F A;  1LL0 A;  1G1L A;  4B3U A;  3U2T A;  3SX8 A;  4BMA A;  4AYL A;  1YP4 A;  3O3P A;  5CMF X;  4G3Q A;  2AM4 A;  2AM3 A;  2D7I A;  4M28 A;  1S4N A;  3V91 A;  4CJ8 A;  1H4C A;  1H7L A;  4B4B A;  3DUV A;  4D48 A;  1O23 B;  1ZHJ A;  1ZJ2 A;  2E3D A;  2YC5 A;  4BQH A;  1H7Q A;  4MIX A;  3TQD A;  5IDT A;  2YQJ A;  4ASJ A;  5L6V A;  4CJC A;  2Y4L A;  2A8W A;  1ZJ1 A;  2WE9 A;  3ZLL A;  5C3B A;  1H7G A;  1VGU A;  1OMX A;  1MP4 A;  2I5K A;  3E26 A;  3ST8 A;  4FQW A;  2JCJ A;  2AH9 A;  1ZIZ A;  1SS9 A;  4UEG A;  2RIZ A;  1H4D A;  1H7E A;  1FR8 A;  4O6M A;  2VK9 A;  5C1H A;  4IRQ A;  3U0Y A;  5C4C A;  1FO9 A;  2PX7 A;  4P02 A;  1ZCV A;  4HG6 A;  3SXB A;  5CMG X;  1ZI1 A;  4KRV A;  2P73 A;  4D11 C;  1R7T A;  5CQL X;  3SXG A;  1OMZ A;  3U2X A;  4K6R A;  1EZI A;  4EE4 A;  1O7O A;  1H7H A;  3DK5 A;  4AYJ A;  5IFY A;  1E5K A;  4Y9X A;  1NKH B;  5DDV A;  2Y4K A;  3K8D A;  4B42 A;  1FXO A;  4NAL A;  3V8Z A;  1S4P A;  1ON6 A;  1ZJP A;  3V0P A;  1FOA A;  2J0A A;  1O0R A;  4ECM A;  1YP2 A;  2YQC A;  5C1L A;  3FWW A;  2RJ7 A;  1INJ A;  2E8B A;  3CKJ A;  1JVG A;  3OH2 A;  2Q4J A;  2YES A;  2RJ8 A;  4R7P A;  1R7Y A;  1V82 A;  4IRP A;  3NGW A;  4D11 A;  1FWY A;  1FR9 A;  1W57 A;  5D92 A;  3EE5 A;  2APC A;  3JUK A;  5HS2 A;  5EJZ A;  4HCQ A;  1G8O A;  1HJJ A;  2WVM A;  5DDT A;  1ZI5 A;  1H7T A;  4ZDQ A;  1G93 A;  3BCV A;  4FCE A;  4Y7V A;  2RJ4 A; 
#chains in the Genus database with same CATH homology
 2BO8 A;  4EEO A;  2RIY A;  4FRO A;  1GX4 A;  4E1K A;  1GWW A;  3Q4S A;  4HO6 A;  4DDZ A;  1VH3 A;  1MP3 A;  3V0O A;  4HO9 A;  1GA8 A;  3TZT A;  2W0V A;  4FRQ A;  3R2W A;  4Y63 A;  1MP5 A;  1JYL A;  1R7U A;  2RIT A;  3PKQ A;  4LW6 A;  1HV9 A;  2AM5 A;  2V0K A;  1K4V A;  2UX8 A;  2Y6P A;  2WVL A;  4Y6U A;  4C2S A;  1PZY B;  3FOQ A;  4P00 A;  1ZI3 A;  1G9R A;  3CU0 A;  1H5S B;  4ARW A;  4D0T A;  2Z87 A;  2JCL A;  3OAM A;  3V0M A;  1WVC A;  3OKR A;  3SXE A;  4CVH A;  4KXO A;  4B2X A;  1GWV A;  1R82 A;  4KC1 A;  4DE7 A;  2BO6 A;  1JV3 A;  4AAW A;  1XZ6 A;  4XWI A;  3SPT A;  2YQH A;  5IDS A;  3T7N A;  5C3A A;  1LZ7 A;  3OH4 A;  1R7V A;  1V84 A;  1NF5 B;  2D7R A;  3CKN A;  4HO3 A;  5C4F A;  4FRD A;  2P72 A;  5JQQ A;  4G3S A;  2YC3 A;  5FU0 A;  5C4D A;  2X5Z A;  1VPA A;  4FRA A;  1VGW A;  1G2V A;  2P6W A;  2XWL A;  5FTV A;  3LW6 A;  