3CKQA

Crystal structure of a mycobacterial protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
315
structure length
302
Chain Sequence
GLRDTRPGDTWLADRSWNRPGWTVAELEAAKAGRTISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVKSFYRRPLGGRVTELVARPLLAALRPELGCILQPLGGEYAATRELLTSVPFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRCGIPDSGVGLTQFVADGPEGQSYTQHTWPVSLADRPPMQAIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a UDP-glucose-specific glycosyltransferase from a Mycobacterium species.
pubmed doi rcsb
molecule tags Unknown function
total genus 83
structure length 302
sequence length 315
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ckqA00
1O0RA 2FYAA 1JVDA 2GGOA 2XMEA 1H5SC 1S4PA 1XHBA 5CMFX 3ZLLA 2Y7AA 2O1GA 2QKXA 1ZIZA 1G2VA 2X65A 1ON8A 1QGSA 1ZI3A 4Y7VA 5FYEA 2WVKA 4FRAA 3RMVA 5CQPA 1H5SB 1VPAA 3TZTA 1ZI1A 1MP5A 1G93A 4M28A 1ZJ3A 4G87A 4KXOA 3CKNA 4BMAA 1LL0A 4P00A 1NWGB 2RIXA 4ECMA 2GGQA 2OI6A 4KC2A 1H5RB 4B42A 3V8YA 3N9WA 3SXAA 2RIZA 2VFZA 3E25A 5EJ1A 2OI5A 1QG8A 2AM5A 4NAKA 2V0IA 2VS3A 4KPXA 5DDVA 2RJ0A 5J49A 3K8DA 4FCUA 4HOCA 3IOJA 4FROA 5AJNA 3FOQA 1VGUA 3R2WA 1R7VA 1TZFA 1ZI4A 3PNNA 4KC4A 1H7EA 3U2XA 3SXCA 4DE7A 1TW1A 2FYDB 1H7GA 1ZJ0A 3QVBA 1OMXA 4KT7A 1V82A 4D0ZA 3I0EA 4IRPA 3SXBA 3KIAA 2FY7A 2RJ8A 1GX4A 4ZDQA 4FRLA 2X5ZA 1ZJ2A 2Z86A 4FRHA 1H7QA 2Y4KA 3SPTA 1R7UA 4DDZA 1GWWA 3OH1A 1JV3A 2PGVA 4HO0A 2A8WA 2E8BA 2OEFA 1IINA 4GBPA 4HG6A 3T7OA 5FU0A 4NALA 1H5TA 1HJLA 3F1CA 2YQJA 3U2TA 4BQHA 5IDSA 2BO8A 5AJOA 3E26A 4B2WA 4Y7UA 1VICA 3U2VA 3CKJA 3CU0A 3I0GA 4ASYA 5C4EA 2ZU9A 1YP4A 2JCKA 2WE9A 2AH9A 2RIYA 5FTVA 5CMIA 1ZJOA 4Y7GA 2JCOA 4FCEA 3SXDA 4AYJA 2ICXA 1FRWA 2PGYA 1QGQA 1K4VA 3OH2A 4D48A 1GQCA 2ZU7A 2PX7A 4EEOA 3D5NA 2X60A 3DJ4A 2W0VA 1FO8A 4FREA 1O7OA 3FWWA 4Y6NA 2V0KA 1LL3A 1H5SA 5C1LA 3JTJA 3K8EA 4FRDA 3OGZA 4EEMA 4Y7FA 1VZUA 2ICYA 4KRVA 3Q80A 1EZIA 3IOHA 4EVWA 2E3DA 2FYCB 4EE5A 4M4KA 4Y63A 2I7BA 4B3UA 5C3BA 1H5RA 1HJJA 2YQHA 1R81A 1LL2A 5FTSA 4D11A 3OH0A 4HO5A 3OAMA 4D11C 2VD4A 4DECA 1FG5N 4MNDA 1INJA 4XWIA 2RJ6A 1W55A 3JUJA 4FQWA 1ZCUA 4B4BA 1MP4A 3OKRA 2JCJA 1IIMA 2VXMA 3I0HA 1PZYB 2P6WA 2FYBA 3I0FA 3DK5A 1FXOA 1LZJA 1PZTA 1W57A 1ZCYA 1H5SD 2AM3A 1GX0A 1OMZA 4MYBA 5CQMX 1XZ6A 2P72A 4HO4A 1TVYA 1JYKA 4ASJA 3I0CA 5L6SA 2D7IA 1JYLA 1H7FA 2Y4LA 1GQ9A 2VS5A 1HM8A 2AM4A 5FUHA 1LZ0A 3T7NA 1VH3A 5C3AA 2MZBA 2RJ9A 3V90A 3CKVA 3HL3A 4HO9A 3OC9A 2RITA 2A8UA 1Z90A 4EEAA 5C8RA 3ZF8A 4Y6UA 1WT0A 1QWJA 2W0WA 2QH5A 2VSHA 1H4DA 4HO2A 4KPZA 2BO4A 5EJZA 1VGZA 2WVMA 1FGGA 2YESA 1O7QA 1NF5B 1ZCVA 1LZIA 5CMHA 1E5KA 2RJ7A 3GUEA 4C2SA 3CKOA 3USRA 1WT3A 1R7YA 2Y4JA 2O1HA 1ZDGA 5FU8A 4HO3A 2VS4A 3SX8A 2FFUA 2WEEA 5CQLX 1G97A 1VGWA 5C48A 5FV9A 2AECA 4CJBA 4LW6A 2I5EA 1WT2A 3IOIA 3V0MA 2XWMA 1VGTA 2WGZA 3U2UA 2DPWA 1ZJPA 4KNXA 3RSBA 2UX8A 1R7TA 5IDTA 2I5KA 3V0OA 1G3LA 3ZGGA 5CQOA 3BRKX 2WVLA 2O1FA 1HM0A 2X5SA 4KNRA 1HM9A 3SXGA 3PKPA 2PA4A 2Y4MA 5I1FA 1FO9A 4P02A 4J18A 1FXJA 1WT1A 5C4BA 3D98A 2NXVA 5C3DA 1G23A 1JV1A 1INIA 1TW5A 2CU2A 4B4GA 2RJ1A 3RMWA 3O3PA 1VH1A 2FFVA 3U0XA 4FRQA 1I52A 1EYRA 1H7TA 4R7PA 1FZWA 1R82A 2OEGA 4UEGA 3SXEA 3I0KA 5AJPA 2ZU8A 4B4MA 1LZ7A 4HO6A 5C1HA 1YP3A 5C4CA 3I0LA 2V0HA 5C47A 1HV9A 2APCA 1GA8A 3SX5A 3POLA 3JUKA 5EIYA 1KWSA 4Y64A 4JISA 1MC3A 5C36A 3SX3A 3USQA 3DUVA 3U0YA 5L6VA 1V83A 5IFYA 2VSIA 1V84A 4KQLA 1VZTA 4IRQA 4D0TA 3Q4SA 4Y7TA 3V0NA 2YC3A 1S4NA 4B5BA 1ON6A 2QGIA 4EE4A 1JVGA 3LW6A 1H4CA 1H3MA 4HCQA 3SX7A 3ZGFA 4AAWA 3TQDA 1WVCA 1O23B 1FR8A 4K6RA 3EE5A 5C4DA 2AGDA 3I0IX 5C4FA 4JD0A 1S4OA 