1IIMA

Thymidylyltransferase complexed with ttp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glucose-1-phosphate thymidylyltransferase
publication title Structure, mechanism and engineering of a nucleotidylyltransferase as a first step toward glycorandomization.
pubmed doi rcsb
source organism Salmonella enterica
total genus 95
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1iimA00
1LL2A 1LVWA 3T7MA 3I0HA 4NAIA 1ZCVA 4Y6NA 4ZDQA 3JUJA 4HO2A 2XMEA 2YQSA 4EVWA 1GQCA 3CKQA 1H7EA 4FRPA 1MP3A 2RJ5A 1HM0A 4AYLA 4GBPA 4JD0A 1MP5A 2RJ1A 2D0JA 1ZJOA 5DDTA 4XWIA 5CQLX 4NAKA 1ZDFA 5C1HA 1VH1A 1OMXA 2P72A 1Z90A 4HO3A 1I52A 1G3LA 3LW6A 1V83A 2V0IA 3SXDA 1EYRA 2WGZA 1ZI1A 4G3SA 3OGZA 1JV3A 2JCJA 3SX3A 1H5SB 2WVKA 2D7IA 3OH1A 2I5EA 3I0EA 1INIA 1VZUA 5AJNA 1QGSA 2RJ6A 1G97A 2FFVA 1ZDGA 2AGDA 3BRKX 1FOAA 1JYKA 1K4VA 3CKJA 4HO0A 4MNDA 1QG8A 3ZGFA 2RJ9A 2FY7A 3N9WA 1G93A 4HO4A 4EEMA 1FG5N 1H7FA 3SXCA 4KXOA 4P00A 3USQA 5BXCA 2OI7A 5FYEA 2P6WA 4FRHA 5EIYA 4UEGA 1FO8A 2X5SA 4B2XA 1VPAA 3DUVA 2DPWA 2RIYA 2W0VA 2ZU8A 1G9RA 1YP4A 3I0CA 4CJ8A 2VD4A 2GGQA 2ICYA 3RSBA 1FO9A 4AAWA 4CJCA 2Q4JA 4D11C 1H5SA 1LZ7A 4M28A 3V91A 3CGXA 3IOJA 5CQOA 3V0MA 1VGWA 1ZI4A 4FRDA 2Y4MA 3V90A 4B3UA 2D7RA 3V0QA 2GGOA 2A8UA 4BMAA 3NGWA 3ZLKA 1W77A 3E26A 2RJ4A 1TZFA 4G3PA 5IDTA 1GA8A 1YROB 1INJA 5FTVA 1H7QA 4HO5A 3U2TA 2XWLA 1S4OA 3I0GA 2AESA 4EEAA 3OKRA 2YQCA 2FYAA 1R82A 1FR8A 1H4EA 4LW6A 1NMMB 3IOHA 2YQJA 5I1FA 1VH3A 1FGXA 2Y4KA 5C4DA 1VM8A 3EE5A 5L6VA 4JISA 3U2XA 4Y7VA 3K8DA 1HM8A 2QH5A 1JVGA 2RIXA 3SX8A 1VGZA 4DECA 1LL0A 2Z86A 4J18A 5J49A 4HO6A 2O1GA 2OI5A 1JVDA 1ZJ3A 4EEOA 2PGVA 2QKXA 2CU2A 4BQHA 1ON6A 3CU0A 3V8ZA 2A8WA 2V0KA 4FRMA 1H5TA 5C38A 2V0HA 1ZCUA 2YQHA 3FOQA 4Y62A 1H5RB 1G2VA 3PKQA 1KWSA 4EEGA 4AC3A 3I0JA 3D5NA 1G1LA 5JQQA 1GWWA 2JCLA 3K8EA 3OH2A 2YCMA 4HCQA 1V84A 1O7OA 2AM4A 2WAWA 3QVBA 2PX7A 3CKVA 2VS5A 5CQMX 4D0ZA 4Y6UA 2Y4JA 4KRVA 4M4KA 4E1KA 5C49A 3CKOA 2VS4A 1LL3A 1O23B 1OQMB 4KQLA 1FR9A 1G0RA 1ZI5A 2RITA 2WE9A 4FREA 5C1LA 2BO7A 1HJJA 3T7NA 1GQ9A 2XMHA 1PZTA 4NANA 1GWVA 2JCOA 5FU0A 1JYLA 4KC1A 1MC3A 1LZ0A 1W57A 4EE5A 3Q7UA 3D98A 4HG6A 2ZU9A 1QWJA 1SS9A 3I0DA 1H3MA 5AJPA 3OC9A 2QGIA 2MZBA 3I0FA 1R7VA 1VZTA 3U2VA 4B4GA 2XWMA 3U2WA 2X65A 1XHBA 1LZIA 1IINA 2Y6PA 3ZF8A 1O7QA 1R7TA 4FCEA 2AH9A 3R2WA 1WT2A 3OH0A 5C8RA 4B42A 3JUKA 1HV9A 5C4EA 3PNNA 3RMVA 3Q4SA 5EJZA 4HOCA 5FU8A 1EZIA 2YESA 5CMGX 4ECMA 2PA4A 5C3BA 2W0WA 2Y4LA 4Y64A 1WT1A 1ZJPA 1NWGB 4B4MA 3F1CA 3E25A 4MYBA 1H5SC 5FUHA 2BO8A 1R7YA 2FYDB 4Y7UA 5AJOA 3KIAA 1H7GA 2XWNA 4FRQA 4KNXA 4EE3A 1FXJA 3U2UA 3USRA 3GUEA 2V0LA 2FYBA 3V0OA 2RJ7A 1H4CA 1NKHB 1FRWA 3V8YA 5FTSA 2BO6A 2E3DA 3SX5A 1W55A 2AM5A 4G87A 5C4FA 1O0RA 2WEEA 1NHEB 3SXAA 4B2WA 1H4DA 2V0JA 3U0YA 3BCVA 1PZYB 1ZJ1A 5CMHA 3I0KA 3POLA 1V82A 4Y63A 5C36A 1LZJA 4ARWA 2X5ZA 2X60A 5DDVA 4Y7FA 2OI6A 3DJ4A 2NXVA 2AE7A 1MP4A 1R80A 2Z87A 4Y9XA 4EE4A 1JV1A 3V0LA 3U0XA 2APCA 3R3IA 1R7XA 2O1FA 1H5SD 1GX4A 2I5KA 4Y7GA 5C1GA 1VGTA 2RIZA 4LW3A 3T7OA 5C4CA 1ZJ2A 2ICXA 1WVCA 4CVHA 4R7PA 3D8VA 4C2SA 1VGUA 1FWYA 1VICA 5FV9A 4YS8A 1E5KA 1GX0A 3TZTA 3SXEA 1S4PA 2AM3A 3OAMA 2RJ0A 1ZJ0A 5CMFX 1VZXA 4HO9A 1XZ6A 4KC2A 1ON8A 1HM9A 4DDZA 2VXMA 1H5RA 2YC5A 4B5BA 3HL3A 5IFYA 4KC4A 3TQDA 4AYJA 1FXOA 2AECA 5C3DA 2VSHA 2VSIA 5C3AA 2YC3A 2VXLA 2ZU7A 2JCKA 3SXGA 2E8BA 4K6RA 2WVMA 5IDSA 5C47A 4M2BA 1QGQA 1WT0A 1H7LA 4D11A 2VS3A 1WT3A 2FFUA 4IRQA 4FCUA 1G8OA 4P02A 2BO4A 5C4BA 1FZWA 3ZLLA 2P73A 4Y7TA 3CKNA 5C48A 4ASYA 1TW5A 2PGYA 1TW1A 4ASJA 3Q80A 4KT7A 1FGGA 5CMIA 4D48A 3RMWA 5EJ1A 2FYCB 5HS2A 1YP3A 4CJBA 1ZCTA 3F1YA 4FRAA 4IRPA 4M2AA 1H7TA 3SPTA 4G3QA 2OEGA 1R81A 1ZI3A 2OEFA 3I0LA 3DK5A 4KPXA 2VFZA 1WSZA 3OH3A 3V0NA 4KPZA 3ST8A 1G95A 4HO8A 1IIMA 1H5TB 1ZIZA 4DE7A 2UX8A 1H7HA 2O1HA 3O3PA 3SXBA 4FRLA 5L6SA 2RJ8A 3I0IX 4NALA 5CQNX 3V0PA 1HJLA 3JTJA 2WVLA 1ZHJA 1ZCYA 4FROA 4L41C 1YP2A 1G23A 3IOIA 3PKPA 5CQPA 4B4BA 1NF5B 3OH4A 1S4NA 4FRBA 4D0TA 4FQWA 3SX7A 2Y7AA 4KNRA 1TVYA 1OMZA 3ZGGA 5CMJA 3FWWA 1R7UA 2I7BA 1NQIB
