4EEAA

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-gal-beta1,4-glc-beta
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4eeaA00
3QVBA 1E5KA 5FV9A 1VICA 2XMHA 1JV1A 1ZJ1A 1WVCA 3DUVA 3Q80A 4Y7TA 1WT1A 4ASYA 4M28A 1ZJ2A 1H5TB 1H7EA 3OGZA 1QGQA 1ON6A 1R81A 3CU0A 2RJ4A 1HJLA 2O1GA 1HV9A 4IRPA 2FYBA 1ZI5A 3F1YA 3SXDA 1R7VA 2RJ1A 4HO6A 1O7QA 1ZIZA 4EEMA 4B4BA 1S4NA 5C1LA 5C36A 5J49A 4B4MA 2CU2A 3TZTA 2VS4A 3SXBA 5EIYA 3T7MA 2JCLA 3Q7UA 4G3SA 4KPXA 1ZJPA 4HO0A 1NF5B 4FRPA 1FRWA 3KIAA 4JISA 4BMAA 2Q4JA 4G87A 3V0OA 1GQ9A 3U2TA 3V0QA 1OMXA 1ZI3A 1PZYB 3U0YA 5CMJA 2VXLA 2YESA 4HOCA 5FU0A 1FR9A 2V0HA 2Y6PA 4HG6A 1H5RB 4KNXA 2VFZA 2E3DA 1IINA 2E8BA 4MNDA 3NGWA 1MC3A 1HM8A 1G1LA 1JVDA 2Y4LA 1VGTA 4FCEA 1GX4A 4KPZA 3OH3A 4FRMA 2RJ6A 3IOHA 4HO8A 3POLA 4M4KA 4D11A 3USRA 1VGWA 1NMMB 5C8RA 2AM3A 4M2AA 1V82A 4Y7FA 2AM5A 3TQDA 5C4EA 2WAWA 2WE9A 4HO2A 2XWNA 1H5RA 2D7IA 1MP5A 3OH0A 5C4CA 3I0GA 1V84A 2FY7A 2Z87A 2QKXA 4JD0A 5AJPA 2ZU9A 1FWYA 1QGSA 3I0FA 3T7NA 3V90A 4KT7A 1INIA 1FO8A 2I5EA 4B5BA 1ZCYA 3CKQA 2YC3A 1WSZA 3ZLLA 4LW3A 3JUKA 4DE7A 3DK5A 3E25A 2O1FA 5JQQA 2RJ9A 1FG5N 3JUJA 4XWIA 5L6VA 1R80A 4BQHA 3F1CA 1O23B 5BXCA 1H5SC 1HM9A 3I0IX 5C49A 1ZJ0A 2Z86A 4UEGA 1VGZA 4FROA 4M2BA 1VZUA 3K8DA 3V0NA 1ZCVA 3I0EA 4P02A 3D5NA 3SPTA 1TW5A 1ZI4A 2OEGA 3OH4A 1LL2A 2RIXA 3FOQA 3I0LA 3PNNA 4Y9XA 3SX3A 5CQLX 1YP3A 4Y6UA 5C1HA 2V0LA 2FYDB 4Y6NA 3V0MA 2PGYA 3OH2A 4MYBA 5AJNA 1YP2A 3FWWA 2X65A 1G93A 4ZDQA 1XZ6A 4Y64A 4HO3A 1W77A 4B3UA 3T7OA 3N9WA 4K6RA 1KWSA 4P00A 5CMIA 3CKNA 1GWVA 2YQJA 1ZJ3A 4L41C 1JV3A 2WVKA 4FCUA 4HO5A 1MP3A 3ZGGA 1ZCTA 2YQCA 5CMGX 4EEGA 4D0ZA 1ZHJA 4KC2A 4B2XA 4NAKA 1R82A 5C3DA 5CQOA 1R7YA 2AE7A 2A8WA 4J18A 5C48A 4FRAA 1ZI1A 3PKPA 2VS5A 4NALA 4CJBA 3BRKX 2JCJA 5FYEA 4YS8A 3ST8A 2RJ5A 1TW1A 2WVMA 2X60A 5IDTA 1FO9A 2JCKA 3D98A 2PA4A 5C4BA 1TZFA 2YCMA 1JYLA 3DJ4A 5CQPA 4IRQA 2VSHA 1FXOA 1G2VA 1QG8A 1TVYA 3I0HA 3SXAA 1G3LA 3U2XA 4FRDA 4AYLA 1O7OA 4ASJA 2OI5A 4D48A 4FRQA 3OC9A 1GQCA 2BO6A 3V8ZA 5EJ1A 4EE3A 1H4CA 3BCVA 1W57A 2NXVA 2P72A 1I52A 1NKHB 2VD4A 5HS2A 4HCQA 4EE4A 1H7FA 1WT2A 5AJOA 3RSBA 2ZU7A 1K4VA 2I5KA 3V8YA 1H7GA 1W55A 2VXMA 1R7UA 3ZLKA 1LZ0A 1G0RA 2D0JA 3OH1A 3Q4SA 2GGQA 5I1FA 4Y63A 2BO4A 4Y7GA 1OQMB 2APCA 1WT0A 2XMEA 1NHEB 2RIYA 1PZTA 4B42A 3USQA 2RIZA 4FRHA 5FU8A 4EE5A 4FRBA 3U2WA 1H5SA 3ZF8A 5CMHA 1QWJA 2XWMA 1Z90A 4DDZA 1FGGA 3PKQA 2X5ZA 3SXEA 2WGZA 2AGDA 1S4OA 4KXOA 5C4DA 2O1HA 2RITA 3SX5A 5C3BA 1NQIB 1G97A 1H7HA 3O3PA 4D0TA 2V0JA 4FQWA 2QH5A 1HJJA 4C2SA 1ON8A 3CKJA 1FXJA 1H4EA 2RJ0A 2YQSA 2VS3A 3IOJA 2V0KA 1LZIA 3D8VA 4NAIA 1VGUA 1EZIA 2MZBA 5FTSA 2AM4A 1ZDFA 1H5SD 3HL3A 2QGIA 3CGXA 3SX7A 1H4DA 1G9RA 2W0WA 4KC1A 2FFVA 2YQHA 2GGOA 4Y7UA 1FZWA 1MP4A 1VH3A 2OI6A 1VZXA 2DPWA 2Y4KA 4Y62A 2VSIA 3RMWA 1YP4A 1V83A 3I0CA 2WVLA 2FFUA 1VZTA 2P6WA 1R7TA 5C47A 2Y4MA 3U0XA 4LW6A 1O0RA 2OEFA 2Y4JA 4B2WA 5FTVA 5IDSA 3GUEA 4KC4A 3EE5A 1SS9A 2ICXA 3K8EA 4AC3A 1FOAA 3V91A 1H7TA 3U2UA 1OMZA 2ICYA 1LL3A 3U2VA 1H5TA 2UX8A 4KQLA 1G95A 1G23A 4EEAA 2A8UA 4NANA 2JCOA 1GWWA 1JVGA 1ZDGA 3E26A 5CQMX 2AECA 5FUHA 1R7XA 1LZJA 3SX8A 4E1KA 2RJ7A 4HO9A 1VPAA 4EVWA 2D7RA 2Y7AA 1NWGB 1LZ7A 3OAMA 1FGXA 3I0KA 3ZGFA 1VH1A 1H5SB 3I0DA 3OKRA 1GX0A 3V0LA 4CJCA 5IFYA 1IIMA 2AH9A 5C3AA 2OI7A 4G3QA 4D11C 4KRVA 4GBPA 4AYJA 1G8OA 2P73A 1EYRA 4FREA 2PX7A 2X5SA 4AAWA 1WT3A 5EJZA 3I0JA 2BO8A 4R7PA 1JYKA 1ZJOA 1GA8A 2AESA 2FYAA 1ZCUA 4ARWA 3CKVA 3R3IA 5DDVA 3IOIA 4Y7VA 4G3PA 4DECA 5C4FA 4KNRA 1HM0A 2XWLA 2V0IA 5CMFX 2ZU8A 4B4GA 4HO4A 5C1GA 1INJA 1FR8A 4ECMA 3V0PA 2FYCB 5DDTA 5C38A 1VM8A 2PGVA 3JTJA 4EEOA 4CJ8A 1H7LA 4FRLA 5CQNX 1LL0A 5L6SA 2I7BA 3CKOA 2RJ8A 1XHBA 4CVHA 1LVWA 3LW6A 3R2WA 3RMVA 1H7QA 3SXCA 2WEEA 2BO7A 2W0VA 1S4PA 2YC5A 3SXGA 1H3MA 1YROB
