1IIMA

Thymidylyltransferase complexed with ttp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-1-phosphate thymidylyltransferase
publication title Structure, mechanism and engineering of a nucleotidylyltransferase as a first step toward glycorandomization.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transferase
total genus 95
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1iimA00
3K8DA 5HS2A 4JISA 4HO6A 3D98A 2JCOA 3IOJA 3Q7UA 5FYEA 2P6WA 2YCMA 1WSZA 3RMWA 1G93A 2FYBA 3U0XA 4EEAA 1FG5N 1TW5A 1I52A 1NHEB 4EE4A 3I0JA 5C47A 2Y4JA 2RJ4A 4IRPA 3RMVA 4JD0A 2VFZA 4Y7TA 5IDSA 1V84A 2DPWA 3E25A 3SX7A 1JYLA 1HM9A 4FRHA 2NXVA 1R7XA 5EJZA 5CQPA 3ZGGA 3CKNA 2WVLA 1FO9A 5BXCA 2OI6A 4HO3A 5C1HA 1ZJOA 2V0LA 1PZTA 3ZLLA 2I5KA 3OC9A 3U0YA 1G3LA 3RSBA 2ICXA 3JTJA 2AE7A 1FR9A 2I5EA 1H5SD 1TVYA 2RJ6A 4UEGA 4P02A 2AECA 1EYRA 3FWWA 3CKOA 1NQIB 2I7BA 3T7MA 1QGQA 2ZU7A 1JYKA 3V0MA 4M28A 3SPTA 2JCLA 1KWSA 2FFVA 2VS3A 1LL0A 3D5NA 1OMXA 2XWNA 4ASJA 1H5SB 1YP2A 1H5SA 2Y7AA 2O1FA 2AM5A 2RITA 4EEGA 1S4OA 2VXMA 5EJ1A 3EE5A 5L6VA 3R3IA 4KPXA 2V0JA 5FTSA 3CKQA 1S4PA 4M2BA 5EIYA 5CMHA 3V90A 1G9RA 2D7RA 2QGIA 3SXEA 1LL2A 3V0NA 3Q4SA 2A8WA 2VXLA 4FCEA 2PA4A 4EEOA 1W55A 1VGTA 1ZI3A 3I0DA 3K8EA 5CMIA 2BO7A 3U2UA 2E8BA 1LZJA 4LW3A 1WT0A 4FRDA 1FZWA 4NANA 4B4BA 1INIA 3U2VA 1V82A 1FWYA 2VS5A 2ICYA 4CJCA 1FOAA 2O1GA 2OEGA 4ASYA 3FOQA 2FYDB 2WVKA 4M4KA 2V0HA 1VH1A 3BRKX 2CU2A 4FREA 1GWWA 1XHBA 1VGWA 4YS8A 3DUVA 4KQLA 5C4FA 2OI7A 3I0IX 3USRA 2XMHA 2XWLA 2E3DA 2X5SA 3OGZA 4D11A 1WT2A 1TZFA 1VPAA 1O23B 4CVHA 4AYLA 4FRAA 5C4CA 1ZCVA 3U2TA 1FO8A 2RJ9A 4ZDQA 4EVWA 1FRWA 2XMEA 2V0IA 1S4NA 1ZJPA 2VSHA 5L6SA 3DJ4A 5CMFX 4AYJA 4LW6A 5C3DA 4B4GA 1R82A 1O7OA 2AESA 1ZHJA 4Y63A 3I0KA 4XWIA 3F1YA 5C3AA 5C4EA 4FRQA 1GA8A 4FROA 4D0TA 4KRVA 2Q4JA 2MZBA 1G95A 3V0QA 2QKXA 1VGUA 4FQWA 4HG6A 1LL3A 5DDTA 4K6RA 2W0WA 2YC3A 3SX3A 3JUJA 2P72A 4KC2A 1FXJA 1JVDA 5FUHA 1H5TB 2VSIA 2BO4A 3T7OA 4FRBA 1H5RB 1NKHB 4Y6UA 2UX8A 4FCUA 1GX0A 5C48A 1H5RA 4Y7VA 4HO2A 2XWMA 3OKRA 1LZ0A 2FYAA 2QH5A 3SXAA 1GWVA 3N9WA 3TQDA 1SS9A 4B2XA 1VICA 4HO0A 3OH1A 4BMAA 4HO5A 4Y64A 1GQCA 5C1LA 1ZIZA 1O0RA 3SXDA 1GX4A 4Y7FA 2YQSA 1OQMB 1ZDGA 2BO8A 3PNNA 2Z86A 1R7VA 4IRQA 1WVCA 4B4MA 4E1KA 2GGOA 3I0LA 4KT7A 3USQA 2APCA 3OH3A 2YQJA 2RJ0A 1JV1A 1YP4A 1YROB 2Y6PA 1NWGB 1WT1A 2YC5A 3I0CA 4GBPA 1VZTA 4KPZA 4Y62A 4B42A 1IIMA 2D0JA 2PGYA 5FV9A 3U2WA 3CU0A 4KNRA 2WE9A 2X65A 5AJOA 1HM0A 1E5KA 2V0KA 2FFUA 1FGXA 1H5SC 2RIZA 5C4BA 4EE5A 1ZCYA 3V91A 4HCQA 1MP3A 2RJ7A 1ZCTA 5C49A 3JUKA 3CGXA 1GQ9A 4NAIA 5J49A 1H4DA 1G97A 4HO4A 4J18A 2RIXA 4MYBA 4MNDA 4AC3A 4FRPA 4HOCA 1PZYB 1FR8A 1ZI5A 4Y9XA 4Y6NA 1ZDFA 1G23A 1HM8A 4NALA 1V83A 5CMJA 1ON6A 4Y7UA 4AAWA 5C8RA 1G2VA 1ZI4A 2RIYA 1H7HA 5IFYA 3KIAA 1QG8A 1H7FA 1H7QA 1R7YA 4KC1A 4P00A 1INJA 2AM3A 5CQMX 1EZIA 3CKJA 5CQOA 2AGDA 4NAKA 5CQLX 4HO9A 3LW6A 5C3BA 4M2AA 5C4DA 2RJ8A 1YP3A 3I0EA 1H7TA 3V0OA 5AJNA 2Y4KA 4G87A 5C1GA 1OMZA 3E26A 2ZU8A 4D11C 1W77A 2D7IA 1VH3A 1H7LA 4ARWA 3ZGFA 5CQNX 1G1LA 2ZU9A 1R80A 1W57A 1WT3A 2YQHA 3SX5A 2AH9A 2Y4LA 1XZ6A 2X60A 1H5TA 4EEMA 2BO6A 4CJBA 4DE7A 4R7PA 3ZLKA 5I1FA 3F1CA 5C36A 1ZJ3A 2YESA 2VD4A 1LVWA 1ZJ1A 2JCJA 1MC3A 1R7TA 1ZJ2A 3DK5A 1NF5B 1QWJA 2O1HA 2FY7A 4FRMA 1HJJA 1G8OA 2PGVA 3V8ZA 1JVGA 3BCVA 4G3SA 5DDVA 3OH2A 2YQCA 2WAWA 4BQHA 3R2WA 5IDTA 3IOIA 5JQQA 1H4CA 1TW1A 1ON8A 3ZF8A 1JV3A 4D48A 3SX8A 3HL3A 3OH4A 3CKVA 1NMMB 4KXOA 2OI5A 3POLA 2RJ5A 5C38A 4DECA 3Q80A 1ZI1A 1VZUA 3I0GA 3GUEA 2Y4MA 2Z87A 2JCKA 1VGZA 2RJ1A 4C2SA 1H7GA 1MP4A 2WVMA 3PKPA 4KC4A 3I0HA 3OH0A 5FU8A 2A8UA 1HJLA 2P73A 1G0RA 3QVBA 4CJ8A 3IOHA 4EE3A 1H4EA 1MP5A 4FRLA 4DDZA 4L41C 3U2XA 2WGZA 1IINA 1K4VA 1QGSA 5CMGX 3I0FA 3NGWA 4B3UA 3O3PA 2VS4A 2GGQA 1R81A 1VM8A 4B2WA 1FGGA 2W0VA 4G3QA 3SXCA 3TZTA 3V8YA 4B5BA 1VZXA 1R7UA 1O7QA 4G3PA 1LZIA 5AJPA 4HO8A 4Y7GA 3T7NA 1H7EA 3PKQA 1Z90A 2FYCB 2X5ZA 3V0PA 1HV9A 1H3MA 1FXOA 5FU0A 3V0LA 3SXGA 4KNXA 3ST8A 5FTVA 4D0ZA 3D8VA 3SXBA 2PX7A 1LZ7A 1ZJ0A 2WEEA 4ECMA 3OAMA 2AM4A 2OEFA 1ZCUA