chains in the Genus database with same CATH superfamily
1LL2A 1LVWA 3T7MA 3I0HA 4NAIA 1ZCVA 4Y6NA 4ZDQA 3JUJA 4HO2A 2XMEA 2YQSA 4EVWA 1GQCA 3CKQA 1H7EA 4FRPA 1MP3A 2RJ5A 1HM0A 4AYLA 4GBPA 4JD0A 1MP5A 2RJ1A 2D0JA 1ZJOA 5DDTA 4XWIA 5CQLX 4NAKA 1ZDFA 5C1HA 1VH1A 1OMXA 2P72A 1Z90A 4HO3A 1I52A 1G3LA 3LW6A 1V83A 2V0IA 3SXDA 1EYRA 2WGZA 1ZI1A 4G3SA 3OGZA 1JV3A 2JCJA 3SX3A 1H5SB 2WVKA 2D7IA 3OH1A 2I5EA 3I0EA 1INIA 1VZUA 4Q7CA 1QGSA 5AJNA 2RJ6A 2J0BA 1G97A 2FFVA 1ZDGA 2AGDA 3BRKX 1FOAA 1JYKA 1K4VA 3CKJA 4HO0A 4MNDA 1QG8A 3ZGFA 2RJ9A 2FY7A 3N9WA 1G93A 4HO4A 4EEMA 1FG5N 1H7FA 3SXCA 4KXOA 4P00A 3USQA 5BXCA 2OI7A 5FYEA 2P6WA 4FRHA 5EIYA 4UEGA 1FO8A 2X5SA 4B2XA 1VPAA 3DUVA 2DPWA 2RIYA 2W0VA 2ZU8A 1G9RA 1YP4A 3I0CA 4CJ8A 2VD4A 2GGQA 2ICYA 3RSBA 1FO9A 4AAWA 4CJCA 2Q4JA 4D11C 1H5SA 1LZ7A 4M28A 3V91A 3CGXA 3IOJA 5CQOA 3V0MA 1VGWA 1ZI4A 4FRDA 2Y4MA 3V90A 4B3UA 2D7RA 3V0QA 2GGOA 2A8UA 4BMAA 3NGWA 4FIYA 3ZLKA 1W77A 3E26A 2RJ4A 1TZFA 4G3PA 5IDTA 1GA8A 1YROB 1INJA 5FTVA 1H7QA 4HO5A 3U2TA 2XWLA 1S4OA 3I0GA 2AESA 4EEAA 3OKRA 2YQCA 2FYAA 1R82A 1FR8A 1H4EA 4LW6A 1NMMB 3IOHA 2YQJA 5I1FA 1VH3A 1FGXA 2Y4KA 5C4DA 1VM8A 3EE5A 5L6VA 4JISA 3U2XA 4Y7VA 3K8DA 1HM8A 2QH5A 1JVGA 2RIXA 3SX8A 1VGZA 4DECA 1LL0A 2Z86A 4J18A 5J49A 4HO6A 2O1GA 2OI5A 1JVDA 1ZJ3A 4MIXA 4EEOA 2PGVA 2QKXA 2CU2A 4BQHA 1ON6A 3CU0A 3V8ZA 2A8WA 2V0KA 4FRMA 1H5TA 5C38A 2V0HA 4FIXA 1ZCUA 2YQHA 3FOQA 4Y62A 1H5RB 1G2VA 3PKQA 1KWSA 4EEGA 4AC3A 3I0JA 3D5NA 1G1LA 5JQQA 1GWWA 2JCLA 3K8EA 3OH2A 2YCMA 4HCQA 1V84A 1O7OA 2AM4A 2WAWA 3QVBA 2PX7A 3CKVA 2VS5A 5CQMX 4D0ZA 4Y6UA 2Y4JA 4KRVA 4M4KA 4E1KA 5C49A 3CKOA 2VS4A 1LL3A 1O23B 1OQMB 4KQLA 1FR9A 1G0RA 1ZI5A 2RITA 2WE9A 4FREA 5C1LA 2C0NA 2BO7A 1HJJA 3T7NA 1GQ9A 2XMHA 1PZTA 4NANA 1GWVA 2JCOA 5FU0A 1JYLA 4KC1A 1MC3A 1LZ0A 1W57A 4EE5A 3Q7UA 3D98A 4HG6A 2ZU9A 1QWJA 1SS9A 3I0DA 1H3MA 5AJPA 3OC9A 2QGIA 2MZBA 3I0FA 1R7VA 1VZTA 3U2VA 4B4GA 2XWMA 3U2WA 2X65A 1XHBA 1LZIA 1IINA 2Y6PA 3ZF8A 1O7QA 1R7TA 4FCEA 2AH9A 3R2WA 1WT2A 3OH0A 5C8RA 4B42A 3JUKA 1HV9A 5C4EA 3PNNA 3RMVA 3Q4SA 5EJZA 4HOCA 5FU8A 1EZIA 2YESA 5CMGX 4ECMA 2PA4A 5C3BA 2W0WA 2Y4LA 4Y64A 1WT1A 1ZJPA 1NWGB 2J0AA 4B4MA 3F1CA 3E25A 4MYBA 1H5SC 5FUHA 2BO8A 1R7YA 2FYDB 4Y7UA 5AJOA 3KIAA 1H7GA 2XWNA 4FRQA 4KNXA 4EE3A 1FXJA 3U2UA 3USRA 3GUEA 2V0LA 2FYBA 3V0OA 2RJ7A 1H4CA 1NKHB 1FRWA 3V8YA 5FTSA 2BO6A 2E3DA 3SX5A 1W55A 2AM5A 4G87A 5C4FA 1O0RA 2WEEA 1NHEB 3SXAA 4B2WA 1H4DA 2V0JA 3U0YA 3BCVA 1PZYB 1ZJ1A 5CMHA 3I0KA 3POLA 1V82A 4Y63A 5C36A 1LZJA 4ARWA 2X5ZA 2X60A 5DDVA 4O6NA 4Y7FA 2OI6A 3DJ4A 2NXVA 4O6MA 2AE7A 1MP4A 1R80A 2Z87A 2VK9A 4Y9XA 4EE4A 1JV1A 3V0LA 3U0XA 2APCA 3R3IA 1R7XA 2O1FA 1H5SD 1GX4A 2I5KA 4Y7GA 5C1GA 1VGTA 2RIZA 4LW3A 3T7OA 5C4CA 1ZJ2A 2ICXA 1WVCA 4CVHA 4R7PA 3D8VA 4C2SA 1VGUA 1FWYA 1VICA 5FV9A 4YS8A 1E5KA 1GX0A 3TZTA 3SXEA 1S4PA 2AM3A 3OAMA 2RJ0A 1ZJ0A 5CMFX 1VZXA 4HO9A 1XZ6A 4KC2A 1ON8A 1HM9A 4DDZA 2VXMA 1H5RA 2YC5A 4B5BA 3HL3A 5IFYA 4KC4A 3TQDA 4AYJA 1FXOA 2AECA 5C3DA 2VSHA 2VSIA 5C3AA 2YC3A 2VXLA 2ZU7A 