chains in the Genus database with same CATH superfamily
3QVBA 1E5KA 5FV9A 1VICA 2XMHA 1JV1A 1ZJ1A 1WVCA 4O6MA 3DUVA 3Q80A 4Y7TA 1WT1A 4ASYA 4M28A 1ZJ2A 1H5TB 1H7EA 3OGZA 1QGQA 1ON6A 1R81A 3CU0A 2RJ4A 1HJLA 4FIXA 2O1GA 1HV9A 4IRPA 2FYBA 1ZI5A 3F1YA 3SXDA 1R7VA 2RJ1A 4HO6A 1O7QA 1ZIZA 4EEMA 4B4BA 1S4NA 5C1LA 5C36A 5J49A 4B4MA 2CU2A 2J0BA 3TZTA 2VS4A 3SXBA 5EIYA 3T7MA 2JCLA 3Q7UA 4G3SA 4KPXA 1ZJPA 4HO0A 1NF5B 4FRPA 1FRWA 3KIAA 4JISA 4BMAA 2Q4JA 4G87A 3V0OA 1GQ9A 3U2TA 3V0QA 1OMXA 1ZI3A 1PZYB 3U0YA 5CMJA 2VXLA 2YESA 4HOCA 5FU0A 1FR9A 2V0HA 2Y6PA 4HG6A 1H5RB 4KNXA 2VFZA 2E3DA 1IINA 2E8BA 4MNDA 3NGWA 1MC3A 1HM8A 1G1LA 1JVDA 2Y4LA 1VGTA 4FCEA 1GX4A 4KPZA 3OH3A 4FRMA 2J0AA 2RJ6A 3IOHA 4HO8A 3POLA 4M4KA 4D11A 3USRA 1VGWA 1NMMB 5C8RA 2AM3A 4M2AA 1V82A 4Y7FA 2AM5A 4FIYA 3TQDA 5C4EA 2WAWA 2WE9A 4HO2A 2XWNA 1H5RA 2D7IA 1MP5A 3OH0A 5C4CA 4Q7CA 3I0GA 1V84A 2FY7A 2Z87A 4O6NA 2QKXA 4JD0A 5AJPA 2ZU9A 1FWYA 1QGSA 3I0FA 3T7NA 3V90A 4KT7A 1INIA 1FO8A 2I5EA 4B5BA 5D91A 1ZCYA 3CKQA 2YC3A 1WSZA 3ZLLA 4LW3A 3JUKA 4DE7A 3DK5A 3E25A 2O1FA 5JQQA 2RJ9A 1FG5N 3JUJA 4XWIA 5L6VA 1R80A 4BQHA 3F1CA 1O23B 5BXCA 1H5SC 1HM9A 3I0IX 5C49A 1ZJ0A 2Z86A 4UEGA 1VGZA 4FROA 4M2BA 1VZUA 3K8DA 3V0NA 1ZCVA 3I0EA 4MIXA 4P02A 3D5NA 3SPTA 1TW5A 1ZI4A 2OEGA 3OH4A 1LL2A 2RIXA 3FOQA 3I0LA 3PNNA 4Y9XA 3SX3A 5CQLX 1YP3A 4Y6UA 2C0NA 5C1HA 2V0LA 2FYDB 4Y6NA 3V0MA 2PGYA 3OH2A 4MYBA 5AJNA 1YP2A 3FWWA 2X65A 1G93A 4ZDQA 1XZ6A 4Y64A 4HO3A 1W77A 4B3UA 3T7OA 3N9WA 4K6RA 1KWSA 4P00A 5CMIA 3CKNA 1GWVA 2YQJA 1ZJ3A 4L41C 1JV3A 2WVKA 4FCUA 4HO5A 1MP3A 3ZGGA 1ZCTA 2YQCA 5CMGX 4EEGA 4D0ZA 1ZHJA 4KC2A 4B2XA 4NAKA 1R82A 5C3DA 5CQOA 1R7YA 2AE7A 2A8WA 4J18A 5C48A 4FRAA 1ZI1A 3PKPA 2VS5A 4NALA 4CJBA 3BRKX 2JCJA 5FYEA 4YS8A 3ST8A 2RJ5A 1TW1A 2WVMA 2X60A 5IDTA 1FO9A 2JCKA 3D98A 2PA4A 5C4BA 1TZFA 2YCMA 5D92A 1JYLA 3DJ4A 5CQPA 4IRQA 2VSHA 1FXOA 1G2VA 1QG8A 1TVYA 3I0HA 3SXAA 1G3LA 3U2XA 4FRDA 4AYLA 1O7OA 4ASJA 2OI5A 2VK9A 4D48A 4FRQA 3OC9A 1GQCA 2BO6A 3V8ZA 5EJ1A 4EE3A 1H4CA 3BCVA 1W57A 2NXVA 2P72A 1I52A 1NKHB 2VD4A 5HS2A 4HCQA 4EE4A 1H7FA 1WT2A 5AJOA 3RSBA 2ZU7A 1K4VA 2I5KA 3V8YA 1H7GA 1W55A 2VXMA 1R7UA 3ZLKA 1LZ0A 1G0RA 2D0JA 3OH1A 3Q4SA 2GGQA 5I1FA 4Y63A 2BO4A 4Y7GA 1OQMB 2APCA 1WT0A 2XMEA 1NHEB 2RIYA 1PZTA 4B42A 3USQA 2RIZA 4FRHA 5FU8A 4EE5A 4FRBA 3U2WA 1H5SA 3ZF8A 5CMHA 1QWJA 2XWMA 1Z90A 4DDZA 1FGGA 3PKQA 2X5ZA 3SXEA 2WGZA 2AGDA 1S4OA 4KXOA 5C4DA 2O1HA 2RITA 3SX5A 5C3BA 1NQIB 1G97A 1H7HA 3O3PA 4D0TA 2V0JA 4FQWA 2QH5A 1HJJA 4C2SA 1ON8A 3CKJA 1FXJA 1H4EA 2RJ0A 2YQSA 2VS3A 3IOJA 2V0KA 1LZIA 3D8VA 4NAIA 1VGUA 1EZIA 2MZBA 5FTSA 2AM4A 1ZDFA 1H5SD 3HL3A 2QGIA 3CGXA 3SX7A 1H4DA 1G9RA 2W0WA 4KC1A 2FFVA 2YQHA 2GGOA 4Y7UA 1FZWA 1MP4A 1VH3A 2OI6A 1VZXA 2DPWA 2Y4KA 4Y62A 2VSIA 3RMWA 1YP4A 1V83A 3I0CA 2WVLA 2FFUA 1VZTA 2P6WA 1R7TA 5C47A 2Y4MA 3U0XA 4LW6A 1O0RA 2OEFA 2Y4JA 4B2WA 5FTVA 5IDSA 3GUEA 4KC4A 3EE5A 1SS9A 2ICXA 3K8EA 4AC3A 1FOAA 3V91A 1H7TA 3U2UA 1OMZA 2ICYA 1LL3A 3U2VA 1H5TA 2UX8A 4KQLA 1G95A 1G23A 4EEAA 2A8UA 4NANA 2JCOA 1GWWA 1JVGA 1ZDGA 3E26A 5CQMX 2AECA 5FUHA 1R7XA 1LZJA 3SX8A 4E1KA 2RJ7A 4HO9A 1VPAA 4EVWA 2D7RA 2Y7AA 1NWGB 1LZ7A 3OAMA 1FGXA 3I0KA 3ZGFA 1VH1A 1H5SB 3I0DA 3OKRA 1GX0A 3V0LA 4CJCA 5IFYA 1IIMA 2AH9A 5C3AA 2OI7A 4G3QA 4D11C 4KRVA 4GBPA 4AYJA 1G8OA 2P73A 1EYRA 4FREA 2PX7A 2X5SA 4AAWA 1WT3A 5EJZA 3I0JA 2BO8A 4R7PA 1JYKA 1ZJOA 1GA8A 2AESA 2FYAA 1ZCUA 4ARWA 3CKVA 3R3IA 5DDVA 3IOIA 4Y7VA 4G3PA 4DECA 5C4FA 4KNRA 1HM0A 2XWLA 2V0IA 5CMFX 2ZU8A 4B4GA 4HO4A 5C1GA 1INJA 1FR8A 4ECMA 3V0PA 2FYCB 5DDTA 5C38A 1VM8A 2PGVA 3JTJA 4EEOA 4CJ8A 1H7LA 4FRLA 5CQNX 1LL0A 5L6SA 2I7BA 3CKOA 2RJ8A 1XHBA 4CVHA 1LVWA 3LW6A 3R2WA 3RMVA 1H7QA 3SXCA 2WEEA 2BO7A 2W0VA 1S4PA 2YC5A 3SXGA 1H3MA 1YROB