chains in the Genus database with same CATH superfamily
3K8DA 5HS2A 4JISA 4HO6A 3D98A 2JCOA 3IOJA 3Q7UA 5FYEA 2P6WA 2YCMA 1WSZA 3RMWA 1G93A 2FYBA 3U0XA 4EEAA 1FG5N 1TW5A 1I52A 1NHEB 4EE4A 3I0JA 5C47A 2Y4JA 2RJ4A 4IRPA 3RMVA 4JD0A 2VFZA 4Y7TA 5IDSA 1V84A 2DPWA 3E25A 3SX7A 1JYLA 1HM9A 4FRHA 2NXVA 1R7XA 5EJZA 5CQPA 3ZGGA 3CKNA 2WVLA 1FO9A 5BXCA 2OI6A 4HO3A 5C1HA 1ZJOA 2V0LA 1PZTA 3ZLLA 2I5KA 3OC9A 3U0YA 1G3LA 3RSBA 2ICXA 3JTJA 2AE7A 1FR9A 2I5EA 1H5SD 1TVYA 2RJ6A 4UEGA 4P02A 2AECA 1EYRA 3FWWA 3CKOA 1NQIB 2I7BA 3T7MA 1QGQA 2ZU7A 1JYKA 3V0MA 4M28A 3SPTA 2JCLA 1KWSA 2FFVA 2VS3A 1LL0A 3D5NA 1OMXA 2XWNA 4ASJA 1H5SB 1YP2A 4FIYA 1H5SA 2Y7AA 2O1FA 2AM5A 2RITA 4EEGA 1S4OA 2VXMA 5EJ1A 3EE5A 5L6VA 3R3IA 4KPXA 2V0JA 5FTSA 3CKQA 2J0BA 1S4PA 4M2BA 5EIYA 5CMHA 3V90A 1G9RA 2D7RA 2QGIA 3SXEA 1LL2A 3V0NA 3Q4SA 2A8WA 2VXLA 4FCEA 2PA4A 4EEOA 1W55A 1VGTA 1ZI3A 3I0DA 3K8EA 5CMIA 2BO7A 3U2UA 2E8BA 1LZJA 4LW3A 1WT0A 4FRDA 1FZWA 4NANA 4B4BA 1INIA 3U2VA 1V82A 1FWYA 2VS5A 2ICYA 4CJCA 1FOAA 2O1GA 2OEGA 4ASYA 3FOQA 2FYDB 2WVKA 4M4KA 2V0HA 1VH1A 3BRKX 2CU2A 4FREA 1GWWA 1XHBA 1VGWA 4YS8A 3DUVA 4KQLA 5C4FA 2OI7A 3I0IX 3USRA 2XMHA 2XWLA 2E3DA 2X5SA 3OGZA 4D11A 1WT2A 1TZFA 1VPAA 1O23B 4CVHA 4AYLA 4FRAA 2J0AA 5C4CA 1ZCVA 3U2TA 1FO8A 2RJ9A 4ZDQA 4EVWA 1FRWA 2XMEA 2V0IA 1S4NA 1ZJPA 2VSHA 5L6SA 3DJ4A 5CMFX 4AYJA 4LW6A 5C3DA 4B4GA 1R82A 1O7OA 2AESA 1ZHJA 4Y63A 3I0KA 4XWIA 3F1YA 5C3AA 5C4EA 4FRQA 1GA8A 4FROA 4D0TA 4KRVA 2Q4JA 2MZBA 1G95A 3V0QA 2QKXA 1VGUA 4FQWA 4HG6A 4Q7CA 1LL3A 5DDTA 4K6RA 2W0WA 2YC3A 3SX3A 3JUJA 2P72A 4KC2A 1FXJA 1JVDA 5FUHA 1H5TB 2VSIA 2BO4A 3T7OA 4FRBA 1H5RB 1NKHB 4Y6UA 2UX8A 4FCUA 1GX0A 5C48A 1H5RA 4Y7VA 4HO2A 2XWMA 3OKRA 1LZ0A 2FYAA 2QH5A 3SXAA 1GWVA 3N9WA 3TQDA 1SS9A 4B2XA 1VICA 4HO0A 5D91A 3OH1A 4BMAA 4HO5A 4Y64A 1GQCA 5C1LA 1ZIZA 1O0RA 3SXDA 1GX4A 4Y7FA 2YQSA 1OQMB 1ZDGA 2BO8A 3PNNA 2Z86A 1R7VA 4IRQA 1WVCA 4B4MA 4E1KA 2GGOA 3I0LA 4KT7A 3USQA 2APCA 3OH3A 2YQJA 2RJ0A 1JV1A 1YP4A 1YROB 2Y6PA 1NWGB 1WT1A 2YC5A 3I0CA 4GBPA 1VZTA 4KPZA 4Y62A 4B42A 1IIMA 2D0JA 2PGYA 5FV9A 3U2WA 3CU0A 4KNRA 4FIXA 2WE9A 2X65A 5AJOA 4MIXA 1HM0A 1E5KA 2V0KA 2FFUA 1FGXA 1H5SC 2RIZA 5C4BA 4EE5A 1ZCYA 3V91A 4HCQA 1MP3A 2RJ7A 1ZCTA 5C49A 3JUKA 3CGXA 1GQ9A 4NAIA 5J49A 1H4DA 1G97A 4HO4A 4J18A 2RIXA 4MYBA 4MNDA 4AC3A 2C0NA 2VK9A 4FRPA 4HOCA 1PZYB 1FR8A 4O6MA 1ZI5A 4Y9XA 4Y6NA 1ZDFA 1G23A 1HM8A 4NALA 1V83A 5CMJA 1ON6A 4Y7UA 4AAWA 5C8RA 1G2VA 5D92A 1ZI4A 2RIYA 1H7HA 5IFYA 3KIAA 1QG8A 4O6NA 1H7FA 1H7QA 1R7YA 4KC1A 4P00A 1INJA 2AM3A 5CQMX 1EZIA 3CKJA 5CQOA 2AGDA 4NAKA 5CQLX 4HO9A 3LW6A 5C3BA 4M2AA 5C4DA 2RJ8A 1YP3A 3I0EA 1H7TA 3V0OA 5AJNA 2Y4KA 4G87A 5C1GA 1OMZA 3E26A 2ZU8A 4D11C 1W77A 2D7IA 1VH3A 1H7LA 4ARWA 3ZGFA 5CQNX 1G1LA 2ZU9A 1R80A 1W57A 1WT3A 2YQHA 3SX5A 2AH9A 2Y4LA 1XZ6A 2X60A 1H5TA 4EEMA 2BO6A 4CJBA 4DE7A 4R7PA 3ZLKA 5I1FA 3F1CA 5C36A 1ZJ3A 2YESA 2VD4A 1LVWA 1ZJ1A 2JCJA 1MC3A 1R7TA 1ZJ2A 3DK5A 1NF5B 1QWJA 2O1HA 2FY7A 4FRMA 1HJJA 1G8OA 2PGVA 3V8ZA 1JVGA 3BCVA 4G3SA 5DDVA 