1YP2A 1W77A 5BXCA 5CMGX 1NQIB 3V8ZA 1ZDFA 5C38A 2RJ4A 4Y9XA 3PKQA 2Z87A 2D7RA 4CVHA 4KC1A 3I0JA 3Q7UA 1FWYA 1VZXA 2VXLA 1MP3A 3ZLKA 1FR9A 1G9RA 4EEGA 2YQCA 1NMMB 3V0LA 3OH3A 1H7LA 2RJ5A 1ZCTA 3CGXA 1GWVA 1H4EA 4G3QA 4E1KA 1G0RA 1H7HA 1OQMB 4M2AA 4LW3A 4EE3A 4M2BA 3BCVA 4AC3A 5CMJA 3V0QA 2WAWA 2XMHA 1R7XA 4FRPA 4YS8A 1NHEB 4G3SA 1ZI5A 2XWNA 4NAIA 3D8VA 4FRMA 1G8OA 4L41C 1SS9A 2XWLA 3V0PA 1G1LA 2YC5A 2Y6PA 5HS2A 1FGXA 4NANA 5C1GA 4B2XA 5C49A 3I0DA 1H5TB 3ST8A 2AESA 3CKQA 4G3PA 1WSZA 3OH4A 4Y62A 4CJ8A 2YQSA 4HO8A 2OI7A 4ARWA 1NKHB 2D0JA 2P73A 1VM8A 3R3IA 4CJCA 2BO6A 3V91A 1G95A 1FOAA 3NGWA 2BO7A 2JCLA 2AE7A 1R80A 1ZJ1A 3F1YA 5JQQA 4AYLA 2YCMA 3U2WA 1LVWA 3T7MA 2Q4JA 5DDTA 2V0JA 5CQNX 4FRBA 1YROB 2V0LA 1ZHJA
chains in the Genus database with same CATH superfamily
1O0RA 2FYAA 1JVDA 2GGOA 2XMEA 1H5SC 1S4PA 1XHBA 5CMFX 3ZLLA 2Y7AA 2O1GA 2QKXA 1ZIZA 1G2VA 2X65A 1ON8A 1QGSA 1ZI3A 4Y7VA 5FYEA 2WVKA 4FRAA 3RMVA 5CQPA 1H5SB 1VPAA 3TZTA 1ZI1A 1MP5A 1G93A 4M28A 1ZJ3A 4G87A 4KXOA 3CKNA 4BMAA 1LL0A 4P00A 1NWGB 2RIXA 4FIYA 4ECMA 2GGQA 2OI6A 4KC2A 1H5RB 4B42A 3V8YA 3N9WA 3SXAA 2RIZA 2VFZA 3E25A 5EJ1A 2OI5A 1QG8A 2AM5A 4NAKA 2V0IA 2VS3A 4KPXA 5DDVA 2RJ0A 5J49A 3K8DA 4FCUA 4HOCA 3IOJA 4FROA 5AJNA 3FOQA 1VGUA 3R2WA 1R7VA 1TZFA 1ZI4A 3PNNA 4KC4A 1H7EA 3U2XA 3SXCA 4DE7A 1TW1A 2FYDB 1H7GA 1ZJ0A 3QVBA 1OMXA 4KT7A 1V82A 4D0ZA 3I0EA 4IRPA 3SXBA 3KIAA 2FY7A 2RJ8A 1GX4A 4ZDQA 4FRLA 2X5ZA 1ZJ2A 2Z86A 4FRHA 1H7QA 2Y4KA 3SPTA 1R7UA 4DDZA 1GWWA 3OH1A 1JV3A 2PGVA 4HO0A 2A8WA 2E8BA 2OEFA 1IINA 4GBPA 4HG6A 3T7OA 5FU0A 4NALA 1H5TA 1HJLA 3F1CA 2YQJA 3U2TA 4BQHA 5IDSA 2BO8A 5AJOA 3E26A 4B2WA 4Y7UA 1VICA 3U2VA 3CKJA 3CU0A 3I0GA 4Q7CA 4ASYA 5C4EA 2ZU9A 1YP4A 2JCKA 2WE9A 2AH9A 2RIYA 5FTVA 5CMIA 1ZJOA 4Y7GA 2JCOA 4FCEA 3SXDA 4AYJA 2ICXA 1FRWA 2PGYA 5D91A 1QGQA 1K4VA 3OH2A 4D48A 1GQCA 2ZU7A 2PX7A 4EEOA 3D5NA 2X60A 3DJ4A 2W0VA 1FO8A 4FREA 1O7OA 3FWWA 4Y6NA 2V0KA 1LL3A 1H5SA 5C1LA 3JTJA 3K8EA 4FRDA 3OGZA 4EEMA 4Y7FA 1VZUA 2ICYA 4KRVA 3Q80A 1EZIA 3IOHA 4EVWA 2E3DA 2FYCB 4EE5A 4M4KA 4Y63A 2I7BA 4B3UA 5C3BA 1H5RA 1HJJA 2YQHA 1R81A 1LL2A 5FTSA 4D11A 3OH0A 4HO5A 3OAMA 4D11C 2VD4A 4DECA 1FG5N 4MNDA 1INJA 4XWIA 2RJ6A 1W55A 3JUJA 4FQWA 1ZCUA 4B4BA 1MP4A 3OKRA 2JCJA 1IIMA 2VXMA 3I0HA 1PZYB 2P6WA 2FYBA 3I0FA 3DK5A 1FXOA 1LZJA 1PZTA 1W57A 1ZCYA 1H5SD 2AM3A 1GX0A 1OMZA 4MYBA 5CQMX 1XZ6A 2P72A 4HO4A 1TVYA 1JYKA 4ASJA 3I0CA 5L6SA 2D7IA 1JYLA 1H7FA 2Y4LA 1GQ9A 2VS5A 1HM8A 2AM4A 5FUHA 2C0NA 1LZ0A 3T7NA 1VH3A 5C3AA 2MZBA 2RJ9A 3V90A 3CKVA 3HL3A 4HO9A 3OC9A 2RITA 2A8UA 1Z90A 4EEAA 5C8RA 3ZF8A 4Y6UA 1WT0A 1QWJA 2W0WA 2QH5A 2VSHA 1H4DA 4HO2A 4KPZA 2BO4A 5EJZA 1VGZA 2WVMA 1FGGA 2YESA 1O7QA 1NF5B 1ZCVA 1LZIA 5CMHA 1E5KA 2RJ7A 3GUEA 4C2SA 3CKOA 3USRA 1WT3A 1R7YA 2Y4JA 2O1HA 1ZDGA 5FU8A 4HO3A 2VS4A 3SX8A 2FFUA 2WEEA 5CQLX 1G97A 1VGWA 5C48A 5FV9A 2AECA 4CJBA 4LW6A 2I5EA 1WT2A 3IOIA 3V0MA 2XWMA 1VGTA 2WGZA 3U2UA 2DPWA 1ZJPA 4KNXA 3RSBA 2UX8A 1R7TA 5IDTA 2I5KA 3V0OA 1G3LA 3ZGGA 5CQOA 2VK9A 3BRKX 2WVLA 2O1FA 1HM0A 2X5SA 4KNRA 1HM9A 3SXGA 3PKPA 2PA4A 2Y4MA 5I1FA 1FO9A 4P02A 4J18A 1FXJA 1WT1A 5C4BA 3D98A 2NXVA 5C3DA 1G23A 1JV1A 1INIA 1TW5A 2CU2A 4B4GA 2RJ1A 3RMWA 3O3PA 1VH1A 2FFVA 4FIXA 4FRQA 3U0XA 1I52A 1EYRA 1H7TA 4R7PA 5D92A 1FZWA 1R82A 2OEGA 4UEGA 3SXEA 3I0KA 5AJPA 4O6MA 2ZU8A 4B4MA 1LZ7A 4HO6A 5C1HA 1YP3A 2J0AA 5C4CA 3I0LA 2V0HA 5C47A 1HV9A 2APCA 1GA8A 4MIXA 3SX5A 3POLA 3JUKA 5EIYA 1KWSA 4Y64A 4JISA 1MC3A 5C36A 3SX3A 3USQA 3DUVA 3U0YA 5L6VA 1V83A 5IFYA 2VSIA 1V84A 4KQLA 1VZTA 4IRQA 4D0TA 3Q4SA 4Y7TA 