2JCKA 3SXGA 2E8BA 4K6RA 2WVMA 5IDSA 5C47A 4M2BA 1QGQA 1WT0A 1H7LA 4D11A 2VS3A 1WT3A 2FFUA 4IRQA 4FCUA 1G8OA 4P02A 2BO4A 5C4BA 1FZWA 3ZLLA 2P73A 4Y7TA 3CKNA 5C48A 4ASYA 1TW5A 5D91A 2PGYA 1TW1A 4ASJA 3Q80A 4KT7A 1FGGA 5CMIA 4D48A 3RMWA 5EJ1A 2FYCB 5HS2A 1YP3A 4CJBA 1ZCTA 3F1YA 4FRAA 4IRPA 4M2AA 1H7TA 3SPTA 4G3QA 2OEGA 1R81A 1ZI3A 2OEFA 3I0LA 3DK5A 4KPXA 2VFZA 1WSZA 3OH3A 3V0NA 4KPZA 3ST8A 1G95A 4HO8A 1IIMA 1H5TB 1ZIZA 4DE7A 2UX8A 1H7HA 2O1HA 3O3PA 3SXBA 4FRLA 5L6SA 2RJ8A 3I0IX 4NALA 5CQNX 3V0PA 1HJLA 3JTJA 2WVLA 1ZHJA 1ZCYA 4FROA 4L41C 5D92A 1YP2A 1G23A 3IOIA 3PKPA 5CQPA 4B4BA 1NF5B 3OH4A 1S4NA 4FRBA 4D0TA 4FQWA 3SX7A 2Y7AA 4KNRA 1TVYA 1OMZA 3ZGGA 5CMJA 3FWWA 1R7UA 2I7BA 1NQIB
chains in the Genus database with same CATH topology
1LL2A 1LVWA 3T7MA 3I0HA 4NAIA 1ZCVA 4Y6NA 4ZDQA 3JUJA 4HO2A 2XMEA 2YQSA 4EVWA 1GQCA 3CKQA 1H7EA 4FRPA 1MP3A 2RJ5A 1HM0A 4AYLA 4GBPA 4JD0A 1MP5A 2RJ1A 2D0JA 1ZJOA 5DDTA 4XWIA 5CQLX 4NAKA 1ZDFA 5C1HA 1VH1A 1OMXA 2P72A 1Z90A 4HO3A 1I52A 1G3LA 3LW6A 1V83A 2V0IA 3SXDA 1EYRA 2WGZA 1ZI1A 4G3SA 3OGZA 1JV3A 2JCJA 3SX3A 1H5SB 2WVKA 2D7IA 3OH1A 2I5EA 3I0EA 1INIA 1VZUA 4Q7CA 1QGSA 5AJNA 2RJ6A 2J0BA 1G97A 2FFVA 1ZDGA 2AGDA 3BRKX 1FOAA 1JYKA 1K4VA 3CKJA 4HO0A 4MNDA 1QG8A 3ZGFA 2RJ9A 2FY7A 3N9WA 1G93A 4HO4A 4EEMA 1FG5N 1H7FA 3SXCA 4KXOA 4P00A 3USQA 5BXCA 2OI7A 5FYEA 2P6WA 4FRHA 5EIYA 4UEGA 1FO8A 2X5SA 4B2XA 1VPAA 3DUVA 2DPWA 2RIYA 2W0VA 2ZU8A 1G9RA 1YP4A 3I0CA 4CJ8A 2VD4A 2GGQA 2ICYA 3RSBA 1FO9A 4AAWA 4CJCA 2Q4JA 4D11C 1H5SA 1LZ7A 4M28A 3V91A 3CGXA 3IOJA 5CQOA 3V0MA 1VGWA 1ZI4A 4FRDA 2Y4MA 3V90A 4B3UA 2D7RA 3V0QA 2GGOA 2A8UA 4BMAA 3NGWA 4FIYA 3ZLKA 1W77A 3E26A 2RJ4A 1TZFA 4G3PA 5IDTA 1GA8A 1YROB 1INJA 5FTVA 1H7QA 4HO5A 3U2TA 2XWLA 1S4OA 3I0GA 2AESA 4EEAA 3OKRA 2YQCA 2FYAA 1R82A 1FR8A 1H4EA 4LW6A 1NMMB 3IOHA 2YQJA 5I1FA 1VH3A 1FGXA 2Y4KA 5C4DA 1VM8A 3EE5A 5L6VA 4JISA 3U2XA 4Y7VA 3K8DA 1HM8A 2QH5A 1JVGA 2RIXA 3SX8A 1VGZA 4DECA 1LL0A 2Z86A 4J18A 5J49A 4HO6A 2O1GA 2OI5A 1JVDA 1ZJ3A 4MIXA 4EEOA 2PGVA 2QKXA 2CU2A 4BQHA 1ON6A 3CU0A 3V8ZA 2A8WA 2V0KA 4FRMA 1H5TA 5C38A 2V0HA 4FIXA 1ZCUA 2YQHA 3FOQA 4Y62A 1H5RB 1G2VA 3PKQA 1KWSA 4EEGA 4AC3A 3I0JA 3D5NA 1G1LA 5JQQA 1GWWA 2JCLA 3K8EA 3OH2A 2YCMA 4HCQA 1V84A 1O7OA 2AM4A 2WAWA 3QVBA 2PX7A 3CKVA 2VS5A 5CQMX 4D0ZA 4Y6UA 2Y4JA 4KRVA 4M4KA 4E1KA 5C49A 3CKOA 2VS4A 1LL3A 1O23B 1OQMB 4KQLA 1FR9A 1G0RA 1ZI5A 2RITA 2WE9A 4FREA 5C1LA 2C0NA 2BO7A 1HJJA 3T7NA 1GQ9A 2XMHA 1PZTA 4NANA 1GWVA 2JCOA 5FU0A 1JYLA 4KC1A 1MC3A 1LZ0A 1W57A 4EE5A 3Q7UA 3D98A 4HG6A 2ZU9A 1QWJA 1SS9A 3I0DA 1H3MA 5AJPA 3OC9A 2QGIA 2MZBA 3I0FA 1R7VA 1VZTA 3U2VA 4B4GA 2XWMA 3U2WA 2X65A 1XHBA 1LZIA 1IINA 2Y6PA 3ZF8A 1O7QA 1R7TA 4FCEA 2AH9A 3R2WA 1WT2A 3OH0A 5C8RA 4B42A 3JUKA 1HV9A 5C4EA 3PNNA 3RMVA 3Q4SA 5EJZA 4HOCA 5FU8A 1EZIA 2YESA 5CMGX 4ECMA 2PA4A 5C3BA 2W0WA 2Y4LA 4Y64A 1WT1A 1ZJPA 1NWGB 2J0AA 4B4MA 3F1CA 3E25A 4MYBA 1H5SC 5FUHA 2BO8A 1R7YA 2FYDB 4Y7UA 5AJOA 3KIAA 1H7GA 2XWNA 4FRQA 4KNXA 4EE3A 1FXJA 3U2UA 3USRA 3GUEA 2V0LA 2FYBA 3V0OA 2RJ7A 1H4CA 1NKHB 1FRWA 3V8YA 5FTSA 2BO6A 2E3DA 3SX5A 1W55A 2AM5A 4G87A 5C4FA 1O0RA 2WEEA 1NHEB 3SXAA 4B2WA 1H4DA 2V0JA 3U0YA 3BCVA 1PZYB 1ZJ1A 5CMHA 3I0KA 3POLA 1V82A 4Y63A 5C36A 1LZJA 4ARWA 2X5ZA 2X60A 5DDVA 4O6NA 4Y7FA 2OI6A 3DJ4A 2NXVA 4O6MA 2AE7A 1MP4A 1R80A 2Z87A 2VK9A 4Y9XA 4EE4A 1JV1A 3V0LA 3U0XA 2APCA 3R3IA 1R7XA 2O1FA 1H5SD 1GX4A 2I5KA 4Y7GA 5C1GA 1VGTA 2RIZA 4LW3A 3T7OA 5C4CA 1ZJ2A 2ICXA 1WVCA 4CVHA 4R7PA 3D8VA 4C2SA 1VGUA 1FWYA 1VICA 5FV9A 4YS8A 