3CKQA

Crystal structure of a mycobacterial protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
315
structure length
302
Chain Sequence
GLRDTRPGDTWLADRSWNRPGWTVAELEAAKAGRTISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVKSFYRRPLGGRVTELVARPLLAALRPELGCILQPLGGEYAATRELLTSVPFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRCGIPDSGVGLTQFVADGPEGQSYTQHTWPVSLADRPPMQAIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a UDP-glucose-specific glycosyltransferase from a Mycobacterium species.
pubmed doi rcsb
total genus 83
structure length 302
sequence length 315
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ckqA00
1OQMB 1S4NA 2RITA 3TZTA 2OEGA 5C4BA 1ZJPA 4HO9A 2VXLA 1LZIA 3F1YA 4NANA 1HM9A 2WEEA 1NKHB 3USQA 3V0QA 1QG8A 4MNDA 2ICYA 1YP4A 2V0JA 4NALA 3ZGGA 2Z86A 3V0LA 4FREA 2GGQA 2RJ9A 3PNNA 2RIZA 4B4BA 4CJ8A 1R7TA 1VH3A 1JVGA 3T7OA 2I5KA 2WVLA 2OI7A 3BCVA 4LW3A 3SX8A 3FOQA 2YC5A 2ICXA 3Q80A 3OGZA 1H7HA 2VSHA 5FV9A 3CKNA 4FRBA 2O1FA 1S4OA 1G2VA 1GX0A 4EEAA 3CKOA 1I52A 4HO4A 4IRQA 3V8YA 4EE5A 1WT1A 1LZ7A 2YQJA 1WT2A 5IDSA 1WT3A 4D11C 2Y4JA 3DK5A 2FYCB 3JUJA 1YP3A 3SXEA 2WVMA 2Y7AA 1HM8A 1YROB 2OI5A 5EJZA 1LZ0A 1NWGB 1SS9A 5C4EA 1G97A 1VGWA 4EVWA 4HO5A 4Y64A 1FXJA 1ZI5A 5CMGX 1PZYB 4EE3A 3I0JA 1IINA 1ZI3A 3ZLKA 5CMFX 1QWJA 2I7BA 4HO2A 4FQWA 1VGUA 1FO8A 3SXAA 1HJLA 2Z87A 3HL3A 3T7NA 2YESA 1R82A 1R81A 1TZFA 3I0GA 5C47A 5DDVA 3OKRA 4FRMA 2DPWA 1H5SD 3IOHA 1FWYA 1R7YA 1H4EA 4DECA 4CVHA 5C1LA 2AM3A 2A8UA 1FXOA 2RIYA 2JCJA 1VH1A 5CQNX 1FGGA 4IRPA 3U0XA 2FFUA 1V82A 4FRLA 3I0HA 1LL3A 3ST8A 5CQOA 3V0NA 3U2XA 2GGOA 3V0MA 3V90A 1GWVA 4CJBA 2AESA 3BRKX 3K8EA 4FROA 3SX3A 1ZCVA 1WSZA 5C3DA 3OH4A 4JISA 1TVYA 1ZCYA 1NQIB 2PA4A 2AM4A 2I5EA 5C8RA 2RJ7A 4DE7A 3SXCA 2XMEA 3E25A 2PGYA 3U2WA 3ZF8A 2X65A 1ON8A 4KT7A 5I1FA 5C3AA 2V0LA 1HV9A 2VS3A 1H7LA 3JTJA 1QGQA 2BO4A 2YQCA 4B4MA 2Q4JA 4GBPA 3SXDA 2YQSA 1TW5A 1GQ9A 1H5TA 5C38A 4G3SA 2QKXA 4FRHA 5CQPA 1WVCA 1ZJ2A 2AH9A 4L41C 4M28A 5C4FA 2BO6A 1E5KA 4UEGA 4Y7GA 4Y9XA 4M4KA 2JCOA 3I0IX 5L6SA 3EE5A 3OH1A 3T7MA 2JCKA 1TW1A 4NAIA 5FYEA 2AGDA 2X5ZA 4EEOA 1H5TB 2PX7A 5IFYA 1G93A 3CKQA 2O1GA 4D11A 4R7PA 3U2VA 3SXBA 5FTVA 1ZDFA 5C36A 1W77A 2UX8A 1MP5A 1NMMB 2XWNA 5FTSA 4FRQA 4EEMA 4B2WA 4CJCA 2YC3A 1G95A 1VZXA 5C4DA 1GX4A 2PGVA 4Y6NA 2RJ4A 2XWLA 1VGZA 1H3MA 3V8ZA 5FU8A 4YS8A 1INJA 3ZLLA 1LL2A 1H5SC 1R80A 2D7IA 3CGXA 1VICA 1O23B 1HJJA 4XWIA 3RMVA 5HS2A 4Y7TA 2ZU9A 4M2BA 3NGWA 3CKVA 1FGXA 3O3PA 1ZIZA 4G87A 4HO0A 3V0PA 1ZI1A 5L6VA 2V0KA 4BMAA 2OI6A 2W0VA 4AAWA 1EYRA 1H7QA 1H4DA 3U2TA 1W55A 4Y6UA 4HG6A 2FYDB 1HM0A 1KWSA 3R2WA 4D0TA 1Z90A 3D8VA 4B3UA 4ZDQA 4JD0A 2Y4KA 5IDTA 2W0WA 1MC3A 1O7OA 3I0KA 2AM5A 3PKQA 2WGZA 4P00A 4FCUA 5AJNA 1R7VA 4KXOA 2P6WA 4B2XA 2VFZA 3JUKA 1VGTA 2D7RA 4HO3A 1FR8A 4KNRA 1ON6A 2VXMA 3K8DA 1V84A 3V0OA 3CU0A 4G3QA 4E1KA 2RJ0A 4FCEA 4DDZA 5C48A 2BO7A 1VZTA 5CMHA 1JYKA 2FYAA 2ZU8A 2AE7A 2O1HA 2QGIA 1ZDGA 4KPZA 3CKJA 2D0JA 4FRAA 1INIA 5J49A 1YP2A 5C1GA 2Y4LA 3TQDA 1V83A 3GUEA 3I0LA 4P02A 1O0RA 1WT0A 2X60A 5AJOA 2FYBA 5CQLX 3QVBA 1GA8A 3E26A 4C2SA 3I0DA 4B5BA 5AJPA 5C1HA 2Y6PA 4Y63A 2XMHA 1JVDA 4M2AA 3USRA 1K4VA 3IOJA 3Q4SA 1G0RA 2RIXA 1LZJA 5CMIA 1ZJOA 1NHEB 3I0EA 4FRPA 2NXVA 4ECMA 1PZTA 1H7EA 4EE4A 1ZCUA 3U2UA 1ZCTA 5FUHA 3ZGFA 2RJ5A 1FZWA 1R7XA 4FRDA 4G3PA 3OH0A 3SXGA 3OH2A 4D0ZA 2AECA 3V91A 5FU0A 4ASYA 4ASJA 2FFVA 5DDTA 2Y4MA 1ZJ3A 3KIAA 2P73A 4Y7FA 4NAKA 3RMWA 4HCQA 4HOCA 1H5SA 1FG5N 2YCMA 3R3IA 4HO8A 2APCA 4Y62A 2WAWA 4AC3A 2VSIA 4AYLA 3OC9A 4KC2A 3POLA 1ZHJA 1MP3A 1H5RA 