3V0NA 2YC3A 1S4NA 4B5BA 1ON6A 2QGIA 4EE4A 1JVGA 3LW6A 1H4CA 1H3MA 4HCQA 3SX7A 3ZGFA 4AAWA 3TQDA 1WVCA 1O23B 1FR8A 4K6RA 3EE5A 5C4DA 2AGDA 3I0IX 5C4FA 4JD0A 1S4OA 1YP2A 1W77A 5BXCA 5CMGX 1NQIB 3V8ZA 1ZDFA 5C38A 2RJ4A 4Y9XA 3PKQA 2Z87A 2D7RA 4CVHA 4KC1A 3I0JA 3Q7UA 1FWYA 1VZXA 2J0BA 2VXLA 1MP3A 3ZLKA 1FR9A 1G9RA 4EEGA 2YQCA 1NMMB 3V0LA 3OH3A 1H7LA 2RJ5A 1ZCTA 3CGXA 1GWVA 1H4EA 4G3QA 4E1KA 1G0RA 1H7HA 1OQMB 4M2AA 4LW3A 4EE3A 4M2BA 3BCVA 4AC3A 5CMJA 3V0QA 2WAWA 2XMHA 1R7XA 4FRPA 4YS8A 1NHEB 4G3SA 1ZI5A 2XWNA 4NAIA 3D8VA 4FRMA 4O6NA 1G8OA 4L41C 1SS9A 2XWLA 3V0PA 1G1LA 2YC5A 2Y6PA 5HS2A 1FGXA 4NANA 5C1GA 4B2XA 5C49A 3I0DA 1H5TB 3ST8A 2AESA 3CKQA 4G3PA 1WSZA 3OH4A 4Y62A 4CJ8A 2YQSA 4HO8A 2OI7A 4ARWA 1NKHB 2D0JA 2P73A 1VM8A 3R3IA 4CJCA 2BO6A 3V91A 1G95A 1FOAA 3NGWA 2BO7A 2JCLA 2AE7A 1R80A 1ZJ1A 3F1YA 5JQQA 4AYLA 2YCMA 3U2WA 1LVWA 3T7MA 2Q4JA 5DDTA 2V0JA 5CQNX 4FRBA 1YROB 2V0LA 1ZHJA
chains in the Genus database with same CATH topology
1O0RA 2FYAA 1JVDA 2GGOA 2XMEA 1H5SC 1S4PA 1XHBA 5CMFX 3ZLLA 2Y7AA 2O1GA 2QKXA 1ZIZA 1G2VA 2X65A 1ON8A 1QGSA 1ZI3A 4Y7VA 5FYEA 2WVKA 4FRAA 3RMVA 5CQPA 1H5SB 1VPAA 3TZTA 1ZI1A 1MP5A 1G93A 4M28A 1ZJ3A 4G87A 4KXOA 3CKNA 4BMAA 1LL0A 4P00A 1NWGB 2RIXA 4FIYA 4ECMA 2GGQA 2OI6A 4KC2A 1H5RB 4B42A 3V8YA 3N9WA 3SXAA 2RIZA 2VFZA 3E25A 5EJ1A 2OI5A 1QG8A 2AM5A 4NAKA 2V0IA 2VS3A 4KPXA 5DDVA 2RJ0A 5J49A 3K8DA 4FCUA 4HOCA 3IOJA 4FROA 5AJNA 3FOQA 1VGUA 3R2WA 1R7VA 1TZFA 1ZI4A 3PNNA 4KC4A 1H7EA 3U2XA 3SXCA 4DE7A 1TW1A 2FYDB 1H7GA 1ZJ0A 3QVBA 1OMXA 4KT7A 1V82A 4D0ZA 3I0EA 4IRPA 3SXBA 3KIAA 2FY7A 2RJ8A 1GX4A 4ZDQA 4FRLA 2X5ZA 1ZJ2A 2Z86A 4FRHA 1H7QA 2Y4KA 3SPTA 1R7UA 4DDZA 1GWWA 3OH1A 1JV3A 2PGVA 4HO0A 2A8WA 2E8BA 2OEFA 1IINA 4GBPA 4HG6A 3T7OA 5FU0A 4NALA 1H5TA 1HJLA 3F1CA 2YQJA 3U2TA 4BQHA 5IDSA 2BO8A 5AJOA 3E26A 4B2WA 4Y7UA 1VICA 3U2VA 3CKJA 3CU0A 3I0GA 4Q7CA 4ASYA 5C4EA 2ZU9A 1YP4A 2JCKA 2WE9A 2AH9A 2RIYA 5FTVA 5CMIA 1ZJOA 4Y7GA 2JCOA 4FCEA 3SXDA 4AYJA 2ICXA 1FRWA 2PGYA 5D91A 1QGQA 1K4VA 3OH2A 4D48A 1GQCA 2ZU7A 2PX7A 4EEOA 3D5NA 2X60A 3DJ4A 2W0VA 1FO8A 4FREA 1O7OA 3FWWA 4Y6NA 2V0KA 1LL3A 1H5SA 5C1LA 3JTJA 3K8EA 4FRDA 3OGZA 4EEMA 4Y7FA 1VZUA 2ICYA 4KRVA 3Q80A 1EZIA 3IOHA 4EVWA 2E3DA 2FYCB 4EE5A 4M4KA 4Y63A 2I7BA 4B3UA 5C3BA 1H5RA 1HJJA 2YQHA 1R81A 1LL2A 5FTSA 4D11A 3OH0A 4HO5A 3OAMA 4D11C 2VD4A 4DECA 1FG5N 4MNDA 1INJA 4XWIA 2RJ6A 1W55A 3JUJA 4FQWA 1ZCUA 4B4BA 1MP4A 3OKRA 2JCJA 1IIMA 2VXMA 3I0HA 1PZYB 2P6WA 2FYBA 3I0FA 3DK5A 1FXOA 1LZJA 1PZTA 1W57A 1ZCYA 1H5SD 2AM3A 1GX0A 1OMZA 4MYBA 5CQMX 1XZ6A 2P72A 4HO4A 1TVYA 1JYKA 4ASJA 3I0CA 5L6SA 2D7IA 1JYLA 1H7FA 2Y4LA 1GQ9A 2VS5A 1HM8A 2AM4A 5FUHA 2C0NA 1LZ0A 3T7NA 1VH3A 5C3AA 2MZBA 2RJ9A 3V90A 3CKVA 3HL3A 4HO9A 3OC9A 2RITA 2A8UA 1Z90A 4EEAA 5C8RA 3ZF8A 4Y6UA 1WT0A 1QWJA 2W0WA 2QH5A 2VSHA 1H4DA 4HO2A 4KPZA 2BO4A 5EJZA 1VGZA 2WVMA 1FGGA 2YESA 1O7QA 1NF5B 1ZCVA 1LZIA 5CMHA 1E5KA 2RJ7A 3GUEA 4C2SA 3CKOA 3USRA 1WT3A 1R7YA 2Y4JA 2O1HA 1ZDGA 5FU8A 4HO3A 2VS4A 3SX8A 2FFUA 2WEEA 5CQLX 1G97A 1VGWA 5C48A 5FV9A 2AECA 4CJBA 4LW6A 2I5EA 1WT2A 3IOIA 3V0MA 2XWMA 1VGTA 2WGZA 3U2UA 2DPWA 1ZJPA 4KNXA 3RSBA 2UX8A 1R7TA 5IDTA 2I5KA 3V0OA 1G3LA 3ZGGA 5CQOA 2VK9A 3BRKX 2WVLA 2O1FA 1HM0A 2X5SA 4KNRA 1HM9A 3SXGA 3PKPA 2PA4A 2Y4MA 5I1FA 1FO9A 4P02A 4J18A 1FXJA 1WT1A 5C4BA 3D98A 2NXVA 5C3DA 1G23A 1JV1A 1INIA 1TW5A 2CU2A 4B4GA 2RJ1A 3RMWA 3O3PA 1VH1A 2FFVA 4FIXA 4FRQA 3U0XA 1I52A 1EYRA 1H7TA 4R7PA 5D92A 1FZWA 1R82A 2OEGA 4UEGA 3SXEA 3I0KA 5AJPA 4O6MA 2ZU8A 4B4MA 1LZ7A 4HO6A 5C1HA 1YP3A 2J0AA 5C4CA 3I0LA 2V0HA 