1E5KA 1GX0A 3TZTA 3SXEA 1S4PA 2AM3A 3OAMA 2RJ0A 1ZJ0A 5CMFX 1VZXA 4HO9A 1XZ6A 4KC2A 1ON8A 1HM9A 4DDZA 2VXMA 1H5RA 2YC5A 4B5BA 3HL3A 5IFYA 4KC4A 3TQDA 4AYJA 1FXOA 2AECA 5C3DA 2VSHA 2VSIA 5C3AA 2YC3A 2VXLA 2ZU7A 2JCKA 3SXGA 2E8BA 4K6RA 2WVMA 5IDSA 5C47A 4M2BA 1QGQA 1WT0A 1H7LA 4D11A 2VS3A 1WT3A 2FFUA 4IRQA 4FCUA 1G8OA 4P02A 2BO4A 5C4BA 1FZWA 3ZLLA 2P73A 4Y7TA 3CKNA 5C48A 4ASYA 1TW5A 5D91A 2PGYA 1TW1A 4ASJA 3Q80A 4KT7A 1FGGA 5CMIA 4D48A 3RMWA 5EJ1A 2FYCB 5HS2A 1YP3A 4CJBA 1ZCTA 3F1YA 4FRAA 4IRPA 4M2AA 1H7TA 3SPTA 4G3QA 2OEGA 1R81A 1ZI3A 2OEFA 3I0LA 3DK5A 4KPXA 2VFZA 1WSZA 3OH3A 3V0NA 4KPZA 3ST8A 1G95A 4HO8A 1IIMA 1H5TB 1ZIZA 4DE7A 2UX8A 1H7HA 2O1HA 3O3PA 3SXBA 4FRLA 5L6SA 2RJ8A 3I0IX 4NALA 5CQNX 3V0PA 1HJLA 3JTJA 2WVLA 1ZHJA 1ZCYA 4FROA 4L41C 5D92A 1YP2A 1G23A 3IOIA 3PKPA 5CQPA 4B4BA 1NF5B 3OH4A 1S4NA 4FRBA 4D0TA 4FQWA 3SX7A 2Y7AA 4KNRA 1TVYA 1OMZA 3ZGGA 5CMJA 3FWWA 1R7UA 2I7BA 1NQIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL2 A;  1LVW A;  3T7M A;  3I0H A;  4NAI A;  1ZCV A;  4Y6N A;  4ZDQ A;  3JUJ A;  4HO2 A;  2XME A;  2YQS A;  4EVW A;  1GQC A;  3CKQ A;  1H7E A;  4FRP A;  1MP3 A;  2RJ5 A;  1HM0 A;  4AYL A;  4GBP A;  4JD0 A;  1MP5 A;  2RJ1 A;  2D0J A;  1ZJO A;  5DDT A;  4XWI A;  5CQL X;  4NAK A;  1ZDF A;  5C1H A;  1VH1 A;  1OMX A;  2P72 A;  1Z90 A;  4HO3 A;  1I52 A;  1G3L A;  3LW6 A;  1V83 A;  2V0I A;  3SXD A;  1EYR A;  2WGZ A;  1ZI1 A;  4G3S A;  3OGZ A;  1JV3 A;  2JCJ A;  3SX3 A;  1H5S B;  2WVK A;  2D7I A;  3OH1 A;  2I5E A;  3I0E A;  1INI A;  1VZU A;  5AJN A;  1QGS A;  2RJ6 A;  1G97 A;  2FFV A;  1ZDG A;  2AGD A;  3BRK X;  1FOA A;  1JYK A;  1K4V A;  3CKJ A;  4HO0 A;  4MND A;  1QG8 A;  3ZGF A;  2RJ9 A;  2FY7 A;  3N9W A;  1G93 A;  4HO4 A;  4EEM A;  1FG5 N;  1H7F A;  3SXC A;  4KXO A;  4P00 A;  3USQ A;  5BXC A;  2OI7 A;  5FYE A;  2P6W A;  4FRH A;  5EIY A;  4UEG A;  1FO8 A;  2X5S A;  4B2X A;  1VPA A;  3DUV A;  2DPW A;  2RIY A;  2W0V A;  2ZU8 A;  1G9R A;  1YP4 A;  3I0C A;  4CJ8 A;  2VD4 A;  2GGQ A;  2ICY A;  3RSB A;  1FO9 A;  4AAW A;  4CJC A;  2Q4J A;  4D11 C;  1H5S A;  1LZ7 A;  4M28 A;  3V91 A;  3CGX A;  3IOJ A;  5CQO A;  3V0M A;  1VGW A;  1ZI4 A;  4FRD A;  2Y4M A;  3V90 A;  4B3U A;  2D7R A;  3V0Q A;  2GGO A;  2A8U A;  4BMA A;  3NGW A;  3ZLK A;  1W77 A;  3E26 A;  2RJ4 A;  1TZF A;  4G3P A;  5IDT A;  1GA8 A;  1YRO B;  1INJ A;  5FTV A;  1H7Q A;  4HO5 A;  3U2T A;  2XWL A;  1S4O A;  3I0G A;  2AES A;  4EEA A;  3OKR A;  2YQC A;  2FYA A;  1R82 A;  1FR8 A;  1H4E A;  4LW6 A;  1NMM B;  3IOH A;  2YQJ A;  5I1F A;  1VH3 A;  1FGX A;  2Y4K A;  5C4D A;  1VM8 A;  3EE5 A;  5L6V A;  4JIS A;  3U2X A;  4Y7V A;  3K8D A;  1HM8 A;  2QH5 A;  1JVG A;  2RIX A;  3SX8 A;  1VGZ A;  4DEC A;  1LL0 A;  2Z86 A;  4J18 A;  5J49 A;  4HO6 A;  2O1G A;  2OI5 A;  1JVD A;  1ZJ3 A;  4EEO A;  2PGV A;  2QKX A;  2CU2 A;  4BQH A;  1ON6 A;  3CU0 A;  3V8Z A;  2A8W A;  2V0K A;  4FRM A;  1H5T A;  5C38 A;  2V0H A;  1ZCU A;  2YQH A;  3FOQ A;  4Y62 A;  1H5R B;  1G2V A;  3PKQ A;  1KWS A;  4EEG A;  4AC3 A;  3I0J A;  3D5N A;  1G1L A;  5JQQ A;  1GWW A;  2JCL A;  3K8E A;  3OH2 A;  2YCM A;  4HCQ A;  1V84 A;  1O7O A;  2AM4 A;  2WAW A;  3QVB A;  2PX7 A;  3CKV A;  2VS5 A;  5CQM X;  4D0Z A;  4Y6U A;  2Y4J A;  4KRV A;  4M4K A;  4E1K A;  5C49 A;  3CKO A;  2VS4 A;  1LL3 A;  1O23 B;  1OQM B;  4KQL A;  1FR9 A;  1G0R A;  1ZI5 A;  2RIT A;  2WE9 A;  4FRE A;  5C1L A;  2BO7 A;  1HJJ A;  3T7N A;  1GQ9 A;  2XMH A;  1PZT A;  4NAN A;  1GWV A;  2JCO A;  5FU0 A;  1JYL A;  4KC1 