1ZJ0A 3N9WA 1W57A 1XZ6A 4LW6A 1FRWA 2JCLA 1VZUA 2A8WA 3OH3A 1ZJ1A 2VS4A 3DUVA 4KRVA 3Q7UA 2VS5A 2WVKA 1O7QA 3I0FA 1H5SB 2FY7A 4KQLA 2E3DA 2P72A 1GWWA 4BQHA 1H7GA 3FWWA 4Y7VA 1H7TA 1JYLA 1LL0A 3U0YA 5EIYA 5C49A 1H5RB 3I0CA 1FO9A 3SX7A 4KNXA 1OMXA 2ZU7A 4KPXA 4KC4A 1H4CA 2CU2A 2OEFA 4EEGA 4AYJA 2YQHA 1EZIA 4J18A 1FR9A 2E8BA 2MZBA 1G9RA 2V0IA 2VD4A 2BO8A 3SPTA 1IIMA 5C3BA 1H7FA 1MP4A 3D98A 1R7UA 4HO6A 4K6RA 4MYBA 5C4CA 3DJ4A 1LVWA 2RJ1A 4B4GA 1NF5B 5BXCA 1G3LA 4Y7UA 2RJ8A 3PKPA 3F1CA 1XHBA 2QH5A 3D5NA 5CQMX 1JV3A 3SX5A 1ZI4A 4KC1A 4B42A 1S4PA 5EJ1A 4ARWA 1OMZA 3IOIA 1JV1A 1GQCA 2XWMA 3OAMA 1VPAA 1G1LA 1QGSA 2V0HA 2RJ6A 1G23A 4D48A 2WE9A 1G8OA 5CMJA 1VM8A 3RSBA 3LW6A 5JQQA 2X5SA 1FOAA
chains in the Genus database with same CATH superfamily
1OQMB 1S4NA 2RITA 3TZTA 2OEGA 5C4BA 1ZJPA 4HO9A 2VXLA 1LZIA 3F1YA 4NANA 1HM9A 5D92A 2WEEA 1NKHB 3USQA 3V0QA 1QG8A 4MNDA 2ICYA 1YP4A 2V0JA 4NALA 3ZGGA 2Z86A 3V0LA 4FREA 2GGQA 2RJ9A 3PNNA 2RIZA 4B4BA 4CJ8A 1R7TA 1VH3A 1JVGA 3T7OA 2I5KA 2WVLA 2OI7A 3BCVA 4O6MA 4LW3A 3SX8A 3FOQA 2YC5A 2ICXA 3Q80A 3OGZA 1H7HA 2VSHA 5FV9A 3CKNA 4FRBA 2O1FA 1S4OA 1G2VA 1GX0A 4EEAA 3CKOA 1I52A 4HO4A 4IRQA 3V8YA 4EE5A 1WT1A 1LZ7A 2YQJA 1WT2A 5IDSA 1WT3A 4D11C 2Y4JA 3DK5A 2FYCB 3JUJA 1YP3A 3SXEA 2WVMA 2Y7AA 1HM8A 1YROB 2OI5A 5EJZA 1LZ0A 1NWGB 1SS9A 5C4EA 1G97A 1VGWA 4EVWA 4HO5A 4Y64A 1FXJA 1ZI5A 5CMGX 1PZYB 4EE3A 3I0JA 1IINA 1ZI3A 3ZLKA 5CMFX 1QWJA 2I7BA 4HO2A 4FQWA 1VGUA 1FO8A 3SXAA 1HJLA 2Z87A 3HL3A 3T7NA 2YESA 1R82A 1R81A 1TZFA 3I0GA 5C47A 5DDVA 3OKRA 4FRMA 2DPWA 1H5SD 3IOHA 1FWYA 1R7YA 1H4EA 4DECA 4CVHA 5C1LA 2AM3A 2A8UA 1FXOA 2RIYA 2JCJA 1VH1A 5CQNX 1FGGA 4IRPA 3U0XA 2FFUA 1V82A 4FRLA 3I0HA 1LL3A 3ST8A 5CQOA 3V0NA 3U2XA 2GGOA 3V0MA 3V90A 1GWVA 4CJBA 4Q7CA 2AESA 3BRKX 4FIXA 3K8EA 4FROA 3SX3A 1ZCVA 1WSZA 5C3DA 3OH4A 4JISA 1TVYA 1ZCYA 1NQIB 2PA4A 2AM4A 2I5EA 5C8RA 2RJ7A 4DE7A 3SXCA 2XMEA 3E25A 2PGYA 3U2WA 3ZF8A 2X65A 1ON8A 4KT7A 5I1FA 5D91A 5C3AA 2V0LA 2VK9A 1HV9A 2VS3A 1H7LA 3JTJA 1QGQA 2BO4A 2YQCA 4B4MA 2Q4JA 4GBPA 3SXDA 2YQSA 1TW5A 1GQ9A 1H5TA 5C38A 4G3SA 2QKXA 4FRHA 5CQPA 1WVCA 1ZJ2A 2AH9A 4L41C 4M28A 5C4FA 2BO6A 1E5KA 4UEGA 4Y7GA 4Y9XA 4M4KA 2JCOA 3I0IX 5L6SA 3EE5A 3OH1A 3T7MA 2JCKA 1TW1A 4NAIA 5FYEA 2AGDA 2X5ZA 4FIYA 4EEOA 1H5TB 2PX7A 5IFYA 1G93A 3CKQA 2O1GA 4D11A 4R7PA 3U2VA 3SXBA 4O6NA 5FTVA 1ZDFA 5C36A 1W77A 2UX8A 1MP5A 1NMMB 2XWNA 5FTSA 4FRQA 4EEMA 4B2WA 4CJCA 2YC3A 1G95A 1VZXA 5C4DA 1GX4A 2PGVA 4Y6NA 2RJ4A 2XWLA 1VGZA 1H3MA 3V8ZA 5FU8A 4YS8A 1INJA 3ZLLA 1LL2A 1H5SC 1R80A 2D7IA 3CGXA 1VICA 1O23B 1HJJA 4XWIA 3RMVA 5HS2A 4Y7TA 2ZU9A 4M2BA 3NGWA 3CKVA 1FGXA 3O3PA 1ZIZA 4G87A 4HO0A 3V0PA 1ZI1A 5L6VA 2V0KA 4BMAA 2OI6A 2W0VA 4AAWA 1EYRA 1H7QA 1H4DA 3U2TA 1W55A 4Y6UA 4HG6A 2FYDB 1HM0A 1KWSA 3R2WA 4D0TA 1Z90A 3D8VA 4B3UA 4ZDQA 4JD0A 2Y4KA 5IDTA 2W0WA 4MIXA 1MC3A 1O7OA 3I0KA 2AM5A 3PKQA 2WGZA 4P00A 4FCUA 5AJNA 1R7VA 4KXOA 2P6WA 4B2XA 2VFZA 3JUKA 1VGTA 2D7RA 4HO3A 1FR8A 4KNRA 1ON6A 2VXMA 3K8DA 1V84A 3V0OA 3CU0A 4G3QA 4E1KA 2RJ0A 4FCEA 4DDZA 5C48A 2BO7A 1VZTA 5CMHA 1JYKA 2FYAA 2ZU8A 2AE7A 2O1HA 2QGIA 1ZDGA 4KPZA 3CKJA 2D0JA 2J0AA 4FRAA 1INIA 5J49A 1YP2A 5C1GA 2C0NA 2Y4LA 3TQDA 1V83A 3GUEA 3I0LA 4P02A 1O0RA 1WT0A 2X60A 5AJOA 2FYBA 5CQLX 3QVBA 1GA8A 3E26A 4C2SA 3I0DA 4B5BA 5AJPA 5C1HA 2Y6PA 4Y63A 2XMHA 1JVDA 4M2AA 3USRA 1K4VA 3IOJA 3Q4SA 1G0RA 2RIXA 1LZJA 5CMIA 1ZJOA 1NHEB 3I0EA 4FRPA 2NXVA 4ECMA 1PZTA 1H7EA 4EE4A 1ZCUA 3U2UA 1ZCTA 2J0BA 5FUHA 3ZGFA 2RJ5A 1FZWA 1R7XA 4FRDA 4G3PA 3OH0A 3SXGA 3OH2A 4D0ZA 2AECA 3V91A 5FU0A 4ASYA 