3U2U A;  2FYD B;  1IIN A;  2QGI A;  1V83 A;  3Q80 A;  1LVW A;  3E25 A;  2Y4M A;  3V90 A;  4B2W A;  4Y7T A;  1NQI B;  1W55 A;  1VIC A;  4G87 A;  2WAW A;  3QVB A;  3OH0 A;  3V8Y A;  1G97 A;  2FFV A;  3OC9 A;  3D98 A;  1I52 A;  3I0H A;  2WVK A;  2ZU7 A;  2V0I A;  1G95 A;  2VS3 A;  4EEG A;  3ZLK A;  3I0G A;  1VGT A;  4B4G A;  4D0Z A;  2OI7 A;  3N9W A;  4KNR A;  5CMH A;  4KC2 A;  2QH5 A;  1GQC A;  5CQO A;  2YQS A;  4MND A;  1QWJ A;  2CU2 A;  5D91 A;  2AE7 A;  1PZT A;  1WSZ A;  1FGG A;  4Y62 A;  3D5N A;  2ZU8 A;  2YCM A;  3ZGG A;  1NMM B;  2X60 A;  3SX7 A;  4Y6N A;  1WT2 A;  1H4E A;  2Z86 A;  4KPX A;  3U0X A;  1JV1 A;  1VGZ A;  1FZW A;  1H5R A;  1G3L A;  1ZCU A;  2VSI A;  1ZCT A;  3ZF8 A;  3K8E A;  2VD4 A;  5AJP A;  2WGZ A;  3CKO A;  3V0Q A;  4M4K A;  4FIX A;  4HO4 A;  2GGQ A;  2ICY A;  1FGX A;  5FUH A;  2O1G A;  2PA4 A;  4G3P A;  2X5S A;  4MYB A;  2OEG A;  2NXV A;  4M2A A;  1FO8 A;  3I0E A;  1G23 A;  2I5E A;  2Y4J A;  1YRO B;  4GBP A;  1H5T A;  4FRP A;  5CMI A;  5C36 A;  1WT0 A;  1QGQ A;  1QG8 A;  3RSB A;  1Z90 A;  1NWG B;  4O6N A;  2FYC B;  5C4B A;  1FRW A;  3JUJ A;  1HM0 A;  3GUE A;  4EVW A;  1GQ9 A;  1QGS A;  4NAK A;  5C8R A;  5C4E A;  3POL A;  4FRB A;  4Y64 A;  4Y7G A;  4J18 A;  2RJ5 A;  4EE5 A;  1HJL A;  1JYK A;  3F1C A;  2OI5 A;  5CQN X;  4KT7 A;  1R7X A;  1S4O A;  1VZU A;  4M2B A;  5FTS A;  1H5S C;  1LZ0 A;  1HM8 A;  2XWN A;  4EEA A;  4KPZ A;  1ZI4 A;  2JCK A;  1ZJO A;  1R80 A;  3V0N A;  2PGY A;  4FCU A;  4Y7F A;  4FIY A;  3SXA A;  4DEC A;  2FFU A;  4HO0 A;  2MZB A;  3RMW A;  1TW1 A;  3BRK X;  2AES A;  4HOC A;  3F1Y A;  1LL3 A;  3IOH A;  5FU8 A;  2AGD A;  2BO7 A;  5C3D A;  4B4M A;  2XWM A;  1OQM B;  3D8V A;  2DPW A;  2WEE A;  3T7M A;  2BO4 A;  1ZCY A;  2XME A;  4FRM A;  1ZDF A;  5EIY A;  2RJ1 A;  3CKV A;  1H5S A;  1MC3 A;  3I0K A;  2OI6 A;  5C1G A;  1XHB A;  1YP3 A;  2V0H A;  3USQ A;  5CMJ A;  1H5S D;  1TW5 A;  5BXC A;  3U2V A;  3I0D A;  3OH1 A;  3PKP A;  1ZDG A;  1VZX A;  2RJ6 A;  2O1F A;  1WT1 A;  3SX5 A;  1VH1 A;  3ZGF A;  2RIX A;  4B5B A;  2VXL A;  2Y7A A;  3SXC A;  4KNX A;  4FRH A;  5CQM X;  4Q7C A;  1H5R B;  2FYA A;  2W0W A;  3SX3 A;  5EJ1 A;  5I1F A;  2X65 A;  2VSH A;  3JTJ A;  3CGX A;  3IOJ A;  4YS8 A;  2D0J A;  5C47 A;  5FV9 A;  1ZJ0 A;  2VFZ A;  2ZU9 A;  2FYB A;  1TVY A;  4EE3 A;  3SXD