chains in the Genus database with same CATH topology
3QVBA 1E5KA 5FV9A 1VICA 2XMHA 1JV1A 1ZJ1A 1WVCA 4O6MA 3DUVA 3Q80A 4Y7TA 1WT1A 4ASYA 4M28A 1ZJ2A 1H5TB 1H7EA 3OGZA 1QGQA 1ON6A 1R81A 3CU0A 2RJ4A 1HJLA 4FIXA 2O1GA 1HV9A 4IRPA 2FYBA 1ZI5A 3F1YA 3SXDA 1R7VA 2RJ1A 4HO6A 1O7QA 1ZIZA 4EEMA 4B4BA 1S4NA 5C1LA 5C36A 5J49A 4B4MA 2CU2A 2J0BA 3TZTA 2VS4A 3SXBA 5EIYA 3T7MA 2JCLA 3Q7UA 4G3SA 4KPXA 1ZJPA 4HO0A 1NF5B 4FRPA 1FRWA 3KIAA 4JISA 4BMAA 2Q4JA 4G87A 3V0OA 1GQ9A 3U2TA 3V0QA 1OMXA 1ZI3A 1PZYB 3U0YA 5CMJA 2VXLA 2YESA 4HOCA 5FU0A 1FR9A 2V0HA 2Y6PA 4HG6A 1H5RB 4KNXA 2VFZA 2E3DA 1IINA 2E8BA 4MNDA 3NGWA 1MC3A 1HM8A 1G1LA 1JVDA 2Y4LA 1VGTA 4FCEA 1GX4A 4KPZA 3OH3A 4FRMA 2J0AA 2RJ6A 3IOHA 4HO8A 3POLA 4M4KA 4D11A 3USRA 1VGWA 1NMMB 5C8RA 2AM3A 4M2AA 1V82A 4Y7FA 2AM5A 4FIYA 3TQDA 5C4EA 2WAWA 2WE9A 4HO2A 2XWNA 1H5RA 2D7IA 1MP5A 3OH0A 5C4CA 4Q7CA 3I0GA 1V84A 2FY7A 2Z87A 4O6NA 2QKXA 4JD0A 5AJPA 2ZU9A 1FWYA 1QGSA 3I0FA 3T7NA 3V90A 4KT7A 1INIA 1FO8A 2I5EA 4B5BA 5D91A 1ZCYA 3CKQA 2YC3A 1WSZA 3ZLLA 4LW3A 3JUKA 4DE7A 3DK5A 3E25A 2O1FA 5JQQA 2RJ9A 1FG5N 3JUJA 4XWIA 5L6VA 1R80A 4BQHA 3F1CA 1O23B 5BXCA 1H5SC 1HM9A 3I0IX 5C49A 1ZJ0A 2Z86A 4UEGA 1VGZA 4FROA 4M2BA 1VZUA 3K8DA 3V0NA 1ZCVA 3I0EA 4MIXA 4P02A 3D5NA 3SPTA 1TW5A 1ZI4A 2OEGA 3OH4A 1LL2A 2RIXA 3FOQA 3I0LA 3PNNA 4Y9XA 3SX3A 5CQLX 1YP3A 4Y6UA 2C0NA 5C1HA 2V0LA 2FYDB 4Y6NA 3V0MA 2PGYA 3OH2A 4MYBA 5AJNA 1YP2A 3FWWA 2X65A 1G93A 4ZDQA 1XZ6A 4Y64A 4HO3A 1W77A 4B3UA 3T7OA 3N9WA 4K6RA 1KWSA 4P00A 5CMIA 3CKNA 1GWVA 2YQJA 1ZJ3A 4L41C 1JV3A 2WVKA 4FCUA 4HO5A 1MP3A 3ZGGA 1ZCTA 2YQCA 5CMGX 4EEGA 4D0ZA 1ZHJA 4KC2A 4B2XA 4NAKA 1R82A 5C3DA 5CQOA 1R7YA 2AE7A 2A8WA 4J18A 5C48A 4FRAA 1ZI1A 3PKPA 2VS5A 4NALA 4CJBA 3BRKX 2JCJA 5FYEA 4YS8A 3ST8A 2RJ5A 1TW1A 2WVMA 2X60A 5IDTA 1FO9A 2JCKA 3D98A 2PA4A 5C4BA 1TZFA 2YCMA 5D92A 1JYLA 3DJ4A 5CQPA 4IRQA 2VSHA 1FXOA 1G2VA 1QG8A 1TVYA 3I0HA 3SXAA 1G3LA 3U2XA 4FRDA 4AYLA 1O7OA 4ASJA 2OI5A 2VK9A 4D48A 4FRQA 3OC9A 1GQCA 2BO6A 3V8ZA 5EJ1A 4EE3A 1H4CA 3BCVA 1W57A 2NXVA 2P72A 1I52A 1NKHB 2VD4A 5HS2A 4HCQA 4EE4A 1H7FA 1WT2A 5AJOA 3RSBA 2ZU7A 1K4VA 2I5KA 3V8YA 1H7GA 1W55A 2VXMA 1R7UA 3ZLKA 1LZ0A 1G0RA 2D0JA 3OH1A 3Q4SA 2GGQA 5I1FA 4Y63A 2BO4A 4Y7GA 1OQMB 2APCA 1WT0A 2XMEA 1NHEB 2RIYA 1PZTA 4B42A 3USQA 2RIZA 4FRHA 5FU8A 4EE5A 4FRBA 3U2WA 1H5SA 3ZF8A 5CMHA 1QWJA 2XWMA 1Z90A 4DDZA 1FGGA 3PKQA 2X5ZA 3SXEA 2WGZA 2AGDA 1S4OA 4KXOA 5C4DA 2O1HA 2RITA 3SX5A 5C3BA 1NQIB 1G97A 1H7HA 3O3PA 4D0TA 2V0JA 4FQWA 2QH5A 1HJJA 4C2SA 1ON8A 3CKJA 1FXJA 1H4EA 2RJ0A 2YQSA 2VS3A 3IOJA 2V0KA 1LZIA 3D8VA 4NAIA 1VGUA 1EZIA 2MZBA 5FTSA 2AM4A 1ZDFA 1H5SD 3HL3A 2QGIA 3CGXA 3SX7A 1H4DA 1G9RA 2W0WA 4KC1A 2FFVA 2YQHA 2GGOA 4Y7UA 1FZWA 1MP4A 1VH3A 2OI6A 1VZXA 2DPWA 2Y4KA 4Y62A 2VSIA 3RMWA 1YP4A 1V83A 3I0CA 2WVLA 2FFUA 1VZTA 2P6WA 1R7TA 5C47A 2Y4MA 3U0XA 4LW6A 1O0RA 2OEFA 2Y4JA 4B2WA 5FTVA 5IDSA 3GUEA 4KC4A 3EE5A 1SS9A 2ICXA 3K8EA 4AC3A 1FOAA 3V91A 1H7TA 3U2UA 1OMZA 2ICYA 1LL3A 