4ASJA 2FFVA 5DDTA 2Y4MA 1ZJ3A 3KIAA 2P73A 4Y7FA 4NAKA 3RMWA 4HCQA 4HOCA 1H5SA 1FG5N 2YCMA 3R3IA 4HO8A 2APCA 4Y62A 2WAWA 4AC3A 2VSIA 4AYLA 3OC9A 4KC2A 3POLA 1ZHJA 1MP3A 1H5RA 1ZJ0A 3N9WA 1W57A 1XZ6A 4LW6A 1FRWA 2JCLA 1VZUA 2A8WA 3OH3A 1ZJ1A 2VS4A 3DUVA 4KRVA 3Q7UA 2VS5A 2WVKA 1O7QA 3I0FA 1H5SB 2FY7A 4KQLA 2E3DA 2P72A 1GWWA 4BQHA 1H7GA 3FWWA 4Y7VA 1H7TA 1JYLA 1LL0A 3U0YA 5EIYA 5C49A 1H5RB 3I0CA 1FO9A 3SX7A 4KNXA 1OMXA 2ZU7A 4KPXA 4KC4A 1H4CA 2CU2A 2OEFA 4EEGA 4AYJA 2YQHA 1EZIA 4J18A 1FR9A 2E8BA 2MZBA 1G9RA 2V0IA 2VD4A 2BO8A 3SPTA 1IIMA 5C3BA 1H7FA 1MP4A 3D98A 1R7UA 4HO6A 4K6RA 4MYBA 5C4CA 3DJ4A 1LVWA 2RJ1A 4B4GA 1NF5B 5BXCA 1G3LA 4Y7UA 2RJ8A 3PKPA 3F1CA 1XHBA 2QH5A 3D5NA 5CQMX 1JV3A 3SX5A 1ZI4A 4KC1A 4B42A 1S4PA 5EJ1A 4ARWA 1OMZA 3IOIA 1JV1A 1GQCA 2XWMA 3OAMA 1VPAA 1G1LA 1QGSA 2V0HA 2RJ6A 1G23A 4D48A 2WE9A 1G8OA 5CMJA 1VM8A 3RSBA 3LW6A 5JQQA 2X5SA 1FOAA
chains in the Genus database with same CATH topology
1OQMB 1S4NA 2RITA 3TZTA 2OEGA 5C4BA 1ZJPA 4HO9A 2VXLA 1LZIA 3F1YA 4NANA 1HM9A 5D92A 2WEEA 1NKHB 3USQA 3V0QA 1QG8A 4MNDA 2ICYA 1YP4A 2V0JA 4NALA 3ZGGA 2Z86A 3V0LA 4FREA 2GGQA 2RJ9A 3PNNA 2RIZA 4B4BA 4CJ8A 1R7TA 1VH3A 1JVGA 3T7OA 2I5KA 2WVLA 2OI7A 3BCVA 4O6MA 4LW3A 3SX8A 3FOQA 2YC5A 2ICXA 3Q80A 3OGZA 1H7HA 2VSHA 5FV9A 3CKNA 4FRBA 2O1FA 1S4OA 1G2VA 1GX0A 4EEAA 3CKOA 1I52A 4HO4A 4IRQA 3V8YA 4EE5A 1WT1A 1LZ7A 2YQJA 1WT2A 5IDSA 1WT3A 4D11C 2Y4JA 3DK5A 2FYCB 3JUJA 1YP3A 3SXEA 2WVMA 2Y7AA 1HM8A 1YROB 2OI5A 5EJZA 1LZ0A 1NWGB 1SS9A 5C4EA 1G97A 1VGWA 4EVWA 4HO5A 4Y64A 1FXJA 1ZI5A 5CMGX 1PZYB 4EE3A 3I0JA 1IINA 1ZI3A 3ZLKA 5CMFX 1QWJA 2I7BA 4HO2A 4FQWA 1VGUA 1FO8A 3SXAA 1HJLA 2Z87A 3HL3A 3T7NA 2YESA 1R82A 1R81A 1TZFA 3I0GA 5C47A 5DDVA 3OKRA 4FRMA 2DPWA 1H5SD 3IOHA 1FWYA 1R7YA 1H4EA 4DECA 4CVHA 5C1LA 2AM3A 2A8UA 1FXOA 2RIYA 2JCJA 1VH1A 5CQNX 1FGGA 4IRPA 3U0XA 2FFUA 1V82A 4FRLA 3I0HA 1LL3A 3ST8A 5CQOA 3V0NA 3U2XA 2GGOA 3V0MA 3V90A 1GWVA 4CJBA 4Q7CA 2AESA 3BRKX 4FIXA 3K8EA 4FROA 3SX3A 1ZCVA 1WSZA 5C3DA 3OH4A 4JISA 1TVYA 1ZCYA 1NQIB 2PA4A 2AM4A 2I5EA 5C8RA 2RJ7A 4DE7A 3SXCA 2XMEA 3E25A 2PGYA 3U2WA 3ZF8A 2X65A 1ON8A 4KT7A 5I1FA 5D91A 5C3AA 2V0LA 2VK9A 1HV9A 2VS3A 1H7LA 3JTJA 1QGQA 2BO4A 2YQCA 4B4MA 2Q4JA 4GBPA 3SXDA 2YQSA 1TW5A 1GQ9A 1H5TA 5C38A 4G3SA 2QKXA 4FRHA 5CQPA 1WVCA 1ZJ2A 2AH9A 4L41C 4M28A 5C4FA 2BO6A 1E5KA 4UEGA 4Y7GA 4Y9XA 4M4KA 2JCOA 3I0IX 5L6SA 3EE5A 3OH1A 3T7MA 2JCKA 1TW1A 4NAIA 5FYEA 2AGDA 2X5ZA 4FIYA 4EEOA 1H5TB 2PX7A 5IFYA 1G93A 3CKQA 2O1GA 4D11A 4R7PA 3U2VA 3SXBA 4O6NA 5FTVA 1ZDFA 5C36A 1W77A 2UX8A 1MP5A 1NMMB 2XWNA 5FTSA 4FRQA 4EEMA 4B2WA 4CJCA 2YC3A 1G95A 1VZXA 5C4DA 1GX4A 2PGVA 4Y6NA 2RJ4A 2XWLA 1VGZA 1H3MA 3V8ZA 5FU8A 4YS8A 1INJA 3ZLLA 1LL2A 1H5SC 1R80A 2D7IA 3CGXA 1VICA 1O23B 1HJJA 4XWIA 3RMVA 5HS2A 4Y7TA 2ZU9A 4M2BA 3NGWA 3CKVA 1FGXA 3O3PA 1ZIZA 4G87A 4HO0A 3V0PA 1ZI1A 5L6VA 2V0KA 4BMAA 2OI6A 2W0VA 4AAWA 1EYRA 1H7QA 1H4DA 3U2TA 1W55A 4Y6UA 4HG6A 2FYDB 1HM0A 1KWSA 3R2WA 4D0TA 1Z90A 3D8VA 4B3UA 4ZDQA 4JD0A 2Y4KA 5IDTA 2W0WA 4MIXA 1MC3A 1O7OA 3I0KA 2AM5A 3PKQA 2WGZA 4P00A 4FCUA 5AJNA 1R7VA 4KXOA 2P6WA 4B2XA 2VFZA 3JUKA 1VGTA 2D7RA 4HO3A 1FR8A 4KNRA 1ON6A 2VXMA 3K8DA 1V84A 3V0OA 3CU0A 4G3QA 4E1KA 2RJ0A 4FCEA 4DDZA 5C48A 2BO7A 1VZTA 5CMHA 1JYKA 2FYAA 2ZU8A 2AE7A 2O1HA 2QGIA 1ZDGA 4KPZA 3CKJA 2D0JA 2J0AA 4FRAA 1INIA 5J49A 1YP2A 5C1GA 2C0NA 2Y4LA 3TQDA 1V83A 3GUEA 3I0LA 4P02A 1O0RA 1WT0A 2X60A 5AJOA 2FYBA 5CQLX 3QVBA 1GA8A 3E26A 4C2SA 3I0DA 4B5BA 5AJPA 5C1HA 2Y6PA 4Y63A 2XMHA 1JVDA 4M2AA 3USRA 1K4VA 3IOJA 3Q4SA 1G0RA 2RIXA 