3OH2A 2YQCA 2WAWA 4BQHA 3R2WA 5IDTA 3IOIA 5JQQA 1H4CA 1TW1A 1ON8A 3ZF8A 1JV3A 4D48A 3SX8A 3HL3A 3OH4A 3CKVA 1NMMB 4KXOA 2OI5A 3POLA 2RJ5A 5C38A 4DECA 3Q80A 1ZI1A 1VZUA 3I0GA 3GUEA 2Y4MA 2Z87A 2JCKA 1VGZA 2RJ1A 4C2SA 1H7GA 1MP4A 2WVMA 3PKPA 4KC4A 3I0HA 3OH0A 5FU8A 2A8UA 1HJLA 2P73A 1G0RA 3QVBA 4CJ8A 3IOHA 4EE3A 1H4EA 1MP5A 4FRLA 4DDZA 4L41C 3U2XA 2WGZA 1IINA 1K4VA 1QGSA 5CMGX 3I0FA 3NGWA 4B3UA 3O3PA 2VS4A 2GGQA 1R81A 1VM8A 4B2WA 1FGGA 2W0VA 4G3QA 3SXCA 3TZTA 3V8YA 4B5BA 1VZXA 1R7UA 1O7QA 4G3PA 1LZIA 5AJPA 4HO8A 4Y7GA 3T7NA 1H7EA 3PKQA 1Z90A 2FYCB 2X5ZA 3V0PA 1HV9A 1H3MA 1FXOA 5FU0A 3V0LA 3SXGA 4KNXA 3ST8A 5FTVA 4D0ZA 3D8VA 3SXBA 2PX7A 1LZ7A 1ZJ0A 2WEEA 4ECMA 3OAMA 2AM4A 2OEFA 1ZCUA
chains in the Genus database with same CATH topology
3K8DA 5HS2A 4JISA 4HO6A 3D98A 2JCOA 3IOJA 3Q7UA 5FYEA 2P6WA 2YCMA 1WSZA 3RMWA 1G93A 2FYBA 3U0XA 4EEAA 1FG5N 1TW5A 1I52A 1NHEB 4EE4A 3I0JA 5C47A 2Y4JA 2RJ4A 4IRPA 3RMVA 4JD0A 2VFZA 4Y7TA 5IDSA 1V84A 2DPWA 3E25A 3SX7A 1JYLA 1HM9A 4FRHA 2NXVA 1R7XA 5EJZA 5CQPA 3ZGGA 3CKNA 2WVLA 1FO9A 5BXCA 2OI6A 4HO3A 5C1HA 1ZJOA 2V0LA 1PZTA 3ZLLA 2I5KA 3OC9A 3U0YA 1G3LA 3RSBA 2ICXA 3JTJA 2AE7A 1FR9A 2I5EA 1H5SD 1TVYA 2RJ6A 4UEGA 4P02A 2AECA 1EYRA 3FWWA 3CKOA 1NQIB 2I7BA 3T7MA 1QGQA 2ZU7A 1JYKA 3V0MA 4M28A 3SPTA 2JCLA 1KWSA 2FFVA 2VS3A 1LL0A 3D5NA 1OMXA 2XWNA 4ASJA 1H5SB 1YP2A 4FIYA 1H5SA 2Y7AA 2O1FA 2AM5A 2RITA 4EEGA 1S4OA 2VXMA 5EJ1A 3EE5A 5L6VA 3R3IA 4KPXA 2V0JA 5FTSA 3CKQA 2J0BA 1S4PA 4M2BA 5EIYA 5CMHA 3V90A 1G9RA 2D7RA 2QGIA 3SXEA 1LL2A 3V0NA 3Q4SA 2A8WA 2VXLA 4FCEA 2PA4A 4EEOA 1W55A 1VGTA 1ZI3A 3I0DA 3K8EA 5CMIA 2BO7A 3U2UA 2E8BA 1LZJA 4LW3A 1WT0A 4FRDA 1FZWA 4NANA 4B4BA 1INIA 3U2VA 1V82A 1FWYA 2VS5A 2ICYA 4CJCA 1FOAA 2O1GA 2OEGA 4ASYA 3FOQA 2FYDB 2WVKA 4M4KA 2V0HA 1VH1A 3BRKX 2CU2A 4FREA 1GWWA 1XHBA 1VGWA 4YS8A 3DUVA 4KQLA 5C4FA 2OI7A 3I0IX 3USRA 2XMHA 2XWLA 2E3DA 2X5SA 3OGZA 4D11A 1WT2A 1TZFA 1VPAA 1O23B 4CVHA 4AYLA 4FRAA 2J0AA 5C4CA 1ZCVA 3U2TA 1FO8A 2RJ9A 4ZDQA 4EVWA 1FRWA 2XMEA 2V0IA 1S4NA 1ZJPA 2VSHA 5L6SA 3DJ4A 5CMFX 4AYJA 4LW6A 5C3DA 4B4GA 1R82A 1O7OA 2AESA 1ZHJA 4Y63A 3I0KA 4XWIA 3F1YA 5C3AA 5C4EA 4FRQA 1GA8A 4FROA 4D0TA 4KRVA 2Q4JA 2MZBA 1G95A 3V0QA 2QKXA 1VGUA 4FQWA 4HG6A 4Q7CA 1LL3A 5DDTA 4K6RA 2W0WA 2YC3A 3SX3A 3JUJA 2P72A 4KC2A 1FXJA 1JVDA 5FUHA 1H5TB 2VSIA 2BO4A 3T7OA 4FRBA 1H5RB 1NKHB 4Y6UA 2UX8A 4FCUA 1GX0A 5C48A 1H5RA 4Y7VA 4HO2A 2XWMA 3OKRA 1LZ0A 2FYAA 2QH5A 3SXAA 1GWVA 3N9WA 3TQDA 1SS9A 4B2XA 1VICA 4HO0A 5D91A 3OH1A 4BMAA 4HO5A 4Y64A 1GQCA 5C1LA 1ZIZA 1O0RA 3SXDA 1GX4A 4Y7FA 2YQSA 1OQMB 1ZDGA 2BO8A 3PNNA 2Z86A 1R7VA 4IRQA 1WVCA 4B4MA 4E1KA 2GGOA 3I0LA 4KT7A 3USQA 2APCA 3OH3A 2YQJA 2RJ0A 1JV1A 1YP4A 1YROB 2Y6PA 1NWGB 1WT1A 2YC5A 3I0CA 4GBPA 1VZTA 4KPZA 4Y62A 4B42A 1IIMA 2D0JA 2PGYA 5FV9A 3U2WA 3CU0A 4KNRA 4FIXA 2WE9A 2X65A 5AJOA 4MIXA 1HM0A 1E5KA 2V0KA 2FFUA 1FGXA 1H5SC 2RIZA 5C4BA 4EE5A 1ZCYA 3V91A 4HCQA 1MP3A 2RJ7A 1ZCTA 5C49A 3JUKA 3CGXA 1GQ9A 4NAIA 5J49A 1H4DA 1G97A 4HO4A 4J18A 2RIXA 4MYBA 4MNDA 4AC3A 2C0NA 2VK9A 4FRPA 4HOCA 1PZYB 1FR8A 4O6MA 1ZI5A 4Y9XA 4Y6NA 1ZDFA 1G23A 1HM8A 4NALA 1V83A 5CMJA 1ON6A 4Y7UA 4AAWA 5C8RA 1G2VA 5D92A 1ZI4A 2RIYA 1H7HA 5IFYA 3KIAA 1QG8A 4O6NA 1H7FA 1H7QA 1R7YA 4KC1A 4P00A 1INJA 2AM3A 5CQMX 1EZIA 3CKJA 5CQOA 2AGDA 4NAKA 5CQLX 4HO9A 3LW6A 5C3BA 4M2AA 5C4DA 2RJ8A 1YP3A 3I0EA 1H7TA 3V0OA 5AJNA 2Y4KA 4G87A 5C1GA 1OMZA 3E26A 2ZU8A 4D11C 1W77A 2D7IA 1VH3A 1H7LA 4ARWA 3ZGFA 5CQNX 1G1LA 2ZU9A 1R80A 1W57A 1WT3A 2YQHA 3SX5A 2AH9A 2Y4LA 1XZ6A 