A;  1MC3 A;  1LZ0 A;  1W57 A;  4EE5 A;  3Q7U A;  3D98 A;  4HG6 A;  2ZU9 A;  1QWJ A;  1SS9 A;  3I0D A;  1H3M A;  5AJP A;  3OC9 A;  2QGI A;  2MZB A;  3I0F A;  1R7V A;  1VZT A;  3U2V A;  4B4G A;  2XWM A;  3U2W A;  2X65 A;  1XHB A;  1LZI A;  1IIN A;  2Y6P A;  3ZF8 A;  1O7Q A;  1R7T A;  4FCE A;  2AH9 A;  3R2W A;  1WT2 A;  3OH0 A;  5C8R A;  4B42 A;  3JUK A;  1HV9 A;  5C4E A;  3PNN A;  3RMV A;  3Q4S A;  5EJZ A;  4HOC A;  5FU8 A;  1EZI A;  2YES A;  5CMG X;  4ECM A;  2PA4 A;  5C3B A;  2W0W A;  2Y4L A;  4Y64 A;  1WT1 A;  1ZJP A;  1NWG B;  4B4M A;  3F1C A;  3E25 A;  4MYB A;  1H5S C;  5FUH A;  2BO8 A;  1R7Y A;  2FYD B;  4Y7U A;  5AJO A;  3KIA A;  1H7G A;  2XWN A;  4FRQ A;  4KNX A;  4EE3 A;  1FXJ A;  3U2U A;  3USR A;  3GUE A;  2V0L A;  2FYB A;  3V0O A;  2RJ7 A;  1H4C A;  1NKH B;  1FRW A;  3V8Y A;  5FTS A;  2BO6 A;  2E3D A;  3SX5 A;  1W55 A;  2AM5 A;  4G87 A;  5C4F A;  1O0R A;  2WEE A;  1NHE B;  3SXA A;  4B2W A;  1H4D A;  2V0J A;  3U0Y A;  3BCV A;  1PZY B;  1ZJ1 A;  5CMH A;  3I0K A;  3POL A;  1V82 A;  4Y63 A;  5C36 A;  1LZJ A;  4ARW A;  2X5Z A;  2X60 A;  5DDV A;  4Y7F A;  2OI6 A;  3DJ4 A;  2NXV A;  2AE7 A;  1MP4 A;  1R80 A;  2Z87 A;  4Y9X A;  4EE4 A;  1JV1 A;  3V0L A;  3U0X A;  2APC A;  3R3I A;  1R7X A;  2O1F A;  1H5S D;  1GX4 A;  2I5K A;  4Y7G A;  5C1G A;  1VGT A;  2RIZ A;  4LW3 A;  3T7O A;  5C4C A;  1ZJ2 A;  2ICX A;  1WVC A;  4CVH A;  4R7P A;  3D8V A;  4C2S A;  1VGU A;  1FWY A;  1VIC A;  5FV9 A;  4YS8 A;  1E5K A;  1GX0 A;  3TZT A;  3SXE A;  1S4P A;  2AM3 A;  3OAM A;  2RJ0 A;  1ZJ0 A;  5CMF X;  1VZX A;  4HO9 A;  1XZ6 A;  4KC2 A;  1ON8 A;  1HM9 A;  4DDZ A;  2VXM A;  1H5R A;  2YC5 A;  4B5B A;  3HL3 A;  5IFY A;  4KC4 A;  3TQD A;  4AYJ A;  1FXO A;  2AEC A;  5C3D A;  2VSH A;  2VSI A;  5C3A A;  2YC3 A;  2VXL A;  2ZU7 A;  2JCK A;  3SXG A;  2E8B A;  4K6R A;  2WVM A;  5IDS A;  5C47 A;  4M2B A;  1QGQ A;  1WT0 A;  1H7L A;  4D11 A;  2VS3 A;  1WT3 A;  2FFU A;  4IRQ A;  4FCU A;  1G8O A;  4P02 A;  2BO4 A;  5C4B A;  1FZW A;  3ZLL A;  2P73 A;  4Y7T A;  3CKN A;  5C48 A;  4ASY A;  1TW5 A;  2PGY A;  1TW1 A;  4ASJ A;  3Q80 A;  4KT7 A;  1FGG A;  5CMI A;  4D48 A;  3RMW A;  5EJ1 A;  2FYC B;  5HS2 A;  1YP3 A;  4CJB A;  1ZCT A;  3F1Y A;  4FRA A;  4IRP A;  4M2A A;  1H7T A;  3SPT A;  4G3Q A;  2OEG A;  1R81 A;  1ZI3 A;  2OEF A;  3I0L A;  3DK5 A;  4KPX A;  2VFZ A;  1WSZ A;  3OH3 A;  3V0N A;  4KPZ A;  3ST8 A;  1G95 A;  4HO8 A;  1IIM A;  1H5T B;  1ZIZ A;  4DE7 A;  2UX8 A;  1H7H A;  2O1H A;  3O3P A;  3SXB A;  4FRL A;  5L6S A;  2RJ8 A;  3I0I X;  4NAL A;  5CQN X;  3V0P A;  1HJL A;  3JTJ A;  2WVL A;  1ZHJ A;  1ZCY A;  4FRO A;  4L41 C;  1YP2 A;  1G23 A;  3IOI A;  3PKP A;  5CQP A;  4B4B A;  1NF5 B;  3OH4 A;  1S4N A;  4FRB A;  4D0T A;  4FQW A;  3SX7 A;  2Y7A A;  4KNR A;  1TVY A;  1OMZ A;  3ZGG A;  5CMJ A;  3FWW A;  1R7U A;  2I7B A;  1NQI B; 
#chains in the Genus database with same CATH topology
 1LL2 A;  1LVW A;  3T7M A;  3I0H A;  4NAI A;  1ZCV A;  4Y6N A;  4ZDQ A;  3JUJ A;  4HO2 A;  2XME A;  2YQS A;  4EVW A;  1GQC A;  3CKQ A;  1H7E A;  4FRP A;  1MP3 A;  2RJ5 A;  1HM0 A;  4AYL A;  4GBP A;  4JD0 A;  1MP5 A;  2RJ1 A;  2D0J A;  1ZJO A;  5DDT A;  4XWI A;  5CQL X;  4NAK A;  1ZDF A;  5C1H A;  1VH1 A;  1OMX A;  2P72 A;  1Z90 A;  4HO3 A;  1I52 A;  1G3L A;  3LW6 A;  1V83 A;  2V0I A;  3SXD A;  1EYR A;  2WGZ A;  1ZI1 A;  4G3S A;  3OGZ A;  1JV3 A;  2JCJ A;  3SX3 A;  1H5S B;  2WVK A;  2D7I A;  3OH1 A;  2I5E A;  3I0E A;  1INI A;  1VZU A;  4Q7C A;  1QGS A;  5AJN