1LZJA 5CMIA 1ZJOA 1NHEB 3I0EA 4FRPA 2NXVA 4ECMA 1PZTA 1H7EA 4EE4A 1ZCUA 3U2UA 1ZCTA 2J0BA 5FUHA 3ZGFA 2RJ5A 1FZWA 1R7XA 4FRDA 4G3PA 3OH0A 3SXGA 3OH2A 4D0ZA 2AECA 3V91A 5FU0A 4ASYA 4ASJA 2FFVA 5DDTA 2Y4MA 1ZJ3A 3KIAA 2P73A 4Y7FA 4NAKA 3RMWA 4HCQA 4HOCA 1H5SA 1FG5N 2YCMA 3R3IA 4HO8A 2APCA 4Y62A 2WAWA 4AC3A 2VSIA 4AYLA 3OC9A 4KC2A 3POLA 1ZHJA 1MP3A 1H5RA 1ZJ0A 3N9WA 1W57A 1XZ6A 4LW6A 1FRWA 2JCLA 1VZUA 2A8WA 3OH3A 1ZJ1A 2VS4A 3DUVA 4KRVA 3Q7UA 2VS5A 2WVKA 1O7QA 3I0FA 1H5SB 2FY7A 4KQLA 2E3DA 2P72A 1GWWA 4BQHA 1H7GA 3FWWA 4Y7VA 1H7TA 1JYLA 1LL0A 3U0YA 5EIYA 5C49A 1H5RB 3I0CA 1FO9A 3SX7A 4KNXA 1OMXA 2ZU7A 4KPXA 4KC4A 1H4CA 2CU2A 2OEFA 4EEGA 4AYJA 2YQHA 1EZIA 4J18A 1FR9A 2E8BA 2MZBA 1G9RA 2V0IA 2VD4A 2BO8A 3SPTA 1IIMA 5C3BA 1H7FA 1MP4A 3D98A 1R7UA 4HO6A 4K6RA 4MYBA 5C4CA 3DJ4A 1LVWA 2RJ1A 4B4GA 1NF5B 5BXCA 1G3LA 4Y7UA 2RJ8A 3PKPA 3F1CA 1XHBA 2QH5A 3D5NA 5CQMX 1JV3A 3SX5A 1ZI4A 4KC1A 4B42A 1S4PA 5EJ1A 4ARWA 1OMZA 3IOIA 1JV1A 1GQCA 2XWMA 3OAMA 1VPAA 1G1LA 1QGSA 2V0HA 2RJ6A 1G23A 4D48A 2WE9A 1G8OA 5CMJA 1VM8A 3RSBA 3LW6A 5JQQA 2X5SA 1FOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQM B;  1S4N A;  2RIT A;  3TZT A;  2OEG A;  5C4B A;  1ZJP A;  4HO9 A;  2VXL A;  1LZI A;  3F1Y A;  4NAN A;  1HM9 A;  2WEE A;  1NKH B;  3USQ A;  3V0Q A;  1QG8 A;  4MND A;  2ICY A;  1YP4 A;  2V0J A;  4NAL A;  3ZGG A;  2Z86 A;  3V0L A;  4FRE A;  2GGQ A;  2RJ9 A;  3PNN A;  2RIZ A;  4B4B A;  4CJ8 A;  1R7T A;  1VH3 A;  1JVG A;  3T7O A;  2I5K A;  2WVL A;  2OI7 A;  3BCV A;  4LW3 A;  3SX8 A;  3FOQ A;  2YC5 A;  2ICX A;  3Q80 A;  3OGZ A;  1H7H A;  2VSH A;  5FV9 A;  3CKN A;  4FRB A;  2O1F A;  1S4O A;  1G2V A;  1GX0 A;  4EEA A;  3CKO A;  1I52 A;  4HO4 A;  4IRQ A;  3V8Y A;  4EE5 A;  1WT1 A;  1LZ7 A;  2YQJ A;  1WT2 A;  5IDS A;  1WT3 A;  4D11 C;  2Y4J A;  3DK5 A;  2FYC B;  3JUJ A;  1YP3 A;  3SXE A;  2WVM A;  2Y7A A;  1HM8 A;  1YRO B;  2OI5 A;  5EJZ A;  1LZ0 A;  1NWG B;  1SS9 A;  5C4E A;  1G97 A;  1VGW A;  4EVW A;  4HO5 A;  4Y64 A;  1FXJ A;  1ZI5 A;  5CMG X;  1PZY B;  4EE3 A;  3I0J A;  1IIN A;  1ZI3 A;  3ZLK A;  5CMF X;  1QWJ A;  2I7B A;  4HO2 A;  4FQW A;  1VGU A;  1FO8 A;  3SXA A;  1HJL A;  2Z87 A;  3HL3 A;  3T7N A;  2YES A;  1R82 A;  1R81 A;  1TZF A;  3I0G A;  5C47 A;  5DDV A;  3OKR A;  4FRM A;  2DPW A;  1H5S D;  3IOH A;  1FWY A;  1R7Y A;  1H4E A;  4DEC A;  4CVH A;  5C1L A;  2AM3 A;  2A8U A;  1FXO A;  2RIY A;  2JCJ A;  1VH1 A;  5CQN X;  1FGG A;  4IRP A;  3U0X A;  2FFU A;  1V82 A;  4FRL A;  3I0H A;  1LL3 A;  3ST8 A;  5CQO A;  3V0N A;  3U2X A;  2GGO A;  3V0M A;  3V90 A;  1GWV A;  4CJB A;  2AES A;  3BRK X;  3K8E A;  4FRO A;  3SX3 A;  1ZCV A;  1WSZ A;  5C3D A;  3OH4 A;  4JIS A;  1TVY A;  1ZCY A;  1NQI B;  2PA4 A;  2AM4 A;  2I5E A;  5C8R A;  2RJ7 A;  4DE7 A;  3SXC A;  2XME A;  3E25 A;  2PGY A;  3U2W A;  3ZF8 A;  2X65 A;  1ON8 A;  4KT7 A;  5I1F A;  5C3A A;  2V0L A;  1HV9 A;  2VS3 A;  1H7L A;  3JTJ A;  1QGQ A;  2BO4 A;  2YQC A;  4B4M A;  2Q4J A;  4GBP A;  3SXD A;  2YQS A;  1TW5 A;  1GQ9 A;  1H5T A;  5C38 A;  4G3S A;  2QKX A;  4FRH A;  5CQP A;  1WVC A;  1ZJ2 A;  2AH9 A;  4L41 C;  4M28 A;  5C4F A;  2BO6 A;  1E5K A;  4UEG A;  4Y7G A;  4Y9X A;  4M4K A;  2JCO A;  3I0I X;  5L6S A;  3EE5 A;  3OH1 A;  3T7M A;  2JCK A;  1TW1 A;  4NAI A;  5FYE A;  2AGD A;  2X5Z A;  4EEO A;  1H5T B;  2PX7 A;  5IFY A;  1G93 A;  3CKQ A;  2O1G A;  4D11 A;  4R7P A;  3U2V A;  3SXB A;  5FTV A;  1ZDF A;  5C36 A;  1W77 A;  2UX8 A;  1MP5 A;  1NMM B;  2XWN A;  5FTS A;  4FRQ A;  4EEM A;  4B2W A;  4CJC A;  2YC3 A;  