2X60A 1H5TA 4EEMA 2BO6A 4CJBA 4DE7A 4R7PA 3ZLKA 5I1FA 3F1CA 5C36A 1ZJ3A 2YESA 2VD4A 1LVWA 1ZJ1A 2JCJA 1MC3A 1R7TA 1ZJ2A 3DK5A 1NF5B 1QWJA 2O1HA 2FY7A 4FRMA 1HJJA 1G8OA 2PGVA 3V8ZA 1JVGA 3BCVA 4G3SA 5DDVA 3OH2A 2YQCA 2WAWA 4BQHA 3R2WA 5IDTA 3IOIA 5JQQA 1H4CA 1TW1A 1ON8A 3ZF8A 1JV3A 4D48A 3SX8A 3HL3A 3OH4A 3CKVA 1NMMB 4KXOA 2OI5A 3POLA 2RJ5A 5C38A 4DECA 3Q80A 1ZI1A 1VZUA 3I0GA 3GUEA 2Y4MA 2Z87A 2JCKA 1VGZA 2RJ1A 4C2SA 1H7GA 1MP4A 2WVMA 3PKPA 4KC4A 3I0HA 3OH0A 5FU8A 2A8UA 1HJLA 2P73A 1G0RA 3QVBA 4CJ8A 3IOHA 4EE3A 1H4EA 1MP5A 4FRLA 4DDZA 4L41C 3U2XA 2WGZA 1IINA 1K4VA 1QGSA 5CMGX 3I0FA 3NGWA 4B3UA 3O3PA 2VS4A 2GGQA 1R81A 1VM8A 4B2WA 1FGGA 2W0VA 4G3QA 3SXCA 3TZTA 3V8YA 4B5BA 1VZXA 1R7UA 1O7QA 4G3PA 1LZIA 5AJPA 4HO8A 4Y7GA 3T7NA 1H7EA 3PKQA 1Z90A 2FYCB 2X5ZA 3V0PA 1HV9A 1H3MA 1FXOA 5FU0A 3V0LA 3SXGA 4KNXA 3ST8A 5FTVA 4D0ZA 3D8VA 3SXBA 2PX7A 1LZ7A 1ZJ0A 2WEEA 4ECMA 3OAMA 2AM4A 2OEFA 1ZCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8D A;  5HS2 A;  4JIS A;  4HO6 A;  3D98 A;  2JCO A;  3IOJ A;  3Q7U A;  5FYE A;  2P6W A;  2YCM A;  1WSZ A;  3RMW A;  1G93 A;  2FYB A;  3U0X A;  4EEA A;  1FG5 N;  1TW5 A;  1I52 A;  1NHE B;  4EE4 A;  3I0J A;  5C47 A;  2Y4J A;  2RJ4 A;  4IRP A;  3RMV A;  4JD0 A;  2VFZ A;  4Y7T A;  5IDS A;  1V84 A;  2DPW A;  3E25 A;  3SX7 A;  1JYL A;  1HM9 A;  4FRH A;  2NXV A;  1R7X A;  5EJZ A;  5CQP A;  3ZGG A;  3CKN A;  2WVL A;  1FO9 A;  5BXC A;  2OI6 A;  4HO3 A;  5C1H A;  1ZJO A;  2V0L A;  1PZT A;  3ZLL A;  2I5K A;  3OC9 A;  3U0Y A;  1G3L A;  3RSB A;  2ICX A;  3JTJ A;  2AE7 A;  1FR9 A;  2I5E A;  1H5S D;  1TVY A;  2RJ6 A;  4UEG A;  4P02 A;  2AEC A;  1EYR A;  3FWW A;  3CKO A;  1NQI B;  2I7B A;  3T7M A;  1QGQ A;  2ZU7 A;  1JYK A;  3V0M A;  4M28 A;  3SPT A;  2JCL A;  1KWS A;  2FFV A;  2VS3 A;  1LL0 A;  3D5N A;  1OMX A;  2XWN A;  4ASJ A;  1H5S B;  1YP2 A;  1H5S A;  2Y7A A;  2O1F A;  2AM5 A;  2RIT A;  4EEG A;  1S4O A;  2VXM A;  5EJ1 A;  3EE5 A;  5L6V A;  3R3I A;  4KPX A;  2V0J A;  5FTS A;  3CKQ A;  1S4P A;  4M2B A;  5EIY A;  5CMH A;  3V90 A;  1G9R A;  2D7R A;  2QGI A;  3SXE A;  1LL2 A;  3V0N A;  3Q4S A;  2A8W A;  2VXL A;  4FCE A;  2PA4 A;  4EEO A;  1W55 A;  1VGT A;  1ZI3 A;  3I0D A;  3K8E A;  5CMI A;  2BO7 A;  3U2U A;  2E8B A;  1LZJ A;  4LW3 A;  1WT0 A;  4FRD A;  1FZW A;  4NAN A;  4B4B A;  1INI A;  3U2V A;  1V82 A;  1FWY A;  2VS5 A;  2ICY A;  4CJC A;  1FOA A;  2O1G A;  2OEG A;  4ASY A;  3FOQ A;  2FYD B;  2WVK A;  4M4K A;  2V0H A;  1VH1 A;  3BRK X;  2CU2 A;  4FRE A;  1GWW A;  1XHB A;  1VGW A;  4YS8 A;  3DUV A;  4KQL A;  5C4F A;  2OI7 A;  3I0I X;  3USR A;  2XMH A;  2XWL A;  2E3D A;  2X5S A;  3OGZ A;  4D11 A;  1WT2 A;  1TZF A;  1VPA A;  1O23 B;  4CVH A;  4AYL A;  4FRA A;  5C4C A;  1ZCV A;  3U2T A;  1FO8 A;  2RJ9 A;  4ZDQ A;  4EVW A;  1FRW A;  2XME A;  2V0I A;  1S4N A;  1ZJP A;  2VSH A;  5L6S A;  3DJ4 A;  5CMF X;  4AYJ A;  4LW6 A;  5C3D A;  4B4G A;  1R82 A;  1O7O A;  2AES A;  1ZHJ A;  4Y63 A;  3I0K A;  4XWI A;  3F1Y A;  5C3A A;  5C4E A;  4FRQ A;  1GA8 A;  4FRO A;  4D0T A;  4KRV A;  2Q4J A;  2MZB A;  1G95 A;  3V0Q A;  2QKX A;  1VGU A;  4FQW A;  4HG6 A;  1LL3 A;  5DDT A;  4K6R A;  2W0W A;  2YC3 A;  3SX3 A;  3JUJ A;  2P72 A;  4KC2 A;  1FXJ A;  1JVD A;  5FUH A;  1H5T B;  2VSI A;  2BO4 A;  3T7O A;  4FRB A;  1H5R B;  1NKH B;  4Y6U A;  2UX8 A;  4FCU A;  1GX0 A;  5C48 A;  1H5R A;  4Y7V A;  4HO2 A;  2XWM A;  3OKR A;  1LZ0 A;  2FYA A;  2QH5 A;  3SXA A;  1GWV A;  3N9W A;  3TQD A;  1SS9 A;  4B2X A;  1VIC A;  