A;  2RJ6 A;  2J0B A;  1G97 A;  2FFV A;  1ZDG A;  2AGD A;  3BRK X;  1FOA A;  1JYK A;  1K4V A;  3CKJ A;  4HO0 A;  4MND A;  1QG8 A;  3ZGF A;  2RJ9 A;  2FY7 A;  3N9W A;  1G93 A;  4HO4 A;  4EEM A;  1FG5 N;  1H7F A;  3SXC A;  4KXO A;  4P00 A;  3USQ A;  5BXC A;  2OI7 A;  5FYE A;  2P6W A;  4FRH A;  5EIY A;  4UEG A;  1FO8 A;  2X5S A;  4B2X A;  1VPA A;  3DUV A;  2DPW A;  2RIY A;  2W0V A;  2ZU8 A;  1G9R A;  1YP4 A;  3I0C A;  4CJ8 A;  2VD4 A;  2GGQ A;  2ICY A;  3RSB A;  1FO9 A;  4AAW A;  4CJC A;  2Q4J A;  4D11 C;  1H5S A;  1LZ7 A;  4M28 A;  3V91 A;  3CGX A;  3IOJ A;  5CQO A;  3V0M A;  1VGW A;  1ZI4 A;  4FRD A;  2Y4M A;  3V90 A;  4B3U A;  2D7R A;  3V0Q A;  2GGO A;  2A8U A;  4BMA A;  3NGW A;  4FIY A;  3ZLK A;  1W77 A;  3E26 A;  2RJ4 A;  1TZF A;  4G3P A;  5IDT A;  1GA8 A;  1YRO B;  1INJ A;  5FTV A;  1H7Q A;  4HO5 A;  3U2T A;  2XWL A;  1S4O A;  3I0G A;  2AES A;  4EEA A;  3OKR A;  2YQC A;  2FYA A;  1R82 A;  1FR8 A;  1H4E A;  4LW6 A;  1NMM B;  3IOH A;  2YQJ A;  5I1F A;  1VH3 A;  1FGX A;  2Y4K A;  5C4D A;  1VM8 A;  3EE5 A;  5L6V A;  4JIS A;  3U2X A;  4Y7V A;  3K8D A;  1HM8 A;  2QH5 A;  1JVG A;  2RIX A;  3SX8 A;  1VGZ A;  4DEC A;  1LL0 A;  2Z86 A;  4J18 A;  5J49 A;  4HO6 A;  2O1G A;  2OI5 A;  1JVD A;  1ZJ3 A;  4MIX A;  4EEO A;  2PGV A;  2QKX A;  2CU2 A;  4BQH A;  1ON6 A;  3CU0 A;  3V8Z A;  2A8W A;  2V0K A;  4FRM A;  1H5T A;  5C38 A;  2V0H A;  4FIX A;  1ZCU A;  2YQH A;  3FOQ A;  4Y62 A;  1H5R B;  1G2V A;  3PKQ A;  1KWS A;  4EEG A;  4AC3 A;  3I0J A;  3D5N A;  1G1L A;  5JQQ A;  1GWW A;  2JCL A;  3K8E A;  3OH2 A;  2YCM A;  4HCQ A;  1V84 A;  1O7O A;  2AM4 A;  2WAW A;  3QVB A;  2PX7 A;  3CKV A;  2VS5 A;  5CQM X;  4D0Z A;  4Y6U A;  2Y4J A;  4KRV A;  4M4K A;  4E1K A;  5C49 A;  3CKO A;  2VS4 A;  1LL3 A;  1O23 B;  1OQM B;  4KQL A;  1FR9 A;  1G0R A;  1ZI5 A;  2RIT A;  2WE9 A;  4FRE A;  5C1L A;  2C0N A;  2BO7 A;  1HJJ A;  3T7N A;  1GQ9 A;  2XMH A;  1PZT A;  4NAN A;  1GWV A;  2JCO A;  5FU0 A;  1JYL A;  4KC1 A;  1MC3 A;  1LZ0 A;  1W57 A;  4EE5 A;  3Q7U A;  3D98 A;  4HG6 A;  2ZU9 A;  1QWJ A;  1SS9 A;  3I0D A;  1H3M A;  5AJP A;  3OC9 A;  2QGI A;  2MZB A;  3I0F A;  1R7V A;  1VZT A;  3U2V A;  4B4G A;  2XWM A;  3U2W A;  2X65 A;  1XHB A;  1LZI A;  1IIN A;  2Y6P A;  3ZF8 A;  1O7Q A;  1R7T A;  4FCE A;  2AH9 A;  3R2W A;  1WT2 A;  3OH0 A;  5C8R A;  4B42 A;  3JUK A;  1HV9 A;  5C4E A;  3PNN A;  3RMV A;  3Q4S A;  5EJZ A;  4HOC A;  5FU8 A;  1EZI A;  2YES A;  5CMG X;  4ECM A;  2PA4 A;  5C3B A;  2W0W A;  2Y4L A;  4Y64 A;  1WT1 A;  1ZJP A;  1NWG B;  2J0A A;  4B4M A;  3F1C A;  3E25 A;  4MYB A;  1H5S C;  5FUH A;  2BO8 A;  1R7Y A;  2FYD B;  4Y7U A;  5AJO A;  3KIA A;  1H7G A;  2XWN A;  4FRQ A;  4KNX A;  4EE3 A;  1FXJ A;  3U2U A;  3USR A;  3GUE A;  2V0L A;  2FYB A;  3V0O A;  2RJ7 A;  1H4C A;  1NKH B;  1FRW A;  3V8Y A;  5FTS A;  2BO6 A;  2E3D A;  3SX5 A;  1W55 A;  2AM5 A;  4G87 A;  5C4F A;  1O0R A;  2WEE A;  1NHE B;  3SXA A;  4B2W A;  1H4D A;  2V0J A;  3U0Y A;  3BCV A;  1PZY B;  1ZJ1 A;  5CMH A;  3I0K A;  3POL A;  1V82 A;  4Y63 A;  5C36 A;  1LZJ A;  4ARW A;  2X5Z A;  2X60 A;  5DDV A;  4O6N A;  4Y7F A;  2OI6 A;  3DJ4 A;  2NXV A;  4O6M A;  2AE7 A;  1MP4 A;  1R80 A;  2Z87 A;  2VK9 A;  4Y9X A;  4EE4 A;  1JV1 A;  3V0L A;  3U0X A;  2APC A;  3R3I A;  1R7X A;  2O1F A;  1H5S D;  1GX4 A;  2I5K A;  4Y7G A;  5C1G A;  1VGT A;  2RIZ A;  4LW3 A;  3T7O A;  5C4C A;  1ZJ2 A;  2ICX A;  1WVC A;  4CVH A;  4R7P A;  3D8V A;  4C2S A;  1VGU A;  1FWY A;  1VIC A;  5FV9 A;  4YS8 