1G95 A;  1VZX A;  5C4D A;  1GX4 A;  2PGV A;  4Y6N A;  2RJ4 A;  2XWL A;  1VGZ A;  1H3M A;  3V8Z A;  5FU8 A;  4YS8 A;  1INJ A;  3ZLL A;  1LL2 A;  1H5S C;  1R80 A;  2D7I A;  3CGX A;  1VIC A;  1O23 B;  1HJJ A;  4XWI A;  3RMV A;  5HS2 A;  4Y7T A;  2ZU9 A;  4M2B A;  3NGW A;  3CKV A;  1FGX A;  3O3P A;  1ZIZ A;  4G87 A;  4HO0 A;  3V0P A;  1ZI1 A;  5L6V A;  2V0K A;  4BMA A;  2OI6 A;  2W0V A;  4AAW A;  1EYR A;  1H7Q A;  1H4D A;  3U2T A;  1W55 A;  4Y6U A;  4HG6 A;  2FYD B;  1HM0 A;  1KWS A;  3R2W A;  4D0T A;  1Z90 A;  3D8V A;  4B3U A;  4ZDQ A;  4JD0 A;  2Y4K A;  5IDT A;  2W0W A;  1MC3 A;  1O7O A;  3I0K A;  2AM5 A;  3PKQ A;  2WGZ A;  4P00 A;  4FCU A;  5AJN A;  1R7V A;  4KXO A;  2P6W A;  4B2X A;  2VFZ A;  3JUK A;  1VGT A;  2D7R A;  4HO3 A;  1FR8 A;  4KNR A;  1ON6 A;  2VXM A;  3K8D A;  1V84 A;  3V0O A;  3CU0 A;  4G3Q A;  4E1K A;  2RJ0 A;  4FCE A;  4DDZ A;  5C48 A;  2BO7 A;  1VZT A;  5CMH A;  1JYK A;  2FYA A;  2ZU8 A;  2AE7 A;  2O1H A;  2QGI A;  1ZDG A;  4KPZ A;  3CKJ A;  2D0J A;  4FRA A;  1INI A;  5J49 A;  1YP2 A;  5C1G A;  2Y4L A;  3TQD A;  1V83 A;  3GUE A;  3I0L A;  4P02 A;  1O0R A;  1WT0 A;  2X60 A;  5AJO A;  2FYB A;  5CQL X;  3QVB A;  1GA8 A;  3E26 A;  4C2S A;  3I0D A;  4B5B A;  5AJP A;  5C1H A;  2Y6P A;  4Y63 A;  2XMH A;  1JVD A;  4M2A A;  3USR A;  1K4V A;  3IOJ A;  3Q4S A;  1G0R A;  2RIX A;  1LZJ A;  5CMI A;  1ZJO A;  1NHE B;  3I0E A;  4FRP A;  2NXV A;  4ECM A;  1PZT A;  1H7E A;  4EE4 A;  1ZCU A;  3U2U A;  1ZCT A;  5FUH A;  3ZGF A;  2RJ5 A;  1FZW A;  1R7X A;  4FRD A;  4G3P A;  3OH0 A;  3SXG A;  3OH2 A;  4D0Z A;  2AEC A;  3V91 A;  5FU0 A;  4ASY A;  4ASJ A;  2FFV A;  5DDT A;  2Y4M A;  1ZJ3 A;  3KIA A;  2P73 A;  4Y7F A;  4NAK A;  3RMW A;  4HCQ A;  4HOC A;  1H5S A;  1FG5 N;  2YCM A;  3R3I A;  4HO8 A;  2APC A;  4Y62 A;  2WAW A;  4AC3 A;  2VSI A;  4AYL A;  3OC9 A;  4KC2 A;  3POL A;  1ZHJ A;  1MP3 A;  1H5R A;  1ZJ0 A;  3N9W A;  1W57 A;  1XZ6 A;  4LW6 A;  1FRW A;  2JCL A;  1VZU A;  2A8W A;  3OH3 A;  1ZJ1 A;  2VS4 A;  3DUV A;  4KRV A;  3Q7U A;  2VS5 A;  2WVK A;  1O7Q A;  3I0F A;  1H5S B;  2FY7 A;  4KQL A;  2E3D A;  2P72 A;  1GWW A;  4BQH A;  1H7G A;  3FWW A;  4Y7V A;  1H7T A;  1JYL A;  1LL0 A;  3U0Y A;  5EIY A;  5C49 A;  1H5R B;  3I0C A;  1FO9 A;  3SX7 A;  4KNX A;  1OMX A;  2ZU7 A;  4KPX A;  4KC4 A;  1H4C A;  2CU2 A;  2OEF A;  4EEG A;  4AYJ A;  2YQH A;  1EZI A;  4J18 A;  1FR9 A;  2E8B A;  2MZB A;  1G9R A;  2V0I A;  2VD4 A;  2BO8 A;  3SPT A;  1IIM A;  5C3B A;  1H7F A;  1MP4 A;  3D98 A;  1R7U A;  4HO6 A;  4K6R A;  4MYB A;  5C4C A;  3DJ4 A;  1LVW A;  2RJ1 A;  4B4G A;  1NF5 B;  5BXC A;  1G3L A;  4Y7U A;  2RJ8 A;  3PKP A;  3F1C A;  1XHB A;  2QH5 A;  3D5N A;  5CQM X;  1JV3 A;  3SX5 A;  1ZI4 A;  4KC1 A;  4B42 A;  1S4P A;  5EJ1 A;  4ARW A;  1OMZ A;  3IOI A;  1JV1 A;  1GQC A;  2XWM A;  3OAM A;  1VPA A;  1G1L A;  1QGS A;  2V0H A;  2RJ6 A;  1G23 A;  4D48 A;  2WE9 A;  1G8O A;  5CMJ A;  1VM8 A;  3RSB A;  3LW6 A;  5JQQ A;  2X5S A;  1FOA A; 
#chains in the Genus database with same CATH topology