5C47A 1HV9A 2APCA 1GA8A 4MIXA 3SX5A 3POLA 3JUKA 5EIYA 1KWSA 4Y64A 4JISA 1MC3A 5C36A 3SX3A 3USQA 3DUVA 3U0YA 5L6VA 1V83A 5IFYA 2VSIA 1V84A 4KQLA 1VZTA 4IRQA 4D0TA 3Q4SA 4Y7TA 3V0NA 2YC3A 1S4NA 4B5BA 1ON6A 2QGIA 4EE4A 1JVGA 3LW6A 1H4CA 1H3MA 4HCQA 3SX7A 3ZGFA 4AAWA 3TQDA 1WVCA 1O23B 1FR8A 4K6RA 3EE5A 5C4DA 2AGDA 3I0IX 5C4FA 4JD0A 1S4OA 1YP2A 1W77A 5BXCA 5CMGX 1NQIB 3V8ZA 1ZDFA 5C38A 2RJ4A 4Y9XA 3PKQA 2Z87A 2D7RA 4CVHA 4KC1A 3I0JA 3Q7UA 1FWYA 1VZXA 2J0BA 2VXLA 1MP3A 3ZLKA 1FR9A 1G9RA 4EEGA 2YQCA 1NMMB 3V0LA 3OH3A 1H7LA 2RJ5A 1ZCTA 3CGXA 1GWVA 1H4EA 4G3QA 4E1KA 1G0RA 1H7HA 1OQMB 4M2AA 4LW3A 4EE3A 4M2BA 3BCVA 4AC3A 5CMJA 3V0QA 2WAWA 2XMHA 1R7XA 4FRPA 4YS8A 1NHEB 4G3SA 1ZI5A 2XWNA 4NAIA 3D8VA 4FRMA 4O6NA 1G8OA 4L41C 1SS9A 2XWLA 3V0PA 1G1LA 2YC5A 2Y6PA 5HS2A 1FGXA 4NANA 5C1GA 4B2XA 5C49A 3I0DA 1H5TB 3ST8A 2AESA 3CKQA 4G3PA 1WSZA 3OH4A 4Y62A 4CJ8A 2YQSA 4HO8A 2OI7A 4ARWA 1NKHB 2D0JA 2P73A 1VM8A 3R3IA 4CJCA 2BO6A 3V91A 1G95A 1FOAA 3NGWA 2BO7A 2JCLA 2AE7A 1R80A 1ZJ1A 3F1YA 5JQQA 4AYLA 2YCMA 3U2WA 1LVWA 3T7MA 2Q4JA 5DDTA 2V0JA 5CQNX 4FRBA 1YROB 2V0LA 1ZHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0R A;  2FYA A;  1JVD A;  2GGO A;  2XME A;  1H5S C;  1S4P A;  1XHB A;  5CMF X;  3ZLL A;  2Y7A A;  2O1G A;  2QKX A;  1ZIZ A;  1G2V A;  2X65 A;  1ON8 A;  1QGS A;  1ZI3 A;  4Y7V A;  5FYE A;  2WVK A;  4FRA A;  3RMV A;  5CQP A;  1H5S B;  1VPA A;  3TZT A;  1ZI1 A;  1MP5 A;  1G93 A;  4M28 A;  1ZJ3 A;  4G87 A;  4KXO A;  3CKN A;  4BMA A;  1LL0 A;  4P00 A;  1NWG B;  2RIX A;  4ECM A;  2GGQ A;  2OI6 A;  4KC2 A;  1H5R B;  4B42 A;  3V8Y A;  3N9W A;  3SXA A;  2RIZ A;  2VFZ A;  3E25 A;  5EJ1 A;  2OI5 A;  1QG8 A;  2AM5 A;  4NAK A;  2V0I A;  2VS3 A;  4KPX A;  5DDV A;  2RJ0 A;  5J49 A;  3K8D A;  4FCU A;  4HOC A;  3IOJ A;  4FRO A;  5AJN A;  3FOQ A;  1VGU A;  3R2W A;  1R7V A;  1TZF A;  1ZI4 A;  3PNN A;  4KC4 A;  1H7E A;  3U2X A;  3SXC A;  4DE7 A;  1TW1 A;  2FYD B;  1H7G A;  1ZJ0 A;  3QVB A;  1OMX A;  4KT7 A;  1V82 A;  4D0Z A;  3I0E A;  4IRP A;  3SXB A;  3KIA A;  2FY7 A;  2RJ8 A;  1GX4 A;  4ZDQ A;  4FRL A;  2X5Z A;  1ZJ2 A;  2Z86 A;  4FRH A;  1H7Q A;  2Y4K A;  3SPT A;  1R7U A;  4DDZ A;  1GWW A;  3OH1 A;  1JV3 A;  2PGV A;  4HO0 A;  2A8W A;  2E8B A;  2OEF A;  1IIN A;  4GBP A;  4HG6 A;  3T7O A;  5FU0 A;  4NAL A;  1H5T A;  1HJL A;  3F1C A;  2YQJ A;  3U2T A;  4BQH A;  5IDS A;  2BO8 A;  5AJO A;  3E26 A;  4B2W A;  4Y7U A;  1VIC A;  3U2V A;  3CKJ A;  3CU0 A;  3I0G A;  4ASY A;  5C4E A;  2ZU9 A;  1YP4 A;  2JCK A;  2WE9 A;  2AH9 A;  2RIY A;  5FTV A;  5CMI A;  1ZJO A;  4Y7G A;  2JCO A;  4FCE A;  3SXD A;  4AYJ A;  2ICX A;  1FRW A;  2PGY A;  1QGQ A;  1K4V A;  3OH2 A;  4D48 A;  1GQC A;  2ZU7 A;  2PX7 A;  4EEO A;  3D5N A;  2X60 A;  3DJ4 A;  2W0V A;  1FO8 A;  4FRE A;  1O7O A;  3FWW A;  4Y6N A;  2V0K A;  1LL3 A;  1H5S A;  5C1L A;  3JTJ A;  3K8E A;  4FRD A;  3OGZ A;  4EEM A;  4Y7F A;  1VZU A;  2ICY A;  4KRV A;  3Q80 A;  1EZI A;  3IOH A;  4EVW A;  2E3D A;  2FYC B;  4EE5 A;  4M4K A;  4Y63 A;  2I7B A;  4B3U A;  5C3B A;  1H5R A;  1HJJ A;  2YQH A;  1R81 A;  1LL2 A;  5FTS A;  4D11 A;  3OH0 A;  4HO5 A;  3OAM A;  4D11 C;  2VD4 A;  4DEC A;  1FG5 N;  4MND A;  1INJ A;  4XWI A;  2RJ6 A;  1W55 A;  3JUJ A;  4FQW A;  1ZCU A;  4B4B A;  1MP4 A;  3OKR A;  2JCJ A;  1IIM A;  2VXM A;  3I0H A;  1PZY B;  2P6W A;  2FYB A;  3I0F A;  3DK5 A;  1FXO A;  1LZJ A;  1PZT A;  1W57 A;  1ZCY A;  1H5S D;  2AM3 A;  1GX0 A;  1OMZ A;  4MYB A;  5CQM X;  1XZ6 A;  2P72 A;  4HO4 A;  1TVY A;  1JYK A;  4ASJ A;  3I0C A;  5L6S