A;  1E5K A;  1GX0 A;  3TZT A;  3SXE A;  1S4P A;  2AM3 A;  3OAM A;  2RJ0 A;  1ZJ0 A;  5CMF X;  1VZX A;  4HO9 A;  1XZ6 A;  4KC2 A;  1ON8 A;  1HM9 A;  4DDZ A;  2VXM A;  1H5R A;  2YC5 A;  4B5B A;  3HL3 A;  5IFY A;  4KC4 A;  3TQD A;  4AYJ A;  1FXO A;  2AEC A;  5C3D A;  2VSH A;  2VSI A;  5C3A A;  2YC3 A;  2VXL A;  2ZU7 A;  2JCK A;  3SXG A;  2E8B A;  4K6R A;  2WVM A;  5IDS A;  5C47 A;  4M2B A;  1QGQ A;  1WT0 A;  1H7L A;  4D11 A;  2VS3 A;  1WT3 A;  2FFU A;  4IRQ A;  4FCU A;  1G8O A;  4P02 A;  2BO4 A;  5C4B A;  1FZW A;  3ZLL A;  2P73 A;  4Y7T A;  3CKN A;  5C48 A;  4ASY A;  1TW5 A;  5D91 A;  2PGY A;  1TW1 A;  4ASJ A;  3Q80 A;  4KT7 A;  1FGG A;  5CMI A;  4D48 A;  3RMW A;  5EJ1 A;  2FYC B;  5HS2 A;  1YP3 A;  4CJB A;  1ZCT A;  3F1Y A;  4FRA A;  4IRP A;  4M2A A;  1H7T A;  3SPT A;  4G3Q A;  2OEG A;  1R81 A;  1ZI3 A;  2OEF A;  3I0L A;  3DK5 A;  4KPX A;  2VFZ A;  1WSZ A;  3OH3 A;  3V0N A;  4KPZ A;  3ST8 A;  1G95 A;  4HO8 A;  1IIM A;  1H5T B;  1ZIZ A;  4DE7 A;  2UX8 A;  1H7H A;  2O1H A;  3O3P A;  3SXB A;  4FRL A;  5L6S A;  2RJ8 A;  3I0I X;  4NAL A;  5CQN X;  3V0P A;  1HJL A;  3JTJ A;  2WVL A;  1ZHJ A;  1ZCY A;  4FRO A;  4L41 C;  5D92 A;  1YP2 A;  1G23 A;  3IOI A;  3PKP A;  5CQP A;  4B4B A;  1NF5 B;  3OH4 A;  1S4N A;  4FRB A;  4D0T A;  4FQW A;  3SX7 A;  2Y7A A;  4KNR A;  1TVY A;  1OMZ A;  3ZGG A;  5CMJ A;  3FWW A;  1R7U A;  2I7B A;  1NQI B; 
#chains in the Genus database with same CATH homology
 1LL2 A;  1LVW A;  3T7M A;  3I0H A;  4NAI A;  1ZCV A;  4Y6N A;  4ZDQ A;  3JUJ A;  4HO2 A;  2XME A;  2YQS A;  4EVW A;  1GQC A;  3CKQ A;  1H7E A;  4FRP A;  1MP3 A;  2RJ5 A;  1HM0 A;  4AYL A;  4GBP A;  4JD0 A;  1MP5 A;  2RJ1 A;  2D0J A;  1ZJO A;  5DDT A;  4XWI A;  5CQL X;  4NAK A;  1ZDF A;  5C1H A;  1VH1 A;  1OMX A;  2P72 A;  1Z90 A;  4HO3 A;  1I52 A;  1G3L A;  3LW6 A;  1V83 A;  2V0I A;  3SXD A;  1EYR A;  2WGZ A;  1ZI1 A;  4G3S A;  3OGZ A;  1JV3 A;  2JCJ A;  3SX3 A;  1H5S B;  2WVK A;  2D7I A;  3OH1 A;  2I5E A;  3I0E A;  1INI A;  1VZU A;  4Q7C A;  1QGS A;  5AJN A;  2RJ6 A;  2J0B A;  1G97 A;  2FFV A;  1ZDG A;  2AGD A;  3BRK X;  1FOA A;  1JYK A;  1K4V A;  3CKJ A;  4HO0 A;  4MND A;  1QG8 A;  3ZGF A;  2RJ9 A;  2FY7 A;  3N9W A;  1G93 A;  4HO4 A;  4EEM A;  1FG5 N;  1H7F A;  3SXC A;  4KXO A;  4P00 A;  3USQ A;  5BXC A;  2OI7 A;  5FYE A;  2P6W A;  4FRH A;  5EIY A;  4UEG A;  1FO8 A;  2X5S A;  4B2X A;  1VPA A;  3DUV A;  2DPW A;  2RIY A;  2W0V A;  2ZU8 A;  1G9R A;  1YP4 A;  3I0C A;  4CJ8 A;  2VD4 A;  2GGQ A;  2ICY A;  3RSB A;  1FO9 A;  4AAW A;  4CJC A;  2Q4J A;  4D11 C;  1H5S A;  1LZ7 A;  4M28 A;  3V91 A;  3CGX A;  3IOJ A;  5CQO A;  3V0M A;  1VGW A;  1ZI4 A;  4FRD A;  2Y4M A;  3V90 A;  4B3U A;  2D7R A;  3V0Q A;  2GGO A;  2A8U A;  4BMA A;  3NGW A;  4FIY A;  3ZLK A;  1W77 A;  3E26 A;  2RJ4 A;  1TZF A;  4G3P A;  5IDT A;  1GA8 A;  1YRO B;  1INJ A;  5FTV A;  1H7Q A;  4HO5 A;  3U2T A;  2XWL A;  1S4O A;  3I0G A;  2AES A;  4EEA A;  3OKR A;  2YQC A;  2FYA A;  1R82 A;  1FR8 A;  1H4E A;  4LW6 A;  1NMM B;  3IOH A;  2YQJ A;  5I1F A;  1VH3 A;  1FGX A;  2Y4K A;  5C4D A;  1VM8 A;  3EE5 A;  5L6V A;  4JIS A;  3U2X A;  4Y7V A;  3K8D A;  1HM8 A;  2QH5 A;  1JVG A;  2RIX A;  3SX8 A;  1VGZ A;  4DEC A;  1LL0 A;  2Z86 A;  4J18 A;  5J49 A;  4HO6 A;  2O1G A;  2OI5 A;  1JVD A;  1ZJ3 A;  4MIX A;  4EEO A;  2PGV A;  2QKX A;  2CU2 A;  4BQH A;  1ON6 A;  3CU0 A;  3V8Z A;  2A8W A;  2V0K A;  4FRM A;  1H5T A;  5C38 A;  2V0H A;  4FIX A;  1ZCU A;  2YQH A;  3FOQ A;  4Y62 A;  1H5R