 1OQM B;  1S4N A;  2RIT A;  3TZT A;  2OEG A;  5C4B A;  1ZJP A;  4HO9 A;  2VXL A;  1LZI A;  3F1Y A;  4NAN A;  1HM9 A;  5D92 A;  2WEE A;  1NKH B;  3USQ A;  3V0Q A;  1QG8 A;  4MND A;  2ICY A;  1YP4 A;  2V0J A;  4NAL A;  3ZGG A;  2Z86 A;  3V0L A;  4FRE A;  2GGQ A;  2RJ9 A;  3PNN A;  2RIZ A;  4B4B A;  4CJ8 A;  1R7T A;  1VH3 A;  1JVG A;  3T7O A;  2I5K A;  2WVL A;  2OI7 A;  3BCV A;  4O6M A;  4LW3 A;  3SX8 A;  3FOQ A;  2YC5 A;  2ICX A;  3Q80 A;  3OGZ A;  1H7H A;  2VSH A;  5FV9 A;  3CKN A;  4FRB A;  2O1F A;  1S4O A;  1G2V A;  1GX0 A;  4EEA A;  3CKO A;  1I52 A;  4HO4 A;  4IRQ A;  3V8Y A;  4EE5 A;  1WT1 A;  1LZ7 A;  2YQJ A;  1WT2 A;  5IDS A;  1WT3 A;  4D11 C;  2Y4J A;  3DK5 A;  2FYC B;  3JUJ A;  1YP3 A;  3SXE A;  2WVM A;  2Y7A A;  1HM8 A;  1YRO B;  2OI5 A;  5EJZ A;  1LZ0 A;  1NWG B;  1SS9 A;  5C4E A;  1G97 A;  1VGW A;  4EVW A;  4HO5 A;  4Y64 A;  1FXJ A;  1ZI5 A;  5CMG X;  1PZY B;  4EE3 A;  3I0J A;  1IIN A;  1ZI3 A;  3ZLK A;  5CMF X;  1QWJ A;  2I7B A;  4HO2 A;  4FQW A;  1VGU A;  1FO8 A;  3SXA A;  1HJL A;  2Z87 A;  3HL3 A;  3T7N A;  2YES A;  1R82 A;  1R81 A;  1TZF A;  3I0G A;  5C47 A;  5DDV A;  3OKR A;  4FRM A;  2DPW A;  1H5S D;  3IOH A;  1FWY A;  1R7Y A;  1H4E A;  4DEC A;  4CVH A;  5C1L A;  2AM3 A;  2A8U A;  1FXO A;  2RIY A;  2JCJ A;  1VH1 A;  5CQN X;  1FGG A;  4IRP A;  3U0X A;  2FFU A;  1V82 A;  4FRL A;  3I0H A;  1LL3 A;  3ST8 A;  5CQO A;  3V0N A;  3U2X A;  2GGO A;  3V0M A;  3V90 A;  1GWV A;  4CJB A;  4Q7C A;  2AES A;  3BRK X;  4FIX A;  3K8E A;  4FRO A;  3SX3 A;  1ZCV A;  1WSZ A;  5C3D A;  3OH4 A;  4JIS A;  1TVY A;  1ZCY A;  1NQI B;  2PA4 A;  2AM4 A;  2I5E A;  5C8R A;  2RJ7 A;  4DE7 A;  3SXC A;  2XME A;  3E25 A;  2PGY A;  3U2W A;  3ZF8 A;  2X65 A;  1ON8 A;  4KT7 A;  5I1F A;  5D91 A;  5C3A A;  2V0L A;  2VK9 A;  1HV9 A;  2VS3 A;  1H7L A;  3JTJ A;  1QGQ A;  2BO4 A;  2YQC A;  4B4M A;  2Q4J A;  4GBP A;  3SXD A;  2YQS A;  1TW5 A;  1GQ9 A;  1H5T A;  5C38 A;  4G3S A;  2QKX A;  4FRH A;  5CQP A;  1WVC A;  1ZJ2 A;  2AH9 A;  4L41 C;  4M28 A;  5C4F A;  2BO6 A;  1E5K A;  4UEG A;  4Y7G A;  4Y9X A;  4M4K A;  2JCO A;  3I0I X;  5L6S A;  3EE5 A;  3OH1 A;  3T7M A;  2JCK A;  1TW1 A;  4NAI A;  5FYE A;  2AGD A;  2X5Z A;  4FIY A;  4EEO A;  1H5T B;  2PX7 A;  5IFY A;  1G93 A;  3CKQ A;  2O1G A;  4D11 A;  4R7P A;  3U2V A;  3SXB A;  4O6N A;  5FTV A;  1ZDF A;  5C36 A;  1W77 A;  2UX8 A;  1MP5 A;  1NMM B;  2XWN A;  5FTS A;  4FRQ A;  4EEM A;  4B2W A;  4CJC A;  2YC3 A;  1G95 A;  1VZX A;  5C4D A;  1GX4 A;  2PGV A;  4Y6N A;  2RJ4 A;  2XWL A;  1VGZ A;  1H3M A;  3V8Z A;  5FU8 A;  4YS8 A;  1INJ A;  3ZLL A;  1LL2 A;  1H5S C;  1R80 A;  2D7I A;  3CGX A;  1VIC A;  1O23 B;  1HJJ A;  4XWI A;  3RMV A;  5HS2 A;  4Y7T A;  2ZU9 A;  4M2B A;  3NGW A;  3CKV A;  1FGX A;  3O3P A;  1ZIZ A;  4G87 A;  4HO0 A;  3V0P A;  1ZI1 A;  5L6V A;  2V0K A;  4BMA A;  2OI6 A;  2W0V A;  4AAW A;  1EYR A;  1H7Q A;  1H4D A;  3U2T A;  1W55 A;  4Y6U A;  4HG6 A;  2FYD B;  1HM0 A;  1KWS A;  3R2W A;  4D0T A;  1Z90 A;  3D8V A;  4B3U A;  4ZDQ A;  4JD0 A;  2Y4K A;  5IDT A;  2W0W A;  4MIX A;  1MC3 A;  1O7O A;  3I0K A;  2AM5 A;  3PKQ A;  2WGZ A;  4P00 A;  4FCU A;  5AJN A;  1R7V A;  4KXO A;  2P6W A;  4B2X A;  2VFZ A;  3JUK A;  1VGT A;  2D7R A;  4HO3 A;  1FR8 A;  4KNR A;  1ON6 A;  2VXM A;  3K8D A;  1V84 A;  3V0O A;  3CU0 A;  4G3Q A;  4E1K A;  2RJ0 A;  4FCE A;  4DDZ A;  5C48 A;  2BO7 A;  1VZT A;  5CMH A;  1JYK A;  2FYA A;  2ZU8 A;  2AE7 A;  2O1H A;  2QGI A;  1ZDG A;  4KPZ A;  3CKJ A;  2D0J A;  2J0A A;  4FRA A;  1INI A;  5J49 A;  1YP2 A;  5C1G A;  2C0N A;  2Y4L A;  3TQD A;  1V83 A;  3GUE A;  3I0L A;  4P02 A;  1O0R A;  1WT0 A;  2X60 A;  5AJO A;  2FYB A;  5CQL X;  3QVB A;  1GA8 A;  3E26 A;  4C2S A;  3I0D A;  4B5B A;  5AJP A;  5C1H A;  2Y6P A;  4Y63 A;  2XMH A;  1JVD A;  4M2A A;  3USR A;  1K4V A;  3IOJ A;  3Q4S A;  1G0R A;  2RIX A;  1LZJ A;  5CMI A;  1ZJO A;  1NHE B;  3I0E A;  4FRP A;  2NXV A;  4ECM A;  1PZT A;  1H7E A;  4EE4 A;  1ZCU A;  3U2U A;  1ZCT A;  2J0B A;  5FUH A;  3ZGF A;  2RJ5 A;  