A;  2D7I A;  1JYL A;  1H7F A;  2Y4L A;  1GQ9 A;  2VS5 A;  1HM8 A;  2AM4 A;  5FUH A;  1LZ0 A;  3T7N A;  1VH3 A;  5C3A A;  2MZB A;  2RJ9 A;  3V90 A;  3CKV A;  3HL3 A;  4HO9 A;  3OC9 A;  2RIT A;  2A8U A;  1Z90 A;  4EEA A;  5C8R A;  3ZF8 A;  4Y6U A;  1WT0 A;  1QWJ A;  2W0W A;  2QH5 A;  2VSH A;  1H4D A;  4HO2 A;  4KPZ A;  2BO4 A;  5EJZ A;  1VGZ A;  2WVM A;  1FGG A;  2YES A;  1O7Q A;  1NF5 B;  1ZCV A;  1LZI A;  5CMH A;  1E5K A;  2RJ7 A;  3GUE A;  4C2S A;  3CKO A;  3USR A;  1WT3 A;  1R7Y A;  2Y4J A;  2O1H A;  1ZDG A;  5FU8 A;  4HO3 A;  2VS4 A;  3SX8 A;  2FFU A;  2WEE A;  5CQL X;  1G97 A;  1VGW A;  5C48 A;  5FV9 A;  2AEC A;  4CJB A;  4LW6 A;  2I5E A;  1WT2 A;  3IOI A;  3V0M A;  2XWM A;  1VGT A;  2WGZ A;  3U2U A;  2DPW A;  1ZJP A;  4KNX A;  3RSB A;  2UX8 A;  1R7T A;  5IDT A;  2I5K A;  3V0O A;  1G3L A;  3ZGG A;  5CQO A;  3BRK X;  2WVL A;  2O1F A;  1HM0 A;  2X5S A;  4KNR A;  1HM9 A;  3SXG A;  3PKP A;  2PA4 A;  2Y4M A;  5I1F A;  1FO9 A;  4P02 A;  4J18 A;  1FXJ A;  1WT1 A;  5C4B A;  3D98 A;  2NXV A;  5C3D A;  1G23 A;  1JV1 A;  1INI A;  1TW5 A;  2CU2 A;  4B4G A;  2RJ1 A;  3RMW A;  3O3P A;  1VH1 A;  2FFV A;  3U0X A;  4FRQ A;  1I52 A;  1EYR A;  1H7T A;  4R7P A;  1FZW A;  1R82 A;  2OEG A;  4UEG A;  3SXE A;  3I0K A;  5AJP A;  2ZU8 A;  4B4M A;  1LZ7 A;  4HO6 A;  5C1H A;  1YP3 A;  5C4C A;  3I0L A;  2V0H A;  5C47 A;  1HV9 A;  2APC A;  1GA8 A;  3SX5 A;  3POL A;  3JUK A;  5EIY A;  1KWS A;  4Y64 A;  4JIS A;  1MC3 A;  5C36 A;  3SX3 A;  3USQ A;  3DUV A;  3U0Y A;  5L6V A;  1V83 A;  5IFY A;  2VSI A;  1V84 A;  4KQL A;  1VZT A;  4IRQ A;  4D0T A;  3Q4S A;  4Y7T A;  3V0N A;  2YC3 A;  1S4N A;  4B5B A;  1ON6 A;  2QGI A;  4EE4 A;  1JVG A;  3LW6 A;  1H4C A;  1H3M A;  4HCQ A;  3SX7 A;  3ZGF A;  4AAW A;  3TQD A;  1WVC A;  1O23 B;  1FR8 A;  4K6R A;  3EE5 A;  5C4D A;  2AGD A;  3I0I X;  5C4F A;  4JD0 A;  1S4O A;  1YP2 A;  1W77 A;  5BXC A;  5CMG X;  1NQI B;  3V8Z A;  1ZDF A;  5C38 A;  2RJ4 A;  4Y9X A;  3PKQ A;  2Z87 A;  2D7R A;  4CVH A;  4KC1 A;  3I0J A;  3Q7U A;  1FWY A;  1VZX A;  2VXL A;  1MP3 A;  3ZLK A;  1FR9 A;  1G9R A;  4EEG A;  2YQC A;  1NMM B;  3V0L A;  3OH3 A;  1H7L A;  2RJ5 A;  1ZCT A;  3CGX A;  1GWV A;  1H4E A;  4G3Q A;  4E1K A;  1G0R A;  1H7H A;  1OQM B;  4M2A A;  4LW3 A;  4EE3 A;  4M2B A;  3BCV A;  4AC3 A;  5CMJ A;  3V0Q A;  2WAW A;  2XMH A;  1R7X A;  4FRP A;  4YS8 A;  1NHE B;  4G3S A;  1ZI5 A;  2XWN A;  4NAI A;  3D8V A;  4FRM A;  1G8O A;  4L41 C;  1SS9 A;  2XWL A;  3V0P A;  1G1L A;  2YC5 A;  2Y6P A;  5HS2 A;  1FGX A;  4NAN A;  5C1G A;  4B2X A;  5C49 A;  3I0D A;  1H5T B;  3ST8 A;  2AES A;  3CKQ A;  4G3P A;  1WSZ A;  3OH4 A;  4Y62 A;  4CJ8 A;  2YQS A;  4HO8 A;  2OI7 A;  4ARW A;  1NKH B;  2D0J A;  2P73 A;  1VM8 A;  3R3I A;  4CJC A;  2BO6 A;  3V91 A;  1G95 A;  1FOA A;  3NGW A;  2BO7 A;  2JCL A;  2AE7 A;  1R80 A;  1ZJ1 A;  3F1Y A;  5JQQ A;  4AYL A;  2YCM A;  3U2W A;  1LVW A;  3T7M A;  2Q4J A;  5DDT A;  2V0J A;  5CQN X;  4FRB A;  1YRO B;  2V0L A;  1ZHJ A; 
#chains in the Genus database with same CATH topology