4HO0 A;  3OH1 A;  4BMA A;  4HO5 A;  4Y64 A;  1GQC A;  5C1L A;  1ZIZ A;  1O0R A;  3SXD A;  1GX4 A;  4Y7F A;  2YQS A;  1OQM B;  1ZDG A;  2BO8 A;  3PNN A;  2Z86 A;  1R7V A;  4IRQ A;  1WVC A;  4B4M A;  4E1K A;  2GGO A;  3I0L A;  4KT7 A;  3USQ A;  2APC A;  3OH3 A;  2YQJ A;  2RJ0 A;  1JV1 A;  1YP4 A;  1YRO B;  2Y6P A;  1NWG B;  1WT1 A;  2YC5 A;  3I0C A;  4GBP A;  1VZT A;  4KPZ A;  4Y62 A;  4B42 A;  1IIM A;  2D0J A;  2PGY A;  5FV9 A;  3U2W A;  3CU0 A;  4KNR A;  2WE9 A;  2X65 A;  5AJO A;  1HM0 A;  1E5K A;  2V0K A;  2FFU A;  1FGX A;  1H5S C;  2RIZ A;  5C4B A;  4EE5 A;  1ZCY A;  3V91 A;  4HCQ A;  1MP3 A;  2RJ7 A;  1ZCT A;  5C49 A;  3JUK A;  3CGX A;  1GQ9 A;  4NAI A;  5J49 A;  1H4D A;  1G97 A;  4HO4 A;  4J18 A;  2RIX A;  4MYB A;  4MND A;  4AC3 A;  4FRP A;  4HOC A;  1PZY B;  1FR8 A;  1ZI5 A;  4Y9X A;  4Y6N A;  1ZDF A;  1G23 A;  1HM8 A;  4NAL A;  1V83 A;  5CMJ A;  1ON6 A;  4Y7U A;  4AAW A;  5C8R A;  1G2V A;  1ZI4 A;  2RIY A;  1H7H A;  5IFY A;  3KIA A;  1QG8 A;  1H7F A;  1H7Q A;  1R7Y A;  4KC1 A;  4P00 A;  1INJ A;  2AM3 A;  5CQM X;  1EZI A;  3CKJ A;  5CQO A;  2AGD A;  4NAK A;  5CQL X;  4HO9 A;  3LW6 A;  5C3B A;  4M2A A;  5C4D A;  2RJ8 A;  1YP3 A;  3I0E A;  1H7T A;  3V0O A;  5AJN A;  2Y4K A;  4G87 A;  5C1G A;  1OMZ A;  3E26 A;  2ZU8 A;  4D11 C;  1W77 A;  2D7I A;  1VH3 A;  1H7L A;  4ARW A;  3ZGF A;  5CQN X;  1G1L A;  2ZU9 A;  1R80 A;  1W57 A;  1WT3 A;  2YQH A;  3SX5 A;  2AH9 A;  2Y4L A;  1XZ6 A;  2X60 A;  1H5T A;  4EEM A;  2BO6 A;  4CJB A;  4DE7 A;  4R7P A;  3ZLK A;  5I1F A;  3F1C A;  5C36 A;  1ZJ3 A;  2YES A;  2VD4 A;  1LVW A;  1ZJ1 A;  2JCJ A;  1MC3 A;  1R7T A;  1ZJ2 A;  3DK5 A;  1NF5 B;  1QWJ A;  2O1H A;  2FY7 A;  4FRM A;  1HJJ A;  1G8O A;  2PGV A;  3V8Z A;  1JVG A;  3BCV A;  4G3S A;  5DDV A;  3OH2 A;  2YQC A;  2WAW A;  4BQH A;  3R2W A;  5IDT A;  3IOI A;  5JQQ A;  1H4C A;  1TW1 A;  1ON8 A;  3ZF8 A;  1JV3 A;  4D48 A;  3SX8 A;  3HL3 A;  3OH4 A;  3CKV A;  1NMM B;  4KXO A;  2OI5 A;  3POL A;  2RJ5 A;  5C38 A;  4DEC A;  3Q80 A;  1ZI1 A;  1VZU A;  3I0G A;  3GUE A;  2Y4M A;  2Z87 A;  2JCK A;  1VGZ A;  2RJ1 A;  4C2S A;  1H7G A;  1MP4 A;  2WVM A;  3PKP A;  4KC4 A;  3I0H A;  3OH0 A;  5FU8 A;  2A8U A;  1HJL A;  2P73 A;  1G0R A;  3QVB A;  4CJ8 A;  3IOH A;  4EE3 A;  1H4E A;  1MP5 A;  4FRL A;  4DDZ A;  4L41 C;  3U2X A;  2WGZ A;  1IIN A;  1K4V A;  1QGS A;  5CMG X;  3I0F A;  3NGW A;  4B3U A;  3O3P A;  2VS4 A;  2GGQ A;  1R81 A;  1VM8 A;  4B2W A;  1FGG A;  2W0V A;  4G3Q A;  3SXC A;  3TZT A;  3V8Y A;  4B5B A;  1VZX A;  1R7U A;  1O7Q A;  4G3P A;  1LZI A;  5AJP A;  4HO8 A;  4Y7G A;  3T7N A;  1H7E A;  3PKQ A;  1Z90 A;  2FYC B;  2X5Z A;  3V0P A;  1HV9 A;  1H3M A;  1FXO A;  5FU0 A;  3V0L A;  3SXG A;  4KNX A;  3ST8 A;  5FTV A;  4D0Z A;  3D8V A;  3SXB A;  2PX7 A;  1LZ7 A;  1ZJ0 A;  2WEE A;  4ECM A;  3OAM A;  2AM4 A;  2OEF A;  1ZCU A; 
#chains in the Genus database with same CATH topology
 3K8D A;  5HS2 A;  4JIS A;  4HO6 A;  3D98 A;  2JCO A;  3IOJ A;  3Q7U A;  5FYE A;  2P6W A;  2YCM A;  1WSZ A;  3RMW A;  1G93 A;  2FYB A;  3U0X A;  4EEA A;  1FG5 N;  1TW5 A;  1I52 A;  1NHE B;  4EE4 A;  3I0J A;  5C47 A;  2Y4J A;  2RJ4 A;  4IRP A;  3RMV A;  4JD0 A;  2VFZ A;  4Y7T A;  5IDS A;  1V84 A;  2DPW A;  3E25 A;  3SX7 A;  1JYL A;  1HM9 A;  4FRH A;  2NXV A;  1R7X A;  5EJZ A;  5CQP A;  3ZGG A;  3CKN A;  2WVL A;  1FO9 A;  5BXC A;  2OI6 A;  4HO3 A;  5C1H A;  1ZJO A;  2V0L A;  1PZT A;  3ZLL A;  2I5K A;  3OC9 A;  3U0Y A;  1G3L A;  3RSB A;  2ICX A;  3JTJ A;  2AE7 