3U2VA 1H5TA 2UX8A 4KQLA 1G95A 1G23A 4EEAA 2A8UA 4NANA 2JCOA 1GWWA 1JVGA 1ZDGA 3E26A 5CQMX 2AECA 5FUHA 1R7XA 1LZJA 3SX8A 4E1KA 2RJ7A 4HO9A 1VPAA 4EVWA 2D7RA 2Y7AA 1NWGB 1LZ7A 3OAMA 1FGXA 3I0KA 3ZGFA 1VH1A 1H5SB 3I0DA 3OKRA 1GX0A 3V0LA 4CJCA 5IFYA 1IIMA 2AH9A 5C3AA 2OI7A 4G3QA 4D11C 4KRVA 4GBPA 4AYJA 1G8OA 2P73A 1EYRA 4FREA 2PX7A 2X5SA 4AAWA 1WT3A 5EJZA 3I0JA 2BO8A 4R7PA 1JYKA 1ZJOA 1GA8A 2AESA 2FYAA 1ZCUA 4ARWA 3CKVA 3R3IA 5DDVA 3IOIA 4Y7VA 4G3PA 4DECA 5C4FA 4KNRA 1HM0A 2XWLA 2V0IA 5CMFX 2ZU8A 4B4GA 4HO4A 5C1GA 1INJA 1FR8A 4ECMA 3V0PA 2FYCB 5DDTA 5C38A 1VM8A 2PGVA 3JTJA 4EEOA 4CJ8A 1H7LA 4FRLA 5CQNX 1LL0A 5L6SA 2I7BA 3CKOA 2RJ8A 1XHBA 4CVHA 1LVWA 3LW6A 3R2WA 3RMVA 1H7QA 3SXCA 2WEEA 2BO7A 2W0VA 1S4PA 2YC5A 3SXGA 1H3MA 1YROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVB A;  1E5K A;  5FV9 A;  1VIC A;  2XMH A;  1JV1 A;  1ZJ1 A;  1WVC A;  3DUV A;  3Q80 A;  4Y7T A;  1WT1 A;  4ASY A;  4M28 A;  1ZJ2 A;  1H5T B;  1H7E A;  3OGZ A;  1QGQ A;  1ON6 A;  1R81 A;  3CU0 A;  2RJ4 A;  1HJL A;  2O1G A;  1HV9 A;  4IRP A;  2FYB A;  1ZI5 A;  3F1Y A;  3SXD A;  1R7V A;  2RJ1 A;  4HO6 A;  1O7Q A;  1ZIZ A;  4EEM A;  4B4B A;  1S4N A;  5C1L A;  5C36 A;  5J49 A;  4B4M A;  2CU2 A;  3TZT A;  2VS4 A;  3SXB A;  5EIY A;  3T7M A;  2JCL A;  3Q7U A;  4G3S A;  4KPX A;  1ZJP A;  4HO0 A;  1NF5 B;  4FRP A;  1FRW A;  3KIA A;  4JIS A;  4BMA A;  2Q4J A;  4G87 A;  3V0O A;  1GQ9 A;  3U2T A;  3V0Q A;  1OMX A;  1ZI3 A;  1PZY B;  3U0Y A;  5CMJ A;  2VXL A;  2YES A;  4HOC A;  5FU0 A;  1FR9 A;  2V0H A;  2Y6P A;  4HG6 A;  1H5R B;  4KNX A;  2VFZ A;  2E3D A;  1IIN A;  2E8B A;  4MND A;  3NGW A;  1MC3 A;  1HM8 A;  1G1L A;  1JVD A;  2Y4L A;  1VGT A;  4FCE A;  1GX4 A;  4KPZ A;  3OH3 A;  4FRM A;  2RJ6 A;  3IOH A;  4HO8 A;  3POL A;  4M4K A;  4D11 A;  3USR A;  1VGW A;  1NMM B;  5C8R A;  2AM3 A;  4M2A A;  1V82 A;  4Y7F A;  2AM5 A;  3TQD A;  5C4E A;  2WAW A;  2WE9 A;  4HO2 A;  2XWN A;  1H5R A;  2D7I A;  1MP5 A;  3OH0 A;  5C4C A;  3I0G A;  1V84 A;  2FY7 A;  2Z87 A;  2QKX A;  4JD0 A;  5AJP A;  2ZU9 A;  1FWY A;  1QGS A;  3I0F A;  3T7N A;  3V90 A;  4KT7 A;  1INI A;  1FO8 A;  2I5E A;  4B5B A;  1ZCY A;  3CKQ A;  2YC3 A;  1WSZ A;  3ZLL A;  4LW3 A;  3JUK A;  4DE7 A;  3DK5 A;  3E25 A;  2O1F A;  5JQQ A;  2RJ9 A;  1FG5 N;  3JUJ A;  4XWI A;  5L6V A;  1R80 A;  4BQH A;  3F1C A;  1O23 B;  5BXC A;  1H5S C;  1HM9 A;  3I0I X;  5C49 A;  1ZJ0 A;  2Z86 A;  4UEG A;  1VGZ A;  4FRO A;  4M2B A;  1VZU A;  3K8D A;  3V0N A;  1ZCV A;  3I0E A;  4P02 A;  3D5N A;  3SPT A;  1TW5 A;  1ZI4 A;  2OEG A;  3OH4 A;  1LL2 A;  2RIX A;  3FOQ A;  3I0L A;  3PNN A;  4Y9X A;  3SX3 A;  5CQL X;  1YP3 A;  4Y6U A;  5C1H A;  2V0L A;  2FYD B;  4Y6N A;  3V0M A;  2PGY A;  3OH2 A;  4MYB A;  5AJN A;  1YP2 A;  3FWW A;  2X65 A;  1G93 A;  4ZDQ A;  1XZ6 A;  4Y64 A;  4HO3 A;  1W77 A;  4B3U A;  3T7O A;  3N9W A;  4K6R A;  1KWS A;  4P00 A;  5CMI A;  3CKN A;  1GWV A;  2YQJ A;  1ZJ3 A;  4L41 C;  1JV3 A;  2WVK A;  4FCU A;  4HO5 A;  1MP3 A;  3ZGG A;  1ZCT A;  2YQC A;  5CMG X;  4EEG A;  4D0Z A;  1ZHJ A;  4KC2 A;  4B2X A;  4NAK A;  1R82 A;  5C3D A;  5CQO A;  1R7Y A;  2AE7 A;  2A8W A;  4J18 A;  5C48 A;  4FRA A;  1ZI1 A;  3PKP A;  2VS5 A;  4NAL A;  4CJB A;  3BRK X;  2JCJ A;  5FYE A;  4YS8 A;  3ST8 A;  2RJ5 A;  1TW1 A;  2WVM A;  2X60 A;  5IDT A;  1FO9 A;  2JCK A;  3D98 A;  2PA4 A;  5C4B A;  1TZF A;  2YCM A;  1JYL A;  3DJ4 A;  5CQP A;  4IRQ A;  2VSH A;  1FXO A;  1G2V A;  1QG8 A;  1TVY A;  3I0H