B;  1G2V A;  3PKQ A;  1KWS A;  4EEG A;  4AC3 A;  3I0J A;  3D5N A;  1G1L A;  5JQQ A;  1GWW A;  2JCL A;  3K8E A;  3OH2 A;  2YCM A;  4HCQ A;  1V84 A;  1O7O A;  2AM4 A;  2WAW A;  3QVB A;  2PX7 A;  3CKV A;  2VS5 A;  5CQM X;  4D0Z A;  4Y6U A;  2Y4J A;  4KRV A;  4M4K A;  4E1K A;  5C49 A;  3CKO A;  2VS4 A;  1LL3 A;  1O23 B;  1OQM B;  4KQL A;  1FR9 A;  1G0R A;  1ZI5 A;  2RIT A;  2WE9 A;  4FRE A;  5C1L A;  2C0N A;  2BO7 A;  1HJJ A;  3T7N A;  1GQ9 A;  2XMH A;  1PZT A;  4NAN A;  1GWV A;  2JCO A;  5FU0 A;  1JYL A;  4KC1 A;  1MC3 A;  1LZ0 A;  1W57 A;  4EE5 A;  3Q7U A;  3D98 A;  4HG6 A;  2ZU9 A;  1QWJ A;  1SS9 A;  3I0D A;  1H3M A;  5AJP A;  3OC9 A;  2QGI A;  2MZB A;  3I0F A;  1R7V A;  1VZT A;  3U2V A;  4B4G A;  2XWM A;  3U2W A;  2X65 A;  1XHB A;  1LZI A;  1IIN A;  2Y6P A;  3ZF8 A;  1O7Q A;  1R7T A;  4FCE A;  2AH9 A;  3R2W A;  1WT2 A;  3OH0 A;  5C8R A;  4B42 A;  3JUK A;  1HV9 A;  5C4E A;  3PNN A;  3RMV A;  3Q4S A;  5EJZ A;  4HOC A;  5FU8 A;  1EZI A;  2YES A;  5CMG X;  4ECM A;  2PA4 A;  5C3B A;  2W0W A;  2Y4L A;  4Y64 A;  1WT1 A;  1ZJP A;  1NWG B;  2J0A A;  4B4M A;  3F1C A;  3E25 A;  4MYB A;  1H5S C;  5FUH A;  2BO8 A;  1R7Y A;  2FYD B;  4Y7U A;  5AJO A;  3KIA A;  1H7G A;  2XWN A;  4FRQ A;  4KNX A;  4EE3 A;  1FXJ A;  3U2U A;  3USR A;  3GUE A;  2V0L A;  2FYB A;  3V0O A;  2RJ7 A;  1H4C A;  1NKH B;  1FRW A;  3V8Y A;  5FTS A;  2BO6 A;  2E3D A;  3SX5 A;  1W55 A;  2AM5 A;  4G87 A;  5C4F A;  1O0R A;  2WEE A;  1NHE B;  3SXA A;  4B2W A;  1H4D A;  2V0J A;  3U0Y A;  3BCV A;  1PZY B;  1ZJ1 A;  5CMH A;  3I0K A;  3POL A;  1V82 A;  4Y63 A;  5C36 A;  1LZJ A;  4ARW A;  2X5Z A;  2X60 A;  5DDV A;  4O6N A;  4Y7F A;  2OI6 A;  3DJ4 A;  2NXV A;  4O6M A;  2AE7 A;  1MP4 A;  1R80 A;  2Z87 A;  2VK9 A;  4Y9X A;  4EE4 A;  1JV1 A;  3V0L A;  3U0X A;  2APC A;  3R3I A;  1R7X A;  2O1F A;  1H5S D;  1GX4 A;  2I5K A;  4Y7G A;  5C1G A;  1VGT A;  2RIZ A;  4LW3 A;  3T7O A;  5C4C A;  1ZJ2 A;  2ICX A;  1WVC A;  4CVH A;  4R7P A;  3D8V A;  4C2S A;  1VGU A;  1FWY A;  1VIC A;  5FV9 A;  4YS8 A;  1E5K A;  1GX0 A;  3TZT A;  3SXE A;  1S4P A;  2AM3 A;  3OAM A;  2RJ0 A;  1ZJ0 A;  5CMF X;  1VZX A;  4HO9 A;  1XZ6 A;  4KC2 A;  1ON8 A;  1HM9 A;  4DDZ A;  2VXM A;  1H5R A;  2YC5 A;  4B5B A;  3HL3 A;  5IFY A;  4KC4 A;  3TQD A;  4AYJ A;  1FXO A;  2AEC A;  5C3D A;  2VSH A;  2VSI A;  5C3A A;  2YC3 A;  2VXL A;  2ZU7 A;  2JCK A;  3SXG A;  2E8B A;  4K6R A;  2WVM A;  5IDS A;  5C47 A;  4M2B A;  1QGQ A;  1WT0 A;  1H7L A;  4D11 A;  2VS3 A;  1WT3 A;  2FFU A;  4IRQ A;  4FCU A;  1G8O A;  4P02 A;  2BO4 A;  5C4B A;  1FZW A;  3ZLL A;  2P73 A;  4Y7T A;  3CKN A;  5C48 A;  4ASY A;  1TW5 A;  5D91 A;  2PGY A;  1TW1 A;  4ASJ A;  3Q80 A;  4KT7 A;  1FGG A;  5CMI A;  4D48 A;  3RMW A;  5EJ1 A;  2FYC B;  5HS2 A;  1YP3 A;  4CJB A;  1ZCT A;  3F1Y A;  4FRA A;  4IRP A;  4M2A A;  1H7T A;  3SPT A;  4G3Q A;  2OEG A;  1R81 A;  1ZI3 A;  2OEF A;  3I0L A;  3DK5 A;  4KPX A;  2VFZ A;  1WSZ A;  3OH3 A;  3V0N A;  4KPZ A;  3ST8 A;  1G95 A;  4HO8 A;  1IIM A;  1H5T B;  1ZIZ A;  4DE7 A;  2UX8 A;  1H7H A;  2O1H A;  3O3P A;  3SXB A;  4FRL A;  5L6S A;  2RJ8 A;  3I0I X;  4NAL A;  5CQN X;  3V0P A;  1HJL A;  3JTJ A;  2WVL A;  1ZHJ A;  1ZCY A;  4FRO A;  4L41 C;  5D92 A;  1YP2 A;  1G23 A;  3IOI A;  3PKP A;  5CQP A;  4B4B A;  1NF5 B;  3OH4 A;  1S4N A;  4FRB A;  4D0T A;  4FQW A;  3SX7 A;  2Y7A A;  4KNR A;  1TVY A;  1OMZ A;  3ZGG A;  5CMJ A;  3FWW A;  1R7U A;  2I7B A;  1NQI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...