A;  1FR9 A;  2I5E A;  1H5S D;  1TVY A;  2RJ6 A;  4UEG A;  4P02 A;  2AEC A;  1EYR A;  3FWW A;  3CKO A;  1NQI B;  2I7B A;  3T7M A;  1QGQ A;  2ZU7 A;  1JYK A;  3V0M A;  4M28 A;  3SPT A;  2JCL A;  1KWS A;  2FFV A;  2VS3 A;  1LL0 A;  3D5N A;  1OMX A;  2XWN A;  4ASJ A;  1H5S B;  1YP2 A;  4FIY A;  1H5S A;  2Y7A A;  2O1F A;  2AM5 A;  2RIT A;  4EEG A;  1S4O A;  2VXM A;  5EJ1 A;  3EE5 A;  5L6V A;  3R3I A;  4KPX A;  2V0J A;  5FTS A;  3CKQ A;  2J0B A;  1S4P A;  4M2B A;  5EIY A;  5CMH A;  3V90 A;  1G9R A;  2D7R A;  2QGI A;  3SXE A;  1LL2 A;  3V0N A;  3Q4S A;  2A8W A;  2VXL A;  4FCE A;  2PA4 A;  4EEO A;  1W55 A;  1VGT A;  1ZI3 A;  3I0D A;  3K8E A;  5CMI A;  2BO7 A;  3U2U A;  2E8B A;  1LZJ A;  4LW3 A;  1WT0 A;  4FRD A;  1FZW A;  4NAN A;  4B4B A;  1INI A;  3U2V A;  1V82 A;  1FWY A;  2VS5 A;  2ICY A;  4CJC A;  1FOA A;  2O1G A;  2OEG A;  4ASY A;  3FOQ A;  2FYD B;  2WVK A;  4M4K A;  2V0H A;  1VH1 A;  3BRK X;  2CU2 A;  4FRE A;  1GWW A;  1XHB A;  1VGW A;  4YS8 A;  3DUV A;  4KQL A;  5C4F A;  2OI7 A;  3I0I X;  3USR A;  2XMH A;  2XWL A;  2E3D A;  2X5S A;  3OGZ A;  4D11 A;  1WT2 A;  1TZF A;  1VPA A;  1O23 B;  4CVH A;  4AYL A;  4FRA A;  2J0A A;  5C4C A;  1ZCV A;  3U2T A;  1FO8 A;  2RJ9 A;  4ZDQ A;  4EVW A;  1FRW A;  2XME A;  2V0I A;  1S4N A;  1ZJP A;  2VSH A;  5L6S A;  3DJ4 A;  5CMF X;  4AYJ A;  4LW6 A;  5C3D A;  4B4G A;  1R82 A;  1O7O A;  2AES A;  1ZHJ A;  4Y63 A;  3I0K A;  4XWI A;  3F1Y A;  5C3A A;  5C4E A;  4FRQ A;  1GA8 A;  4FRO A;  4D0T A;  4KRV A;  2Q4J A;  2MZB A;  1G95 A;  3V0Q A;  2QKX A;  1VGU A;  4FQW A;  4HG6 A;  4Q7C A;  1LL3 A;  5DDT A;  4K6R A;  2W0W A;  2YC3 A;  3SX3 A;  3JUJ A;  2P72 A;  4KC2 A;  1FXJ A;  1JVD A;  5FUH A;  1H5T B;  2VSI A;  2BO4 A;  3T7O A;  4FRB A;  1H5R B;  1NKH B;  4Y6U A;  2UX8 A;  4FCU A;  1GX0 A;  5C48 A;  1H5R A;  4Y7V A;  4HO2 A;  2XWM A;  3OKR A;  1LZ0 A;  2FYA A;  2QH5 A;  3SXA A;  1GWV A;  3N9W A;  3TQD A;  1SS9 A;  4B2X A;  1VIC A;  4HO0 A;  5D91 A;  3OH1 A;  4BMA A;  4HO5 A;  4Y64 A;  1GQC A;  5C1L A;  1ZIZ A;  1O0R A;  3SXD A;  1GX4 A;  4Y7F A;  2YQS A;  1OQM B;  1ZDG A;  2BO8 A;  3PNN A;  2Z86 A;  1R7V A;  4IRQ A;  1WVC A;  4B4M A;  4E1K A;  2GGO A;  3I0L A;  4KT7 A;  3USQ A;  2APC A;  3OH3 A;  2YQJ A;  2RJ0 A;  1JV1 A;  1YP4 A;  1YRO B;  2Y6P A;  1NWG B;  1WT1 A;  2YC5 A;  3I0C A;  4GBP A;  1VZT A;  4KPZ A;  4Y62 A;  4B42 A;  1IIM A;  2D0J A;  2PGY A;  5FV9 A;  3U2W A;  3CU0 A;  4KNR A;  4FIX A;  2WE9 A;  2X65 A;  5AJO A;  4MIX A;  1HM0 A;  1E5K A;  2V0K A;  2FFU A;  1FGX A;  1H5S C;  2RIZ A;  5C4B A;  4EE5 A;  1ZCY A;  3V91 A;  4HCQ A;  1MP3 A;  2RJ7 A;  1ZCT A;  5C49 A;  3JUK A;  3CGX A;  1GQ9 A;  4NAI A;  5J49 A;  1H4D A;  1G97 A;  4HO4 A;  4J18 A;  2RIX A;  4MYB A;  4MND A;  4AC3 A;  2C0N A;  2VK9 A;  4FRP A;  4HOC A;  1PZY B;  1FR8 A;  4O6M A;  1ZI5 A;  4Y9X A;  4Y6N A;  1ZDF A;  1G23 A;  1HM8 A;  4NAL A;  1V83 A;  5CMJ A;  1ON6 A;  4Y7U A;  4AAW A;  5C8R A;  1G2V A;  5D92 A;  1ZI4 A;  2RIY A;  1H7H A;  5IFY A;  3KIA A;  1QG8 A;  4O6N A;  1H7F A;  1H7Q A;  1R7Y A;  4KC1 A;  4P00 A;  1INJ A;  2AM3 A;  5CQM X;  1EZI A;  3CKJ A;  5CQO A;  2AGD A;  4NAK A;  5CQL X;  4HO9 A;  3LW6 A;  5C3B A;  4M2A A;  5C4D A;  2RJ8 A;  1YP3 A;  3I0E A;  1H7T A;  3V0O A;  5AJN A;  2Y4K A;  4G87 A;  5C1G A;  1OMZ A;  3E26 A;  2ZU8 A;  4D11 C;  1W77 A;  2D7I A;  1VH3 A;  1H7L A;  4ARW A;  3ZGF A;  5CQN X;  1G1L A;  2ZU9 A;  1R80 A;  1W57 A;  1WT3 A;  2YQH A;  3SX5 A;  2AH9 A;  2Y4L A;  1XZ6 