A;  3SXA A;  1G3L A;  3U2X A;  4FRD A;  4AYL A;  1O7O A;  4ASJ A;  2OI5 A;  4D48 A;  4FRQ A;  3OC9 A;  1GQC A;  2BO6 A;  3V8Z A;  5EJ1 A;  4EE3 A;  1H4C A;  3BCV A;  1W57 A;  2NXV A;  2P72 A;  1I52 A;  1NKH B;  2VD4 A;  5HS2 A;  4HCQ A;  4EE4 A;  1H7F A;  1WT2 A;  5AJO A;  3RSB A;  2ZU7 A;  1K4V A;  2I5K A;  3V8Y A;  1H7G A;  1W55 A;  2VXM A;  1R7U A;  3ZLK A;  1LZ0 A;  1G0R A;  2D0J A;  3OH1 A;  3Q4S A;  2GGQ A;  5I1F A;  4Y63 A;  2BO4 A;  4Y7G A;  1OQM B;  2APC A;  1WT0 A;  2XME A;  1NHE B;  2RIY A;  1PZT A;  4B42 A;  3USQ A;  2RIZ A;  4FRH A;  5FU8 A;  4EE5 A;  4FRB A;  3U2W A;  1H5S A;  3ZF8 A;  5CMH A;  1QWJ A;  2XWM A;  1Z90 A;  4DDZ A;  1FGG A;  3PKQ A;  2X5Z A;  3SXE A;  2WGZ A;  2AGD A;  1S4O A;  4KXO A;  5C4D A;  2O1H A;  2RIT A;  3SX5 A;  5C3B A;  1NQI B;  1G97 A;  1H7H A;  3O3P A;  4D0T A;  2V0J A;  4FQW A;  2QH5 A;  1HJJ A;  4C2S A;  1ON8 A;  3CKJ A;  1FXJ A;  1H4E A;  2RJ0 A;  2YQS A;  2VS3 A;  3IOJ A;  2V0K A;  1LZI A;  3D8V A;  4NAI A;  1VGU A;  1EZI A;  2MZB A;  5FTS A;  2AM4 A;  1ZDF A;  1H5S D;  3HL3 A;  2QGI A;  3CGX A;  3SX7 A;  1H4D A;  1G9R A;  2W0W A;  4KC1 A;  2FFV A;  2YQH A;  2GGO A;  4Y7U A;  1FZW A;  1MP4 A;  1VH3 A;  2OI6 A;  1VZX A;  2DPW A;  2Y4K A;  4Y62 A;  2VSI A;  3RMW A;  1YP4 A;  1V83 A;  3I0C A;  2WVL A;  2FFU A;  1VZT A;  2P6W A;  1R7T A;  5C47 A;  2Y4M A;  3U0X A;  4LW6 A;  1O0R A;  2OEF A;  2Y4J A;  4B2W A;  5FTV A;  5IDS A;  3GUE A;  4KC4 A;  3EE5 A;  1SS9 A;  2ICX A;  3K8E A;  4AC3 A;  1FOA A;  3V91 A;  1H7T A;  3U2U A;  1OMZ A;  2ICY A;  1LL3 A;  3U2V A;  1H5T A;  2UX8 A;  4KQL A;  1G95 A;  1G23 A;  4EEA A;  2A8U A;  4NAN A;  2JCO A;  1GWW A;  1JVG A;  1ZDG A;  3E26 A;  5CQM X;  2AEC A;  5FUH A;  1R7X A;  1LZJ A;  3SX8 A;  4E1K A;  2RJ7 A;  4HO9 A;  1VPA A;  4EVW A;  2D7R A;  2Y7A A;  1NWG B;  1LZ7 A;  3OAM A;  1FGX A;  3I0K A;  3ZGF A;  1VH1 A;  1H5S B;  3I0D A;  3OKR A;  1GX0 A;  3V0L A;  4CJC A;  5IFY A;  1IIM A;  2AH9 A;  5C3A A;  2OI7 A;  4G3Q A;  4D11 C;  4KRV A;  4GBP A;  4AYJ A;  1G8O A;  2P73 A;  1EYR A;  4FRE A;  2PX7 A;  2X5S A;  4AAW A;  1WT3 A;  5EJZ A;  3I0J A;  2BO8 A;  4R7P A;  1JYK A;  1ZJO A;  1GA8 A;  2AES A;  2FYA A;  1ZCU A;  4ARW A;  3CKV A;  3R3I A;  5DDV A;  3IOI A;  4Y7V A;  4G3P A;  4DEC A;  5C4F A;  4KNR A;  1HM0 A;  2XWL A;  2V0I A;  5CMF X;  2ZU8 A;  4B4G A;  4HO4 A;  5C1G A;  1INJ A;  1FR8 A;  4ECM A;  3V0P A;  2FYC B;  5DDT A;  5C38 A;  1VM8 A;  2PGV A;  3JTJ A;  4EEO A;  4CJ8 A;  1H7L A;  4FRL A;  5CQN X;  1LL0 A;  5L6S A;  2I7B A;  3CKO A;  2RJ8 A;  1XHB A;  4CVH A;  1LVW A;  3LW6 A;  3R2W A;  3RMV A;  1H7Q A;  3SXC A;  2WEE A;  2BO7 A;  2W0V A;  1S4P A;  2YC5 A;  3SXG A;  1H3M A;  1YRO B; 
#chains in the Genus database with same CATH topology
 3QVB A;  1E5K A;  5FV9 A;  1VIC A;  2XMH A;  1JV1 A;  1ZJ1 A;  1WVC A;  4O6M A;  3DUV A;  3Q80 A;  4Y7T A;  1WT1 A;  4ASY A;  4M28 A;  1ZJ2 A;  1H5T B;  1H7E A;  3OGZ A;  1QGQ A;  1ON6 A;  1R81 A;  3CU0 A;  2RJ4 A;  1HJL A;  4FIX A;  2O1G A;  1HV9 A;  4IRP A;  2FYB A;  1ZI5 A;  3F1Y A;  3SXD A;  1R7V A;  2RJ1 A;  4HO6 A;  1O7Q A;  1ZIZ A;  4EEM A;  4B4B A;  1S4N A;  5C1L A;  5C36 A;  5J49 A;  4B4M A;  2CU2 A;  2J0B A;  3TZT A;  2VS4 A;  3SXB A;  5EIY A;  3T7M A;  2JCL A;  3Q7U A;  4G3S A;  4KPX A;  1ZJP A;  4HO0 A;  1NF5 B;  4FRP A;  1FRW A;  3KIA A;  4JIS A;  4BMA A;  2Q4J A;  4G87 A;  3V0O A;  1GQ9 A;  3U2T A;  3V0Q A;  1OMX A;  1ZI3 A;  1PZY B;  