A;  5J49 A;  2PGV A;  2ICX A;  4LW3 A;  3Q7U A;  4ASY A;  1H5T B;  3PNN A;  1GX0 A;  1LZI A;  3IOI A;  3DJ4 A;  2VS4 A;  3OH3 A;  2OEF A;  4HO8 A;  1INI A;  4NAI A;  4HO2 A;  3USR A;  1IIM A;  1H3M A;  1TZF A;  1O7Q A;  1VZT A;  4JD0 A;  5FYE A;  2VXM A;  3I0L A;  2O1H A;  3CKQ A;  5C49 A;  4FRL A;  1NHE B;  4FRE A;  5L6S A;  3RMV A;  4NAN A;  5CQP A;  4EEM A;  2J0B A;  2V0L A;  3HL3 A;  2RJ0 A;  3I0F A;  5AJN A;  4Y7U A;  1R81 A;  2JCO A;  5C38 A;  1HM9 A;  2A8U A;  3I0C A;  1LZJ A;  5C48 A;  1EYR A;  4HO5 A;  1WT3 A;  1KWS A;  1ZJ3 A;  1FG5 N;  4KQL A;  3T7O A;  5AJO A;  2FY7 A;  1JVD A;  2AEC A;  4AC3 A;  3U2W A;  2XMH A;  1W77 A;  4KC4 A;  2RJ9 A;  3I0J A;  3OGZ A;  3R3I A;  2I7B A;  1G0R A;  1VM8 A;  3I0I X;  4CJB A;  1LL2 A;  1ON8 A;  2QKX A;  2V0J A;  2GGO A;  1FXJ A;  4JIS A;  4L41 C;  2VS5 A;  3KIA A;  2C0N A;  3V0L A;  1H7F A;  1LL0 A;  1G1L A;  4B3U A;  3U2T A;  3SX8 A;  4BMA A;  4AYL A;  1YP4 A;  3O3P A;  5CMF X;  4G3Q A;  2AM4 A;  2AM3 A;  2D7I A;  4M28 A;  1S4N A;  3V91 A;  4CJ8 A;  1H4C A;  1H7L A;  4B4B A;  3DUV A;  4D48 A;  1O23 B;  1ZHJ A;  1ZJ2 A;  2E3D A;  2YC5 A;  4BQH A;  1H7Q A;  4MIX A;  3TQD A;  5IDT A;  2YQJ A;  4ASJ A;  5L6V A;  4CJC A;  2Y4L A;  2A8W A;  1ZJ1 A;  2WE9 A;  3ZLL A;  5C3B A;  1H7G A;  1VGU A;  1OMX A;  1MP4 A;  2I5K A;  3E26 A;  3ST8 A;  4FQW A;  2JCJ A;  2AH9 A;  1ZIZ A;  1SS9 A;  4UEG A;  2RIZ A;  1H4D A;  1H7E A;  1FR8 A;  4O6M A;  2VK9 A;  5C1H A;  4IRQ A;  3U0Y A;  5C4C A;  1FO9 A;  2PX7 A;  4P02 A;  1ZCV A;  4HG6 A;  3SXB A;  5CMG X;  1ZI1 A;  4KRV A;  2P73 A;  4D11 C;  1R7T A;  5CQL X;  3SXG A;  1OMZ A;  3U2X A;  4K6R A;  1EZI A;  4EE4 A;  1O7O A;  1H7H A;  3DK5 A;  4AYJ A;  5IFY A;  1E5K A;  4Y9X A;  1NKH B;  5DDV A;  2Y4K A;  3K8D A;  4B42 A;  1FXO A;  4NAL A;  3V8Z A;  1S4P A;  1ON6 A;  1ZJP A;  3V0P A;  1FOA A;  2J0A A;  1O0R A;  4ECM A;  1YP2 A;  2YQC A;  5C1L A;  3FWW A;  2RJ7 A;  1INJ A;  2E8B A;  3CKJ A;  1JVG A;  3OH2 A;  2Q4J A;  2YES A;  2RJ8 A;  4R7P A;  1R7Y A;  1V82 A;  4IRP A;  3NGW A;  4D11 A;  1FWY A;  1FR9 A;  1W57 A;  5D92 A;  3EE5 A;  2APC A;  3JUK A;  5HS2 A;  5EJZ A;  4HCQ A;  1G8O A;  1HJJ A;  2WVM A;  5DDT A;  1ZI5 A;  1H7T A;  4ZDQ A;  1G93 A;  3BCV A;  4FCE A;  4Y7V A;  2RJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...