A;  2X60 A;  1H5T A;  4EEM A;  2BO6 A;  4CJB A;  4DE7 A;  4R7P A;  3ZLK A;  5I1F A;  3F1C A;  5C36 A;  1ZJ3 A;  2YES A;  2VD4 A;  1LVW A;  1ZJ1 A;  2JCJ A;  1MC3 A;  1R7T A;  1ZJ2 A;  3DK5 A;  1NF5 B;  1QWJ A;  2O1H A;  2FY7 A;  4FRM A;  1HJJ A;  1G8O A;  2PGV A;  3V8Z A;  1JVG A;  3BCV A;  4G3S A;  5DDV A;  3OH2 A;  2YQC A;  2WAW A;  4BQH A;  3R2W A;  5IDT A;  3IOI A;  5JQQ A;  1H4C A;  1TW1 A;  1ON8 A;  3ZF8 A;  1JV3 A;  4D48 A;  3SX8 A;  3HL3 A;  3OH4 A;  3CKV A;  1NMM B;  4KXO A;  2OI5 A;  3POL A;  2RJ5 A;  5C38 A;  4DEC A;  3Q80 A;  1ZI1 A;  1VZU A;  3I0G A;  3GUE A;  2Y4M A;  2Z87 A;  2JCK A;  1VGZ A;  2RJ1 A;  4C2S A;  1H7G A;  1MP4 A;  2WVM A;  3PKP A;  4KC4 A;  3I0H A;  3OH0 A;  5FU8 A;  2A8U A;  1HJL A;  2P73 A;  1G0R A;  3QVB A;  4CJ8 A;  3IOH A;  4EE3 A;  1H4E A;  1MP5 A;  4FRL A;  4DDZ A;  4L41 C;  3U2X A;  2WGZ A;  1IIN A;  1K4V A;  1QGS A;  5CMG X;  3I0F A;  3NGW A;  4B3U A;  3O3P A;  2VS4 A;  2GGQ A;  1R81 A;  1VM8 A;  4B2W A;  1FGG A;  2W0V A;  4G3Q A;  3SXC A;  3TZT A;  3V8Y A;  4B5B A;  1VZX A;  1R7U A;  1O7Q A;  4G3P A;  1LZI A;  5AJP A;  4HO8 A;  4Y7G A;  3T7N A;  1H7E A;  3PKQ A;  1Z90 A;  2FYC B;  2X5Z A;  3V0P A;  1HV9 A;  1H3M A;  1FXO A;  5FU0 A;  3V0L A;  3SXG A;  4KNX A;  3ST8 A;  5FTV A;  4D0Z A;  3D8V A;  3SXB A;  2PX7 A;  1LZ7 A;  1ZJ0 A;  2WEE A;  4ECM A;  3OAM A;  2AM4 A;  2OEF A;  1ZCU A; 
#chains in the Genus database with same CATH homology
 3K8D A;  5HS2 A;  4JIS A;  4HO6 A;  3D98 A;  2JCO A;  3IOJ A;  3Q7U A;  5FYE A;  2P6W A;  2YCM A;  1WSZ A;  3RMW A;  1G93 A;  2FYB A;  3U0X A;  4EEA A;  1FG5 N;  1TW5 A;  1I52 A;  1NHE B;  4EE4 A;  3I0J A;  5C47 A;  2Y4J A;  2RJ4 A;  4IRP A;  3RMV A;  4JD0 A;  2VFZ A;  4Y7T A;  5IDS A;  1V84 A;  2DPW A;  3E25 A;  3SX7 A;  1JYL A;  1HM9 A;  4FRH A;  2NXV A;  1R7X A;  5EJZ A;  5CQP A;  3ZGG A;  3CKN A;  2WVL A;  1FO9 A;  5BXC A;  2OI6 A;  4HO3 A;  5C1H A;  1ZJO A;  2V0L A;  1PZT A;  3ZLL A;  2I5K A;  3OC9 A;  3U0Y A;  1G3L A;  3RSB A;  2ICX A;  3JTJ A;  2AE7 A;  1FR9 A;  2I5E A;  1H5S D;  1TVY A;  2RJ6 A;  4UEG A;  4P02 A;  2AEC A;  1EYR A;  3FWW A;  3CKO A;  1NQI B;  2I7B A;  3T7M A;  1QGQ A;  2ZU7 A;  1JYK A;  3V0M A;  4M28 A;  3SPT A;  2JCL A;  1KWS A;  2FFV A;  2VS3 A;  1LL0 A;  3D5N A;  1OMX A;  2XWN A;  4ASJ A;  1H5S B;  1YP2 A;  4FIY A;  1H5S A;  2Y7A A;  2O1F A;  2AM5 A;  2RIT A;  4EEG A;  1S4O A;  2VXM A;  5EJ1 A;  3EE5 A;  5L6V A;  3R3I A;  4KPX A;  2V0J A;  5FTS A;  3CKQ A;  2J0B A;  1S4P A;  4M2B A;  5EIY A;  5CMH A;  3V90 A;  1G9R A;  2D7R A;  2QGI A;  3SXE A;  1LL2 A;  3V0N A;  3Q4S A;  2A8W A;  2VXL A;  4FCE A;  2PA4 A;  4EEO A;  1W55 A;  1VGT A;  1ZI3 A;  3I0D A;  3K8E A;  5CMI A;  2BO7 A;  3U2U A;  2E8B A;  1LZJ A;  4LW3 A;  1WT0 A;  4FRD A;  1FZW A;  4NAN A;  4B4B A;  1INI A;  3U2V A;  1V82 A;  1FWY A;  2VS5 A;  2ICY A;  4CJC A;  1FOA A;  2O1G A;  2OEG A;  4ASY A;  3FOQ A;  2FYD B;  2WVK A;  4M4K A;  2V0H A;  1VH1 A;  3BRK X;  2CU2 A;  4FRE A;  1GWW A;  1XHB A;  1VGW A;  4YS8 A;  3DUV A;  4KQL A;  5C4F A;  2OI7 A;  3I0I X;  3USR A;  2XMH A;  2XWL A;  2E3D A;  2X5S A;  3OGZ A;  4D11 A;  1WT2 A;  1TZF A;  1VPA A;  1O23 B;  4CVH A;  4AYL A;  4FRA A;  2J0A A;  5C4C A;  1ZCV A;  3U2T A;  1FO8 A;  2RJ9 A;  4ZDQ A;  4EVW A;  1FRW A;  2XME A;  2V0I A;  1S4N A;  1ZJP A;  2VSH A;  5L6S A;  3DJ4 A;  5CMF X;  4AYJ A;  4LW6 A;  5C3D A;  4B4G A;  1R82 A;  1O7O A;  2AES A;  1ZHJ A;  4Y63 A;  3I0K A;  4XWI A;  3F1Y A;  5C3A