1FZW A;  1R7X A;  4FRD A;  4G3P A;  3OH0 A;  3SXG A;  3OH2 A;  4D0Z A;  2AEC A;  3V91 A;  5FU0 A;  4ASY A;  4ASJ A;  2FFV A;  5DDT A;  2Y4M A;  1ZJ3 A;  3KIA A;  2P73 A;  4Y7F A;  4NAK A;  3RMW A;  4HCQ A;  4HOC A;  1H5S A;  1FG5 N;  2YCM A;  3R3I A;  4HO8 A;  2APC A;  4Y62 A;  2WAW A;  4AC3 A;  2VSI A;  4AYL A;  3OC9 A;  4KC2 A;  3POL A;  1ZHJ A;  1MP3 A;  1H5R A;  1ZJ0 A;  3N9W A;  1W57 A;  1XZ6 A;  4LW6 A;  1FRW A;  2JCL A;  1VZU A;  2A8W A;  3OH3 A;  1ZJ1 A;  2VS4 A;  3DUV A;  4KRV A;  3Q7U A;  2VS5 A;  2WVK A;  1O7Q A;  3I0F A;  1H5S B;  2FY7 A;  4KQL A;  2E3D A;  2P72 A;  1GWW A;  4BQH A;  1H7G A;  3FWW A;  4Y7V A;  1H7T A;  1JYL A;  1LL0 A;  3U0Y A;  5EIY A;  5C49 A;  1H5R B;  3I0C A;  1FO9 A;  3SX7 A;  4KNX A;  1OMX A;  2ZU7 A;  4KPX A;  4KC4 A;  1H4C A;  2CU2 A;  2OEF A;  4EEG A;  4AYJ A;  2YQH A;  1EZI A;  4J18 A;  1FR9 A;  2E8B A;  2MZB A;  1G9R A;  2V0I A;  2VD4 A;  2BO8 A;  3SPT A;  1IIM A;  5C3B A;  1H7F A;  1MP4 A;  3D98 A;  1R7U A;  4HO6 A;  4K6R A;  4MYB A;  5C4C A;  3DJ4 A;  1LVW A;  2RJ1 A;  4B4G A;  1NF5 B;  5BXC A;  1G3L A;  4Y7U A;  2RJ8 A;  3PKP A;  3F1C A;  1XHB A;  2QH5 A;  3D5N A;  5CQM X;  1JV3 A;  3SX5 A;  1ZI4 A;  4KC1 A;  4B42 A;  1S4P A;  5EJ1 A;  4ARW A;  1OMZ A;  3IOI A;  1JV1 A;  1GQC A;  2XWM A;  3OAM A;  1VPA A;  1G1L A;  1QGS A;  2V0H A;  2RJ6 A;  1G23 A;  4D48 A;  2WE9 A;  1G8O A;  5CMJ A;  1VM8 A;  3RSB A;  3LW6 A;  5JQQ A;  2X5S A;  1FOA A; 
#chains in the Genus database with same CATH homology
 1OQM B;  1S4N A;  2RIT A;  3TZT A;  2OEG A;  5C4B A;  1ZJP A;  4HO9 A;  2VXL A;  1LZI A;  3F1Y A;  4NAN A;  1HM9 A;  5D92 A;  2WEE A;  1NKH B;  3USQ A;  3V0Q A;  1QG8 A;  4MND A;  2ICY A;  1YP4 A;  2V0J A;  4NAL A;  3ZGG A;  2Z86 A;  3V0L A;  4FRE A;  2GGQ A;  2RJ9 A;  3PNN A;  2RIZ A;  4B4B A;  4CJ8 A;  1R7T A;  1VH3 A;  1JVG A;  3T7O A;  2I5K A;  2WVL A;  2OI7 A;  3BCV A;  4O6M A;  4LW3 A;  3SX8 A;  3FOQ A;  2YC5 A;  2ICX A;  3Q80 A;  3OGZ A;  1H7H A;  2VSH A;  5FV9 A;  3CKN A;  4FRB A;  2O1F A;  1S4O A;  1G2V A;  1GX0 A;  4EEA A;  3CKO A;  1I52 A;  4HO4 A;  4IRQ A;  3V8Y A;  4EE5 A;  1WT1 A;  1LZ7 A;  2YQJ A;  1WT2 A;  5IDS A;  1WT3 A;  4D11 C;  2Y4J A;  3DK5 A;  2FYC B;  3JUJ A;  1YP3 A;  3SXE A;  2WVM A;  2Y7A A;  1HM8 A;  1YRO B;  2OI5 A;  5EJZ A;  1LZ0 A;  1NWG B;  1SS9 A;  5C4E A;  1G97 A;  1VGW A;  4EVW A;  4HO5 A;  4Y64 A;  1FXJ A;  1ZI5 A;  5CMG X;  1PZY B;  4EE3 A;  3I0J A;  1IIN A;  1ZI3 A;  3ZLK A;  5CMF X;  1QWJ A;  2I7B A;  4HO2 A;  4FQW A;  1VGU A;  1FO8 A;  3SXA A;  1HJL A;  2Z87 A;  3HL3 A;  3T7N A;  2YES A;  1R82 A;  1R81 A;  1TZF A;  3I0G A;  5C47 A;  5DDV A;  3OKR A;  4FRM A;  2DPW A;  1H5S D;  3IOH A;  1FWY A;  1R7Y A;  1H4E A;  4DEC A;  4CVH A;  5C1L A;  2AM3 A;  2A8U A;  1FXO A;  2RIY A;  2JCJ A;  1VH1 A;  5CQN X;  1FGG A;  4IRP A;  3U0X A;  2FFU A;  1V82 A;  4FRL A;  3I0H A;  1LL3 A;  3ST8 A;  5CQO A;  3V0N A;  3U2X A;  2GGO A;  3V0M A;  3V90 A;  1GWV A;  4CJB A;  4Q7C A;  2AES A;  3BRK X;  4FIX A;  3K8E A;  4FRO A;  3SX3 A;  1ZCV A;  1WSZ A;  5C3D A;  3OH4 A;  4JIS A;  1TVY A;  1ZCY A;  1NQI B;  2PA4 A;  2AM4 A;  2I5E A;  5C8R A;  2RJ7 A;  4DE7 A;  3SXC A;  2XME A;  3E25 A;  2PGY A;  3U2W A;  3ZF8 A;  2X65 A;  1ON8 A;  4KT7 A;  5I1F A;  5D91 A;  5C3A A;  2V0L A;  2VK9 A;  1HV9 A;  2VS3 A;  1H7L A;  3JTJ A;  1QGQ A;  2BO4 A;  2YQC A;  4B4M A;  2Q4J A;  4GBP A;  3SXD A;  2YQS A;  1TW5 A;  1GQ9 A;  1H5T A;  5C38 A;  4G3S A;  2QKX A;  4FRH A;  5CQP A;  1WVC A;  1ZJ2 A;  