3U0Y A;  5CMJ A;  2VXL A;  2YES A;  4HOC A;  5FU0 A;  1FR9 A;  2V0H A;  2Y6P A;  4HG6 A;  1H5R B;  4KNX A;  2VFZ A;  2E3D A;  1IIN A;  2E8B A;  4MND A;  3NGW A;  1MC3 A;  1HM8 A;  1G1L A;  1JVD A;  2Y4L A;  1VGT A;  4FCE A;  1GX4 A;  4KPZ A;  3OH3 A;  4FRM A;  2J0A A;  2RJ6 A;  3IOH A;  4HO8 A;  3POL A;  4M4K A;  4D11 A;  3USR A;  1VGW A;  1NMM B;  5C8R A;  2AM3 A;  4M2A A;  1V82 A;  4Y7F A;  2AM5 A;  4FIY A;  3TQD A;  5C4E A;  2WAW A;  2WE9 A;  4HO2 A;  2XWN A;  1H5R A;  2D7I A;  1MP5 A;  3OH0 A;  5C4C A;  4Q7C A;  3I0G A;  1V84 A;  2FY7 A;  2Z87 A;  4O6N A;  2QKX A;  4JD0 A;  5AJP A;  2ZU9 A;  1FWY A;  1QGS A;  3I0F A;  3T7N A;  3V90 A;  4KT7 A;  1INI A;  1FO8 A;  2I5E A;  4B5B A;  5D91 A;  1ZCY A;  3CKQ A;  2YC3 A;  1WSZ A;  3ZLL A;  4LW3 A;  3JUK A;  4DE7 A;  3DK5 A;  3E25 A;  2O1F A;  5JQQ A;  2RJ9 A;  1FG5 N;  3JUJ A;  4XWI A;  5L6V A;  1R80 A;  4BQH A;  3F1C A;  1O23 B;  5BXC A;  1H5S C;  1HM9 A;  3I0I X;  5C49 A;  1ZJ0 A;  2Z86 A;  4UEG A;  1VGZ A;  4FRO A;  4M2B A;  1VZU A;  3K8D A;  3V0N A;  1ZCV A;  3I0E A;  4MIX A;  4P02 A;  3D5N A;  3SPT A;  1TW5 A;  1ZI4 A;  2OEG A;  3OH4 A;  1LL2 A;  2RIX A;  3FOQ A;  3I0L A;  3PNN A;  4Y9X A;  3SX3 A;  5CQL X;  1YP3 A;  4Y6U A;  2C0N A;  5C1H A;  2V0L A;  2FYD B;  4Y6N A;  3V0M A;  2PGY A;  3OH2 A;  4MYB A;  5AJN A;  1YP2 A;  3FWW A;  2X65 A;  1G93 A;  4ZDQ A;  1XZ6 A;  4Y64 A;  4HO3 A;  1W77 A;  4B3U A;  3T7O A;  3N9W A;  4K6R A;  1KWS A;  4P00 A;  5CMI A;  3CKN A;  1GWV A;  2YQJ A;  1ZJ3 A;  4L41 C;  1JV3 A;  2WVK A;  4FCU A;  4HO5 A;  1MP3 A;  3ZGG A;  1ZCT A;  2YQC A;  5CMG X;  4EEG A;  4D0Z A;  1ZHJ A;  4KC2 A;  4B2X A;  4NAK A;  1R82 A;  5C3D A;  5CQO A;  1R7Y A;  2AE7 A;  2A8W A;  4J18 A;  5C48 A;  4FRA A;  1ZI1 A;  3PKP A;  2VS5 A;  4NAL A;  4CJB A;  3BRK X;  2JCJ A;  5FYE A;  4YS8 A;  3ST8 A;  2RJ5 A;  1TW1 A;  2WVM A;  2X60 A;  5IDT A;  1FO9 A;  2JCK A;  3D98 A;  2PA4 A;  5C4B A;  1TZF A;  2YCM A;  5D92 A;  1JYL A;  3DJ4 A;  5CQP A;  4IRQ A;  2VSH A;  1FXO A;  1G2V A;  1QG8 A;  1TVY A;  3I0H A;  3SXA A;  1G3L A;  3U2X A;  4FRD A;  4AYL A;  1O7O A;  4ASJ A;  2OI5 A;  2VK9 A;  4D48 A;  4FRQ A;  3OC9 A;  1GQC A;  2BO6 A;  3V8Z A;  5EJ1 A;  4EE3 A;  1H4C A;  3BCV A;  1W57 A;  2NXV A;  2P72 A;  1I52 A;  1NKH B;  2VD4 A;  5HS2 A;  4HCQ A;  4EE4 A;  1H7F A;  1WT2 A;  5AJO A;  3RSB A;  2ZU7 A;  1K4V A;  2I5K A;  3V8Y A;  1H7G A;  1W55 A;  2VXM A;  1R7U A;  3ZLK A;  1LZ0 A;  1G0R A;  2D0J A;  3OH1 A;  3Q4S A;  2GGQ A;  5I1F A;  4Y63 A;  2BO4 A;  4Y7G A;  1OQM B;  2APC A;  1WT0 A;  2XME A;  1NHE B;  2RIY A;  1PZT A;  4B42 A;  3USQ A;  2RIZ A;  4FRH A;  5FU8 A;  4EE5 A;  4FRB A;  3U2W A;  1H5S A;  3ZF8 A;  5CMH A;  1QWJ A;  2XWM A;  1Z90 A;  4DDZ A;  1FGG A;  3PKQ A;  2X5Z A;  3SXE A;  2WGZ A;  2AGD A;  1S4O A;  4KXO A;  5C4D A;  2O1H A;  2RIT A;  3SX5 A;  5C3B A;  1NQI B;  1G97 A;  1H7H A;  3O3P A;  4D0T A;  2V0J A;  4FQW A;  2QH5 A;  1HJJ A;  4C2S A;  1ON8 A;  3CKJ A;  1FXJ A;  1H4E A;  2RJ0 A;  2YQS A;  2VS3 A;  3IOJ A;  2V0K A;  1LZI A;  3D8V A;  4NAI A;  1VGU A;  1EZI A;  2MZB A;  5FTS A;  2AM4 A;  1ZDF A;  1H5S D;  3HL3 A;  2QGI A;  3CGX A;  3SX7 A;  1H4D A;  1G9R A;  2W0W A;  4KC1 A;  2FFV A;  2YQH A;  2GGO A;  4Y7U A;  1FZW A;  1MP4 A;  1VH3 A;  2OI6 A;  1VZX A;  2DPW A;  2Y4K A;  4Y62 A;  2VSI A;  3RMW A;  1YP4 A;  1V83 A;  3I0C A;  2WVL A;  2FFU A;  1VZT A;  2P6W A;  1R7T A;  5C47 A;  2Y4M A;  3U0X A;  4LW6 