A;  5C4E A;  4FRQ A;  1GA8 A;  4FRO A;  4D0T A;  4KRV A;  2Q4J A;  2MZB A;  1G95 A;  3V0Q A;  2QKX A;  1VGU A;  4FQW A;  4HG6 A;  4Q7C A;  1LL3 A;  5DDT A;  4K6R A;  2W0W A;  2YC3 A;  3SX3 A;  3JUJ A;  2P72 A;  4KC2 A;  1FXJ A;  1JVD A;  5FUH A;  1H5T B;  2VSI A;  2BO4 A;  3T7O A;  4FRB A;  1H5R B;  1NKH B;  4Y6U A;  2UX8 A;  4FCU A;  1GX0 A;  5C48 A;  1H5R A;  4Y7V A;  4HO2 A;  2XWM A;  3OKR A;  1LZ0 A;  2FYA A;  2QH5 A;  3SXA A;  1GWV A;  3N9W A;  3TQD A;  1SS9 A;  4B2X A;  1VIC A;  4HO0 A;  5D91 A;  3OH1 A;  4BMA A;  4HO5 A;  4Y64 A;  1GQC A;  5C1L A;  1ZIZ A;  1O0R A;  3SXD A;  1GX4 A;  4Y7F A;  2YQS A;  1OQM B;  1ZDG A;  2BO8 A;  3PNN A;  2Z86 A;  1R7V A;  4IRQ A;  1WVC A;  4B4M A;  4E1K A;  2GGO A;  3I0L A;  4KT7 A;  3USQ A;  2APC A;  3OH3 A;  2YQJ A;  2RJ0 A;  1JV1 A;  1YP4 A;  1YRO B;  2Y6P A;  1NWG B;  1WT1 A;  2YC5 A;  3I0C A;  4GBP A;  1VZT A;  4KPZ A;  4Y62 A;  4B42 A;  1IIM A;  2D0J A;  2PGY A;  5FV9 A;  3U2W A;  3CU0 A;  4KNR A;  4FIX A;  2WE9 A;  2X65 A;  5AJO A;  4MIX A;  1HM0 A;  1E5K A;  2V0K A;  2FFU A;  1FGX A;  1H5S C;  2RIZ A;  5C4B A;  4EE5 A;  1ZCY A;  3V91 A;  4HCQ A;  1MP3 A;  2RJ7 A;  1ZCT A;  5C49 A;  3JUK A;  3CGX A;  1GQ9 A;  4NAI A;  5J49 A;  1H4D A;  1G97 A;  4HO4 A;  4J18 A;  2RIX A;  4MYB A;  4MND A;  4AC3 A;  2C0N A;  2VK9 A;  4FRP A;  4HOC A;  1PZY B;  1FR8 A;  4O6M A;  1ZI5 A;  4Y9X A;  4Y6N A;  1ZDF A;  1G23 A;  1HM8 A;  4NAL A;  1V83 A;  5CMJ A;  1ON6 A;  4Y7U A;  4AAW A;  5C8R A;  1G2V A;  5D92 A;  1ZI4 A;  2RIY A;  1H7H A;  5IFY A;  3KIA A;  1QG8 A;  4O6N A;  1H7F A;  1H7Q A;  1R7Y A;  4KC1 A;  4P00 A;  1INJ A;  2AM3 A;  5CQM X;  1EZI A;  3CKJ A;  5CQO A;  2AGD A;  4NAK A;  5CQL X;  4HO9 A;  3LW6 A;  5C3B A;  4M2A A;  5C4D A;  2RJ8 A;  1YP3 A;  3I0E A;  1H7T A;  3V0O A;  5AJN A;  2Y4K A;  4G87 A;  5C1G A;  1OMZ A;  3E26 A;  2ZU8 A;  4D11 C;  1W77 A;  2D7I A;  1VH3 A;  1H7L A;  4ARW A;  3ZGF A;  5CQN X;  1G1L A;  2ZU9 A;  1R80 A;  1W57 A;  1WT3 A;  2YQH A;  3SX5 A;  2AH9 A;  2Y4L A;  1XZ6 A;  2X60 A;  1H5T A;  4EEM A;  2BO6 A;  4CJB A;  4DE7 A;  4R7P A;  3ZLK A;  5I1F A;  3F1C A;  5C36 A;  1ZJ3 A;  2YES A;  2VD4 A;  1LVW A;  1ZJ1 A;  2JCJ A;  1MC3 A;  1R7T A;  1ZJ2 A;  3DK5 A;  1NF5 B;  1QWJ A;  2O1H A;  2FY7 A;  4FRM A;  1HJJ A;  1G8O A;  2PGV A;  3V8Z A;  1JVG A;  3BCV A;  4G3S A;  5DDV A;  3OH2 A;  2YQC A;  2WAW A;  4BQH A;  3R2W A;  5IDT A;  3IOI A;  5JQQ A;  1H4C A;  1TW1 A;  1ON8 A;  3ZF8 A;  1JV3 A;  4D48 A;  3SX8 A;  3HL3 A;  3OH4 A;  3CKV A;  1NMM B;  4KXO A;  2OI5 A;  3POL A;  2RJ5 A;  5C38 A;  4DEC A;  3Q80 A;  1ZI1 A;  1VZU A;  3I0G A;  3GUE A;  2Y4M A;  2Z87 A;  2JCK A;  1VGZ A;  2RJ1 A;  4C2S A;  1H7G A;  1MP4 A;  2WVM A;  3PKP A;  4KC4 A;  3I0H A;  3OH0 A;  5FU8 A;  2A8U A;  1HJL A;  2P73 A;  1G0R A;  3QVB A;  4CJ8 A;  3IOH A;  4EE3 A;  1H4E A;  1MP5 A;  4FRL A;  4DDZ A;  4L41 C;  3U2X A;  2WGZ A;  1IIN A;  1K4V A;  1QGS A;  5CMG X;  3I0F A;  3NGW A;  4B3U A;  3O3P A;  2VS4 A;  2GGQ A;  1R81 A;  1VM8 A;  4B2W A;  1FGG A;  2W0V A;  4G3Q A;  3SXC A;  3TZT A;  3V8Y A;  4B5B A;  1VZX A;  1R7U A;  1O7Q A;  4G3P A;  1LZI A;  5AJP A;  4HO8 A;  4Y7G A;  3T7N A;  1H7E A;  3PKQ A;  1Z90 A;  2FYC B;  2X5Z A;  3V0P A;  1HV9 A;  1H3M A;  1FXO A;  5FU0 A;  3V0L A;  3SXG A;  4KNX A;  3ST8 A;  5FTV A;  4D0Z A;  3D8V A;  3SXB A;  2PX7 A;  1LZ7 A;  1ZJ0 A;  2WEE A;  4ECM A;  3OAM A;  2AM4 A;  2OEF A;  1ZCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...