 1O0R A;  2FYA A;  1JVD A;  2GGO A;  2XME A;  1H5S C;  1S4P A;  1XHB A;  5CMF X;  3ZLL A;  2Y7A A;  2O1G A;  2QKX A;  1ZIZ A;  1G2V A;  2X65 A;  1ON8 A;  1QGS A;  1ZI3 A;  4Y7V A;  5FYE A;  2WVK A;  4FRA A;  3RMV A;  5CQP A;  1H5S B;  1VPA A;  3TZT A;  1ZI1 A;  1MP5 A;  1G93 A;  4M28 A;  1ZJ3 A;  4G87 A;  4KXO A;  3CKN A;  4BMA A;  1LL0 A;  4P00 A;  1NWG B;  2RIX A;  4FIY A;  4ECM A;  2GGQ A;  2OI6 A;  4KC2 A;  1H5R B;  4B42 A;  3V8Y A;  3N9W A;  3SXA A;  2RIZ A;  2VFZ A;  3E25 A;  5EJ1 A;  2OI5 A;  1QG8 A;  2AM5 A;  4NAK A;  2V0I A;  2VS3 A;  4KPX A;  5DDV A;  2RJ0 A;  5J49 A;  3K8D A;  4FCU A;  4HOC A;  3IOJ A;  4FRO A;  5AJN A;  3FOQ A;  1VGU A;  3R2W A;  1R7V A;  1TZF A;  1ZI4 A;  3PNN A;  4KC4 A;  1H7E A;  3U2X A;  3SXC A;  4DE7 A;  1TW1 A;  2FYD B;  1H7G A;  1ZJ0 A;  3QVB A;  1OMX A;  4KT7 A;  1V82 A;  4D0Z A;  3I0E A;  4IRP A;  3SXB A;  3KIA A;  2FY7 A;  2RJ8 A;  1GX4 A;  4ZDQ A;  4FRL A;  2X5Z A;  1ZJ2 A;  2Z86 A;  4FRH A;  1H7Q A;  2Y4K A;  3SPT A;  1R7U A;  4DDZ A;  1GWW A;  3OH1 A;  1JV3 A;  2PGV A;  4HO0 A;  2A8W A;  2E8B A;  2OEF A;  1IIN A;  4GBP A;  4HG6 A;  3T7O A;  5FU0 A;  4NAL A;  1H5T A;  1HJL A;  3F1C A;  2YQJ A;  3U2T A;  4BQH A;  5IDS A;  2BO8 A;  5AJO A;  3E26 A;  4B2W A;  4Y7U A;  1VIC A;  3U2V A;  3CKJ A;  3CU0 A;  3I0G A;  4Q7C A;  4ASY A;  5C4E A;  2ZU9 A;  1YP4 A;  2JCK A;  2WE9 A;  2AH9 A;  2RIY A;  5FTV A;  5CMI A;  1ZJO A;  4Y7G A;  2JCO A;  4FCE A;  3SXD A;  4AYJ A;  2ICX A;  1FRW A;  2PGY A;  5D91 A;  1QGQ A;  1K4V A;  3OH2 A;  4D48 A;  1GQC A;  2ZU7 A;  2PX7 A;  4EEO A;  3D5N A;  2X60 A;  3DJ4 A;  2W0V A;  1FO8 A;  4FRE A;  1O7O A;  3FWW A;  4Y6N A;  2V0K A;  1LL3 A;  1H5S A;  5C1L A;  3JTJ A;  3K8E A;  4FRD A;  3OGZ A;  4EEM A;  4Y7F A;  1VZU A;  2ICY A;  4KRV A;  3Q80 A;  1EZI A;  3IOH A;  4EVW A;  2E3D A;  2FYC B;  4EE5 A;  4M4K A;  4Y63 A;  2I7B A;  4B3U A;  5C3B A;  1H5R A;  1HJJ A;  2YQH A;  1R81 A;  1LL2 A;  5FTS A;  4D11 A;  3OH0 A;  4HO5 A;  3OAM A;  4D11 C;  2VD4 A;  4DEC A;  1FG5 N;  4MND A;  1INJ A;  4XWI A;  2RJ6 A;  1W55 A;  3JUJ A;  4FQW A;  1ZCU A;  4B4B A;  1MP4 A;  3OKR A;  2JCJ A;  1IIM A;  2VXM A;  3I0H A;  1PZY B;  2P6W A;  2FYB A;  3I0F A;  3DK5 A;  1FXO A;  1LZJ A;  1PZT A;  1W57 A;  1ZCY A;  1H5S D;  2AM3 A;  1GX0 A;  1OMZ A;  4MYB A;  5CQM X;  1XZ6 A;  2P72 A;  4HO4 A;  1TVY A;  1JYK A;  4ASJ A;  3I0C A;  5L6S A;  2D7I A;  1JYL A;  1H7F A;  2Y4L A;  1GQ9 A;  2VS5 A;  1HM8 A;  2AM4 A;  5FUH A;  2C0N A;  1LZ0 A;  3T7N A;  1VH3 A;  5C3A A;  2MZB A;  2RJ9 A;  3V90 A;  3CKV A;  3HL3 A;  4HO9 A;  3OC9 A;  2RIT A;  2A8U A;  1Z90 A;  4EEA A;  5C8R A;  3ZF8 A;  4Y6U A;  1WT0 A;  1QWJ A;  2W0W A;  2QH5 A;  2VSH A;  1H4D A;  4HO2 A;  4KPZ A;  2BO4 A;  5EJZ A;  1VGZ A;  2WVM A;  1FGG A;  2YES A;  1O7Q A;  1NF5 B;  1ZCV A;  1LZI A;  5CMH A;  1E5K A;  2RJ7 A;  3GUE A;  4C2S A;  3CKO A;  3USR A;  1WT3 A;  1R7Y A;  2Y4J A;  2O1H A;  1ZDG A;  5FU8 A;  4HO3 A;  2VS4 A;  3SX8 A;  2FFU A;  2WEE A;  5CQL X;  1G97 A;  1VGW A;  5C48 A;  5FV9 A;  2AEC A;  4CJB A;  4LW6 A;  2I5E A;  1WT2 A;  3IOI A;  3V0M A;  2XWM A;  1VGT A;  2WGZ A;  3U2U A;  2DPW A;  1ZJP A;  4KNX A;  3RSB A;  2UX8 A;  1R7T A;  5IDT A;  2I5K A;  3V0O A;  1G3L A;  3ZGG A;  5CQO A;  2VK9 A;  3BRK X;  2WVL A;  2O1F A;  1HM0 A;  2X5S A;  4KNR A;  1HM9 A;  3SXG A;  3PKP A;  2PA4 A;  2Y4M A;  5I1F A;  1FO9 A;  4P02 A;  4J18 A;  1FXJ A;  1WT1 A;  5C4B A;  3D98 A;  2NXV A;  5C3D A;  1G23 A;  1JV1 A;  1INI A;  1TW5 A;  2CU2 A;  4B4G A;  2RJ1 A;  3RMW A;  3O3P A;  1VH1 A;  2FFV A;  4FIX A;  4FRQ A;  3U0X A;  1I52 A;  1EYR A;  1H7T A;  4R7P A;  5D92 A;  1FZW A;  1R82 A;  2OEG A;  4UEG A;  3SXE A;  3I0K A;  5AJP A;  4O6M A;  2ZU8 A;  4B4M A;  1LZ7 A;  4HO6 A;  5C1H A;  1YP3 A;  2J0A A;  5C4C A;  3I0L A;  2V0H A;  5C47 A;  1HV9 A;  2APC A;  1GA8 A;  4MIX A;  3SX5 A;  3POL A;  3JUK A;  5EIY A;  1KWS A;  4Y64 A;  4JIS A;  1MC3 A;  5C36 A;  3SX3 A;  3USQ A;  3DUV A;  3U0Y A;  5L6V A;  1V83 A;  