2AH9 A;  4L41 C;  4M28 A;  5C4F A;  2BO6 A;  1E5K A;  4UEG A;  4Y7G A;  4Y9X A;  4M4K A;  2JCO A;  3I0I X;  5L6S A;  3EE5 A;  3OH1 A;  3T7M A;  2JCK A;  1TW1 A;  4NAI A;  5FYE A;  2AGD A;  2X5Z A;  4FIY A;  4EEO A;  1H5T B;  2PX7 A;  5IFY A;  1G93 A;  3CKQ A;  2O1G A;  4D11 A;  4R7P A;  3U2V A;  3SXB A;  4O6N A;  5FTV A;  1ZDF A;  5C36 A;  1W77 A;  2UX8 A;  1MP5 A;  1NMM B;  2XWN A;  5FTS A;  4FRQ A;  4EEM A;  4B2W A;  4CJC A;  2YC3 A;  1G95 A;  1VZX A;  5C4D A;  1GX4 A;  2PGV A;  4Y6N A;  2RJ4 A;  2XWL A;  1VGZ A;  1H3M A;  3V8Z A;  5FU8 A;  4YS8 A;  1INJ A;  3ZLL A;  1LL2 A;  1H5S C;  1R80 A;  2D7I A;  3CGX A;  1VIC A;  1O23 B;  1HJJ A;  4XWI A;  3RMV A;  5HS2 A;  4Y7T A;  2ZU9 A;  4M2B A;  3NGW A;  3CKV A;  1FGX A;  3O3P A;  1ZIZ A;  4G87 A;  4HO0 A;  3V0P A;  1ZI1 A;  5L6V A;  2V0K A;  4BMA A;  2OI6 A;  2W0V A;  4AAW A;  1EYR A;  1H7Q A;  1H4D A;  3U2T A;  1W55 A;  4Y6U A;  4HG6 A;  2FYD B;  1HM0 A;  1KWS A;  3R2W A;  4D0T A;  1Z90 A;  3D8V A;  4B3U A;  4ZDQ A;  4JD0 A;  2Y4K A;  5IDT A;  2W0W A;  4MIX A;  1MC3 A;  1O7O A;  3I0K A;  2AM5 A;  3PKQ A;  2WGZ A;  4P00 A;  4FCU A;  5AJN A;  1R7V A;  4KXO A;  2P6W A;  4B2X A;  2VFZ A;  3JUK A;  1VGT A;  2D7R A;  4HO3 A;  1FR8 A;  4KNR A;  1ON6 A;  2VXM A;  3K8D A;  1V84 A;  3V0O A;  3CU0 A;  4G3Q A;  4E1K A;  2RJ0 A;  4FCE A;  4DDZ A;  5C48 A;  2BO7 A;  1VZT A;  5CMH A;  1JYK A;  2FYA A;  2ZU8 A;  2AE7 A;  2O1H A;  2QGI A;  1ZDG A;  4KPZ A;  3CKJ A;  2D0J A;  2J0A A;  4FRA A;  1INI A;  5J49 A;  1YP2 A;  5C1G A;  2C0N A;  2Y4L A;  3TQD A;  1V83 A;  3GUE A;  3I0L A;  4P02 A;  1O0R A;  1WT0 A;  2X60 A;  5AJO A;  2FYB A;  5CQL X;  3QVB A;  1GA8 A;  3E26 A;  4C2S A;  3I0D A;  4B5B A;  5AJP A;  5C1H A;  2Y6P A;  4Y63 A;  2XMH A;  1JVD A;  4M2A A;  3USR A;  1K4V A;  3IOJ A;  3Q4S A;  1G0R A;  2RIX A;  1LZJ A;  5CMI A;  1ZJO A;  1NHE B;  3I0E A;  4FRP A;  2NXV A;  4ECM A;  1PZT A;  1H7E A;  4EE4 A;  1ZCU A;  3U2U A;  1ZCT A;  2J0B A;  5FUH A;  3ZGF A;  2RJ5 A;  1FZW A;  1R7X A;  4FRD A;  4G3P A;  3OH0 A;  3SXG A;  3OH2 A;  4D0Z A;  2AEC A;  3V91 A;  5FU0 A;  4ASY A;  4ASJ A;  2FFV A;  5DDT A;  2Y4M A;  1ZJ3 A;  3KIA A;  2P73 A;  4Y7F A;  4NAK A;  3RMW A;  4HCQ A;  4HOC A;  1H5S A;  1FG5 N;  2YCM A;  3R3I A;  4HO8 A;  2APC A;  4Y62 A;  2WAW A;  4AC3 A;  2VSI A;  4AYL A;  3OC9 A;  4KC2 A;  3POL A;  1ZHJ A;  1MP3 A;  1H5R A;  1ZJ0 A;  3N9W A;  1W57 A;  1XZ6 A;  4LW6 A;  1FRW A;  2JCL A;  1VZU A;  2A8W A;  3OH3 A;  1ZJ1 A;  2VS4 A;  3DUV A;  4KRV A;  3Q7U A;  2VS5 A;  2WVK A;  1O7Q A;  3I0F A;  1H5S B;  2FY7 A;  4KQL A;  2E3D A;  2P72 A;  1GWW A;  4BQH A;  1H7G A;  3FWW A;  4Y7V A;  1H7T A;  1JYL A;  1LL0 A;  3U0Y A;  5EIY A;  5C49 A;  1H5R B;  3I0C A;  1FO9 A;  3SX7 A;  4KNX A;  1OMX A;  2ZU7 A;  4KPX A;  4KC4 A;  1H4C A;  2CU2 A;  2OEF A;  4EEG A;  4AYJ A;  2YQH A;  1EZI A;  4J18 A;  1FR9 A;  2E8B A;  2MZB A;  1G9R A;  2V0I A;  2VD4 A;  2BO8 A;  3SPT A;  1IIM A;  5C3B A;  1H7F A;  1MP4 A;  3D98 A;  1R7U A;  4HO6 A;  4K6R A;  4MYB A;  5C4C A;  3DJ4 A;  1LVW A;  2RJ1 A;  4B4G A;  1NF5 B;  5BXC A;  1G3L A;  4Y7U A;  2RJ8 A;  3PKP A;  3F1C A;  1XHB A;  2QH5 A;  3D5N A;  5CQM X;  1JV3 A;  3SX5 A;  1ZI4 A;  4KC1 A;  4B42 A;  1S4P A;  5EJ1 A;  4ARW A;  1OMZ A;  3IOI A;  1JV1 A;  1GQC A;  2XWM A;  3OAM A;  1VPA A;  1G1L A;  1QGS A;  2V0H A;  2RJ6 A;  1G23 A;  4D48 A;  2WE9 A;  1G8O A;  5CMJ A;  1VM8 A;  3RSB A;  3LW6 A;  5JQQ A;  2X5S A;  1FOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...