A;  1O0R A;  2OEF A;  2Y4J A;  4B2W A;  5FTV A;  5IDS A;  3GUE A;  4KC4 A;  3EE5 A;  1SS9 A;  2ICX A;  3K8E A;  4AC3 A;  1FOA A;  3V91 A;  1H7T A;  3U2U A;  1OMZ A;  2ICY A;  1LL3 A;  3U2V A;  1H5T A;  2UX8 A;  4KQL A;  1G95 A;  1G23 A;  4EEA A;  2A8U A;  4NAN A;  2JCO A;  1GWW A;  1JVG A;  1ZDG A;  3E26 A;  5CQM X;  2AEC A;  5FUH A;  1R7X A;  1LZJ A;  3SX8 A;  4E1K A;  2RJ7 A;  4HO9 A;  1VPA A;  4EVW A;  2D7R A;  2Y7A A;  1NWG B;  1LZ7 A;  3OAM A;  1FGX A;  3I0K A;  3ZGF A;  1VH1 A;  1H5S B;  3I0D A;  3OKR A;  1GX0 A;  3V0L A;  4CJC A;  5IFY A;  1IIM A;  2AH9 A;  5C3A A;  2OI7 A;  4G3Q A;  4D11 C;  4KRV A;  4GBP A;  4AYJ A;  1G8O A;  2P73 A;  1EYR A;  4FRE A;  2PX7 A;  2X5S A;  4AAW A;  1WT3 A;  5EJZ A;  3I0J A;  2BO8 A;  4R7P A;  1JYK A;  1ZJO A;  1GA8 A;  2AES A;  2FYA A;  1ZCU A;  4ARW A;  3CKV A;  3R3I A;  5DDV A;  3IOI A;  4Y7V A;  4G3P A;  4DEC A;  5C4F A;  4KNR A;  1HM0 A;  2XWL A;  2V0I A;  5CMF X;  2ZU8 A;  4B4G A;  4HO4 A;  5C1G A;  1INJ A;  1FR8 A;  4ECM A;  3V0P A;  2FYC B;  5DDT A;  5C38 A;  1VM8 A;  2PGV A;  3JTJ A;  4EEO A;  4CJ8 A;  1H7L A;  4FRL A;  5CQN X;  1LL0 A;  5L6S A;  2I7B A;  3CKO A;  2RJ8 A;  1XHB A;  4CVH A;  1LVW A;  3LW6 A;  3R2W A;  3RMV A;  1H7Q A;  3SXC A;  2WEE A;  2BO7 A;  2W0V A;  1S4P A;  2YC5 A;  3SXG A;  1H3M A;  1YRO B; 
#chains in the Genus database with same CATH homology
 3QVB A;  1E5K A;  5FV9 A;  1VIC A;  2XMH A;  1JV1 A;  1ZJ1 A;  1WVC A;  4O6M A;  3DUV A;  3Q80 A;  4Y7T A;  1WT1 A;  4ASY A;  4M28 A;  1ZJ2 A;  1H5T B;  1H7E A;  3OGZ A;  1QGQ A;  1ON6 A;  1R81 A;  3CU0 A;  2RJ4 A;  1HJL A;  4FIX A;  2O1G A;  1HV9 A;  4IRP A;  2FYB A;  1ZI5 A;  3F1Y A;  3SXD A;  1R7V A;  2RJ1 A;  4HO6 A;  1O7Q A;  1ZIZ A;  4EEM A;  4B4B A;  1S4N A;  5C1L A;  5C36 A;  5J49 A;  4B4M A;  2CU2 A;  2J0B A;  3TZT A;  2VS4 A;  3SXB A;  5EIY A;  3T7M A;  2JCL A;  3Q7U A;  4G3S A;  4KPX A;  1ZJP A;  4HO0 A;  1NF5 B;  4FRP A;  1FRW A;  3KIA A;  4JIS A;  4BMA A;  2Q4J A;  4G87 A;  3V0O A;  1GQ9 A;  3U2T A;  3V0Q A;  1OMX A;  1ZI3 A;  1PZY B;  3U0Y A;  5CMJ A;  2VXL A;  2YES A;  4HOC A;  5FU0 A;  1FR9 A;  2V0H A;  2Y6P A;  4HG6 A;  1H5R B;  4KNX A;  2VFZ A;  2E3D A;  1IIN A;  2E8B A;  4MND A;  3NGW A;  1MC3 A;  1HM8 A;  1G1L A;  1JVD A;  2Y4L A;  1VGT A;  4FCE A;  1GX4 A;  4KPZ A;  3OH3 A;  4FRM A;  2J0A A;  2RJ6 A;  3IOH A;  4HO8 A;  3POL A;  4M4K A;  4D11 A;  3USR A;  1VGW A;  1NMM B;  5C8R A;  2AM3 A;  4M2A A;  1V82 A;  4Y7F A;  2AM5 A;  4FIY A;  3TQD A;  5C4E A;  2WAW A;  2WE9 A;  4HO2 A;  2XWN A;  1H5R A;  2D7I A;  1MP5 A;  3OH0 A;  5C4C A;  4Q7C A;  3I0G A;  1V84 A;  2FY7 A;  2Z87 A;  4O6N A;  2QKX A;  4JD0 A;  5AJP A;  2ZU9 A;  1FWY A;  1QGS A;  3I0F A;  3T7N A;  3V90 A;  4KT7 A;  1INI A;  1FO8 A;  2I5E A;  4B5B A;  5D91 A;  1ZCY A;  3CKQ A;  2YC3 A;  1WSZ A;  3ZLL A;  4LW3 A;  3JUK A;  4DE7 A;  3DK5 A;  3E25 A;  2O1F A;  5JQQ A;  2RJ9 A;  1FG5 N;  3JUJ A;  4XWI A;  5L6V A;  1R80 A;  4BQH A;  3F1C A;  1O23 B;  5BXC A;  1H5S C;  1HM9 A;  3I0I X;  5C49 A;  1ZJ0 A;  2Z86 A;  4UEG A;  1VGZ A;  4FRO A;  4M2B A;  1VZU A;  3K8D A;  3V0N A;  1ZCV A;  3I0E A;  4MIX A;  4P02 A;  3D5N A;  3SPT A;  1TW5 A;  1ZI4 A;  2OEG A;  3OH4 A;  1LL2 A;  2RIX A;  3FOQ A;  3I0L A;  3PNN A;  4Y9X A;  3SX3 A;  5CQL X;  1YP3 A;  4Y6U A;  2C0N A;  5C1H A;  2V0L A;  2FYD B;  4Y6N A;  3V0M A;  2PGY A;  3OH2 A;  4MYB A;  5AJN A;  1YP2 A;  3FWW A;  2X65 A;  1G93 A;  4ZDQ A;  