5IFY A;  2VSI A;  1V84 A;  4KQL A;  1VZT A;  4IRQ A;  4D0T A;  3Q4S A;  4Y7T A;  3V0N A;  2YC3 A;  1S4N A;  4B5B A;  1ON6 A;  2QGI A;  4EE4 A;  1JVG A;  3LW6 A;  1H4C A;  1H3M A;  4HCQ A;  3SX7 A;  3ZGF A;  4AAW A;  3TQD A;  1WVC A;  1O23 B;  1FR8 A;  4K6R A;  3EE5 A;  5C4D A;  2AGD A;  3I0I X;  5C4F A;  4JD0 A;  1S4O A;  1YP2 A;  1W77 A;  5BXC A;  5CMG X;  1NQI B;  3V8Z A;  1ZDF A;  5C38 A;  2RJ4 A;  4Y9X A;  3PKQ A;  2Z87 A;  2D7R A;  4CVH A;  4KC1 A;  3I0J A;  3Q7U A;  1FWY A;  1VZX A;  2J0B A;  2VXL A;  1MP3 A;  3ZLK A;  1FR9 A;  1G9R A;  4EEG A;  2YQC A;  1NMM B;  3V0L A;  3OH3 A;  1H7L A;  2RJ5 A;  1ZCT A;  3CGX A;  1GWV A;  1H4E A;  4G3Q A;  4E1K A;  1G0R A;  1H7H A;  1OQM B;  4M2A A;  4LW3 A;  4EE3 A;  4M2B A;  3BCV A;  4AC3 A;  5CMJ A;  3V0Q A;  2WAW A;  2XMH A;  1R7X A;  4FRP A;  4YS8 A;  1NHE B;  4G3S A;  1ZI5 A;  2XWN A;  4NAI A;  3D8V A;  4FRM A;  4O6N A;  1G8O A;  4L41 C;  1SS9 A;  2XWL A;  3V0P A;  1G1L A;  2YC5 A;  2Y6P A;  5HS2 A;  1FGX A;  4NAN A;  5C1G A;  4B2X A;  5C49 A;  3I0D A;  1H5T B;  3ST8 A;  2AES A;  3CKQ A;  4G3P A;  1WSZ A;  3OH4 A;  4Y62 A;  4CJ8 A;  2YQS A;  4HO8 A;  2OI7 A;  4ARW A;  1NKH B;  2D0J A;  2P73 A;  1VM8 A;  3R3I A;  4CJC A;  2BO6 A;  3V91 A;  1G95 A;  1FOA A;  3NGW A;  2BO7 A;  2JCL A;  2AE7 A;  1R80 A;  1ZJ1 A;  3F1Y A;  5JQQ A;  4AYL A;  2YCM A;  3U2W A;  1LVW A;  3T7M A;  2Q4J A;  5DDT A;  2V0J A;  5CQN X;  4FRB A;  1YRO B;  2V0L A;  1ZHJ A; 
#chains in the Genus database with same CATH homology
 1O0R A;  2FYA A;  1JVD A;  2GGO A;  2XME A;  1H5S C;  1S4P A;  1XHB A;  5CMF X;  3ZLL A;  2Y7A A;  2O1G A;  2QKX A;  1ZIZ A;  1G2V A;  2X65 A;  1ON8 A;  1QGS A;  1ZI3 A;  4Y7V A;  5FYE A;  2WVK A;  4FRA A;  3RMV A;  5CQP A;  1H5S B;  1VPA A;  3TZT A;  1ZI1 A;  1MP5 A;  1G93 A;  4M28 A;  1ZJ3 A;  4G87 A;  4KXO A;  3CKN A;  4BMA A;  1LL0 A;  4P00 A;  1NWG B;  2RIX A;  4FIY A;  4ECM A;  2GGQ A;  2OI6 A;  4KC2 A;  1H5R B;  4B42 A;  3V8Y A;  3N9W A;  3SXA A;  2RIZ A;  2VFZ A;  3E25 A;  5EJ1 A;  2OI5 A;  1QG8 A;  2AM5 A;  4NAK A;  2V0I A;  2VS3 A;  4KPX A;  5DDV A;  2RJ0 A;  5J49 A;  3K8D A;  4FCU A;  4HOC A;  3IOJ A;  4FRO A;  5AJN A;  3FOQ A;  1VGU A;  3R2W A;  1R7V A;  1TZF A;  1ZI4 A;  3PNN A;  4KC4 A;  1H7E A;  3U2X A;  3SXC A;  4DE7 A;  1TW1 A;  2FYD B;  1H7G A;  1ZJ0 A;  3QVB A;  1OMX A;  4KT7 A;  1V82 A;  4D0Z A;  3I0E A;  4IRP A;  3SXB A;  3KIA A;  2FY7 A;  2RJ8 A;  1GX4 A;  4ZDQ A;  4FRL A;  2X5Z A;  1ZJ2 A;  2Z86 A;  4FRH A;  1H7Q A;  2Y4K A;  3SPT A;  1R7U A;  4DDZ A;  1GWW A;  3OH1 A;  1JV3 A;  2PGV A;  4HO0 A;  2A8W A;  2E8B A;  2OEF A;  1IIN A;  4GBP A;  4HG6 A;  3T7O A;  5FU0 A;  4NAL A;  1H5T A;  1HJL A;  3F1C A;  2YQJ A;  3U2T A;  4BQH A;  5IDS A;  2BO8 A;  5AJO A;  3E26 A;  4B2W A;  4Y7U A;  1VIC A;  3U2V A;  3CKJ A;  3CU0 A;  3I0G A;  4Q7C A;  4ASY A;  5C4E A;  2ZU9 A;  1YP4 A;  2JCK A;  2WE9 A;  2AH9 A;  2RIY A;  5FTV A;  5CMI A;  1ZJO A;  4Y7G A;  2JCO A;  4FCE A;  3SXD A;  4AYJ A;  2ICX A;  1FRW A;  2PGY A;  5D91 A;  1QGQ A;  1K4V A;  3OH2 A;  4D48 A;  1GQC A;  2ZU7 A;  2PX7 A;  4EEO A;  3D5N A;  2X60 A;  3DJ4 A;  2W0V A;  1FO8 A;  4FRE A;  1O7O A;  3FWW A;  4Y6N A;  2V0K A;  1LL3 A;  1H5S A;  5C1L A;  3JTJ A;  3K8E A;  4FRD A;  3OGZ A;  4EEM A;  4Y7F A;  1VZU A;  2ICY A;  4KRV A;  3Q80 A;  1EZI A;  3IOH A;  4EVW A;  2E3D A;  2FYC B;  4EE5 A;  4M4K A;  4Y63 A;  2I7B A;  4B3U A;  5C3B A;  1H5R A;  1HJJ A;  2YQH A;  1R81 A;  1LL2 A;  5FTS A;  4D11 A;  3OH0 A;  4HO5 A;  3OAM