1XZ6 A;  4Y64 A;  4HO3 A;  1W77 A;  4B3U A;  3T7O A;  3N9W A;  4K6R A;  1KWS A;  4P00 A;  5CMI A;  3CKN A;  1GWV A;  2YQJ A;  1ZJ3 A;  4L41 C;  1JV3 A;  2WVK A;  4FCU A;  4HO5 A;  1MP3 A;  3ZGG A;  1ZCT A;  2YQC A;  5CMG X;  4EEG A;  4D0Z A;  1ZHJ A;  4KC2 A;  4B2X A;  4NAK A;  1R82 A;  5C3D A;  5CQO A;  1R7Y A;  2AE7 A;  2A8W A;  4J18 A;  5C48 A;  4FRA A;  1ZI1 A;  3PKP A;  2VS5 A;  4NAL A;  4CJB A;  3BRK X;  2JCJ A;  5FYE A;  4YS8 A;  3ST8 A;  2RJ5 A;  1TW1 A;  2WVM A;  2X60 A;  5IDT A;  1FO9 A;  2JCK A;  3D98 A;  2PA4 A;  5C4B A;  1TZF A;  2YCM A;  5D92 A;  1JYL A;  3DJ4 A;  5CQP A;  4IRQ A;  2VSH A;  1FXO A;  1G2V A;  1QG8 A;  1TVY A;  3I0H A;  3SXA A;  1G3L A;  3U2X A;  4FRD A;  4AYL A;  1O7O A;  4ASJ A;  2OI5 A;  2VK9 A;  4D48 A;  4FRQ A;  3OC9 A;  1GQC A;  2BO6 A;  3V8Z A;  5EJ1 A;  4EE3 A;  1H4C A;  3BCV A;  1W57 A;  2NXV A;  2P72 A;  1I52 A;  1NKH B;  2VD4 A;  5HS2 A;  4HCQ A;  4EE4 A;  1H7F A;  1WT2 A;  5AJO A;  3RSB A;  2ZU7 A;  1K4V A;  2I5K A;  3V8Y A;  1H7G A;  1W55 A;  2VXM A;  1R7U A;  3ZLK A;  1LZ0 A;  1G0R A;  2D0J A;  3OH1 A;  3Q4S A;  2GGQ A;  5I1F A;  4Y63 A;  2BO4 A;  4Y7G A;  1OQM B;  2APC A;  1WT0 A;  2XME A;  1NHE B;  2RIY A;  1PZT A;  4B42 A;  3USQ A;  2RIZ A;  4FRH A;  5FU8 A;  4EE5 A;  4FRB A;  3U2W A;  1H5S A;  3ZF8 A;  5CMH A;  1QWJ A;  2XWM A;  1Z90 A;  4DDZ A;  1FGG A;  3PKQ A;  2X5Z A;  3SXE A;  2WGZ A;  2AGD A;  1S4O A;  4KXO A;  5C4D A;  2O1H A;  2RIT A;  3SX5 A;  5C3B A;  1NQI B;  1G97 A;  1H7H A;  3O3P A;  4D0T A;  2V0J A;  4FQW A;  2QH5 A;  1HJJ A;  4C2S A;  1ON8 A;  3CKJ A;  1FXJ A;  1H4E A;  2RJ0 A;  2YQS A;  2VS3 A;  3IOJ A;  2V0K A;  1LZI A;  3D8V A;  4NAI A;  1VGU A;  1EZI A;  2MZB A;  5FTS A;  2AM4 A;  1ZDF A;  1H5S D;  3HL3 A;  2QGI A;  3CGX A;  3SX7 A;  1H4D A;  1G9R A;  2W0W A;  4KC1 A;  2FFV A;  2YQH A;  2GGO A;  4Y7U A;  1FZW A;  1MP4 A;  1VH3 A;  2OI6 A;  1VZX A;  2DPW A;  2Y4K A;  4Y62 A;  2VSI A;  3RMW A;  1YP4 A;  1V83 A;  3I0C A;  2WVL A;  2FFU A;  1VZT A;  2P6W A;  1R7T A;  5C47 A;  2Y4M A;  3U0X A;  4LW6 A;  1O0R A;  2OEF A;  2Y4J A;  4B2W A;  5FTV A;  5IDS A;  3GUE A;  4KC4 A;  3EE5 A;  1SS9 A;  2ICX A;  3K8E A;  4AC3 A;  1FOA A;  3V91 A;  1H7T A;  3U2U A;  1OMZ A;  2ICY A;  1LL3 A;  3U2V A;  1H5T A;  2UX8 A;  4KQL A;  1G95 A;  1G23 A;  4EEA A;  2A8U A;  4NAN A;  2JCO A;  1GWW A;  1JVG A;  1ZDG A;  3E26 A;  5CQM X;  2AEC A;  5FUH A;  1R7X A;  1LZJ A;  3SX8 A;  4E1K A;  2RJ7 A;  4HO9 A;  1VPA A;  4EVW A;  2D7R A;  2Y7A A;  1NWG B;  1LZ7 A;  3OAM A;  1FGX A;  3I0K A;  3ZGF A;  1VH1 A;  1H5S B;  3I0D A;  3OKR A;  1GX0 A;  3V0L A;  4CJC A;  5IFY A;  1IIM A;  2AH9 A;  5C3A A;  2OI7 A;  4G3Q A;  4D11 C;  4KRV A;  4GBP A;  4AYJ A;  1G8O A;  2P73 A;  1EYR A;  4FRE A;  2PX7 A;  2X5S A;  4AAW A;  1WT3 A;  5EJZ A;  3I0J A;  2BO8 A;  4R7P A;  1JYK A;  1ZJO A;  1GA8 A;  2AES A;  2FYA A;  1ZCU A;  4ARW A;  3CKV A;  3R3I A;  5DDV A;  3IOI A;  4Y7V A;  4G3P A;  4DEC A;  5C4F A;  4KNR A;  1HM0 A;  2XWL A;  2V0I A;  5CMF X;  2ZU8 A;  4B4G A;  4HO4 A;  5C1G A;  1INJ A;  1FR8 A;  4ECM A;  3V0P A;  2FYC B;  5DDT A;  5C38 A;  1VM8 A;  2PGV A;  3JTJ A;  4EEO A;  4CJ8 A;  1H7L A;  4FRL A;  5CQN X;  1LL0 A;  5L6S A;  2I7B A;  3CKO A;  2RJ8 A;  1XHB A;  4CVH A;  1LVW A;  3LW6 A;  3R2W A;  3RMV A;  1H7Q A;  3SXC A;  2WEE A;  2BO7 A;  2W0V A;  1S4P A;  2YC5 A;  3SXG A;  1H3M A;  1YRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...