A;  4D11 C;  2VD4 A;  4DEC A;  1FG5 N;  4MND A;  1INJ A;  4XWI A;  2RJ6 A;  1W55 A;  3JUJ A;  4FQW A;  1ZCU A;  4B4B A;  1MP4 A;  3OKR A;  2JCJ A;  1IIM A;  2VXM A;  3I0H A;  1PZY B;  2P6W A;  2FYB A;  3I0F A;  3DK5 A;  1FXO A;  1LZJ A;  1PZT A;  1W57 A;  1ZCY A;  1H5S D;  2AM3 A;  1GX0 A;  1OMZ A;  4MYB A;  5CQM X;  1XZ6 A;  2P72 A;  4HO4 A;  1TVY A;  1JYK A;  4ASJ A;  3I0C A;  5L6S A;  2D7I A;  1JYL A;  1H7F A;  2Y4L A;  1GQ9 A;  2VS5 A;  1HM8 A;  2AM4 A;  5FUH A;  2C0N A;  1LZ0 A;  3T7N A;  1VH3 A;  5C3A A;  2MZB A;  2RJ9 A;  3V90 A;  3CKV A;  3HL3 A;  4HO9 A;  3OC9 A;  2RIT A;  2A8U A;  1Z90 A;  4EEA A;  5C8R A;  3ZF8 A;  4Y6U A;  1WT0 A;  1QWJ A;  2W0W A;  2QH5 A;  2VSH A;  1H4D A;  4HO2 A;  4KPZ A;  2BO4 A;  5EJZ A;  1VGZ A;  2WVM A;  1FGG A;  2YES A;  1O7Q A;  1NF5 B;  1ZCV A;  1LZI A;  5CMH A;  1E5K A;  2RJ7 A;  3GUE A;  4C2S A;  3CKO A;  3USR A;  1WT3 A;  1R7Y A;  2Y4J A;  2O1H A;  1ZDG A;  5FU8 A;  4HO3 A;  2VS4 A;  3SX8 A;  2FFU A;  2WEE A;  5CQL X;  1G97 A;  1VGW A;  5C48 A;  5FV9 A;  2AEC A;  4CJB A;  4LW6 A;  2I5E A;  1WT2 A;  3IOI A;  3V0M A;  2XWM A;  1VGT A;  2WGZ A;  3U2U A;  2DPW A;  1ZJP A;  4KNX A;  3RSB A;  2UX8 A;  1R7T A;  5IDT A;  2I5K A;  3V0O A;  1G3L A;  3ZGG A;  5CQO A;  2VK9 A;  3BRK X;  2WVL A;  2O1F A;  1HM0 A;  2X5S A;  4KNR A;  1HM9 A;  3SXG A;  3PKP A;  2PA4 A;  2Y4M A;  5I1F A;  1FO9 A;  4P02 A;  4J18 A;  1FXJ A;  1WT1 A;  5C4B A;  3D98 A;  2NXV A;  5C3D A;  1G23 A;  1JV1 A;  1INI A;  1TW5 A;  2CU2 A;  4B4G A;  2RJ1 A;  3RMW A;  3O3P A;  1VH1 A;  2FFV A;  4FIX A;  4FRQ A;  3U0X A;  1I52 A;  1EYR A;  1H7T A;  4R7P A;  5D92 A;  1FZW A;  1R82 A;  2OEG A;  4UEG A;  3SXE A;  3I0K A;  5AJP A;  4O6M A;  2ZU8 A;  4B4M A;  1LZ7 A;  4HO6 A;  5C1H A;  1YP3 A;  2J0A A;  5C4C A;  3I0L A;  2V0H A;  5C47 A;  1HV9 A;  2APC A;  1GA8 A;  4MIX A;  3SX5 A;  3POL A;  3JUK A;  5EIY A;  1KWS A;  4Y64 A;  4JIS A;  1MC3 A;  5C36 A;  3SX3 A;  3USQ A;  3DUV A;  3U0Y A;  5L6V A;  1V83 A;  5IFY A;  2VSI A;  1V84 A;  4KQL A;  1VZT A;  4IRQ A;  4D0T A;  3Q4S A;  4Y7T A;  3V0N A;  2YC3 A;  1S4N A;  4B5B A;  1ON6 A;  2QGI A;  4EE4 A;  1JVG A;  3LW6 A;  1H4C A;  1H3M A;  4HCQ A;  3SX7 A;  3ZGF A;  4AAW A;  3TQD A;  1WVC A;  1O23 B;  1FR8 A;  4K6R A;  3EE5 A;  5C4D A;  2AGD A;  3I0I X;  5C4F A;  4JD0 A;  1S4O A;  1YP2 A;  1W77 A;  5BXC A;  5CMG X;  1NQI B;  3V8Z A;  1ZDF A;  5C38 A;  2RJ4 A;  4Y9X A;  3PKQ A;  2Z87 A;  2D7R A;  4CVH A;  4KC1 A;  3I0J A;  3Q7U A;  1FWY A;  1VZX A;  2J0B A;  2VXL A;  1MP3 A;  3ZLK A;  1FR9 A;  1G9R A;  4EEG A;  2YQC A;  1NMM B;  3V0L A;  3OH3 A;  1H7L A;  2RJ5 A;  1ZCT A;  3CGX A;  1GWV A;  1H4E A;  4G3Q A;  4E1K A;  1G0R A;  1H7H A;  1OQM B;  4M2A A;  4LW3 A;  4EE3 A;  4M2B A;  3BCV A;  4AC3 A;  5CMJ A;  3V0Q A;  2WAW A;  2XMH A;  1R7X A;  4FRP A;  4YS8 A;  1NHE B;  4G3S A;  1ZI5 A;  2XWN A;  4NAI A;  3D8V A;  4FRM A;  4O6N A;  1G8O A;  4L41 C;  1SS9 A;  2XWL A;  3V0P A;  1G1L A;  2YC5 A;  2Y6P A;  5HS2 A;  1FGX A;  4NAN A;  5C1G A;  4B2X A;  5C49 A;  3I0D A;  1H5T B;  3ST8 A;  2AES A;  3CKQ A;  4G3P A;  1WSZ A;  3OH4 A;  4Y62 A;  4CJ8 A;  2YQS A;  4HO8 A;  2OI7 A;  4ARW A;  1NKH B;  2D0J A;  2P73 A;  1VM8 A;  3R3I A;  4CJC A;  2BO6 A;  3V91 A;  1G95 A;  1FOA A;  3NGW A;  2BO7 A;  2JCL A;  2AE7 A;  1R80 A;  1ZJ1 A;  3F1Y A;  5JQQ A;  4AYL A;  2YCM A;  3U2W A;  1LVW A;  3T7M A;  2Q4J A;  5DDT A;  2V0J A;  5CQN X;  4FRB A;  1YRO B;  2V0L A;  1ZHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...