1FO9A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
344
structure length
331
Chain Sequence
ELAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 109
structure length 331
sequence length 344
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo9A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo9A01
3Q80A 1O7QA 4G87A 5C3DA 1FXOA 5CMIA 1R7TA 2ZU8A 3V8ZA 1LZ0A 1G1LA 2FY7A 1NWGB 4B4MA 1VH3A 1GQCA 3U0XA 3U2WA 1W57A 4LW3A 4FRHA 1EZIA 1WT2A 1NF5B 1S4OA 4HO6A 3CGXA 1JYLA 4UEGA 5AJNA 2Z86A 1FOAA 4G3SA 1ZJ0A 1K4VA 3T7NA 4EE3A 2FYAA 4FRMA 4HG6A 4D48A 1WT3A 1NQIB 1VH1A 4FROA 1S4PA 2OEFA 2AECA 1NHEB 4EE4A 4G3QA 2YC3A 4IRPA 3I0DA 5C3BA 4FRLA 3SPTA 2O1GA 3OH4A 1QWJA 3OH0A 4KT7A 2WVKA 1R80A 2BO6A 4Y63A 3T7OA 5FUHA 2V0KA 3U2VA 2X5ZA 2AESA 4KQLA 2I7BA 1KWSA 2YQSA 5DDTA 2Z87A 3V8YA 2QKXA 3EE5A 1VGTA 2VS5A 1V82A 5C1GA 1LL3A 2Y6PA 5EJ1A 1NMMB 2AM5A 3HL3A 3ZF8A 5C47A 4XWIA 5EIYA 5HS2A 2RIZA 5FV9A 4Y9XA 4J18A 1QG8A 4HO5A 3IOIA 1H5SC 1GWWA 2JCOA 4D11A 2X5SA 1FGXA 2RJ5A 3V91A 2FFUA 1VZXA 2RJ8A 4KC2A 2QGIA 1G2VA 2W0WA 4B4BA 4NAIA 3I0GA 1OMXA 1ZI4A 4CJCA 3RSBA 1JV1A 3OH3A 4Y62A 2AM3A 4M2BA 3RMWA 1R82A 3USQA 2PGVA 1FR8A 2BO8A 3I0HA 2P72A 3ZGGA 4FCEA 4FRDA 5DDVA 4BQHA 4EVWA 1ON8A 3U0YA 5CMHA 1ZCYA 1FGGA 2VXMA 1G9RA 4M28A 1LZJA 1R7XA 3I0FA 3V0LA 3CU0A 1V84A 3R2WA 2V0JA 1H5RB 3BCVA 2YQHA 1FRWA 1ZIZA 3TZTA 2YC5A 2OEGA 4ASYA 3FOQA 1HM9A 1HM8A 2OI6A 4FRPA 3ZLLA 5CQMX 1H4CA 5AJOA 1HJLA 2D7IA 1FWYA 2MZBA 2BO7A 4R7PA 2PX7A 1W55A 2E3DA 4KRVA 3SX8A 5CQNX 4B4GA 4B42A 3I0LA 3BRKX 1VGZA 5IFYA 4KNXA 1FXJA 1PZYB 5C1LA 3K8EA 4Y7TA 2I5EA 5C4FA 3ZGFA 3IOHA 4M4KA 3CKVA 3CKJA 1MP5A 4Y7UA 4AAWA 2VS3A 4KPZA 1H7QA 3IOJA 3JUJA 4Y7GA 4HO0A 3U2XA 4Y64A 4B5BA 4HO8A 3U2TA 3I0CA 5J49A 3N9WA 3OH1A 2D7RA 2JCJA 4JISA 4B2WA 1IIMA 1H7FA 2YQCA 4K6RA 1FZWA 1H5TB 1ZJOA 5C3AA 2Q4JA 3E25A 4B3UA 2APCA 1G23A 5AJPA 4HO9A 1QGQA 2A8WA 1FO8A 1MP3A 3I0JA 4ECMA 1H7GA 2AH9A 2O1HA 5EJZA 2GGOA 1JVGA 1VICA 1XZ6A 5FTVA 2VSIA 4FQWA 1H5RA 1EYRA 1VPAA 2VD4A 1LZ7A 3Q7UA 1GX4A 3V90A 2ZU7A 3F1YA 4NANA 2GGQA 3V0OA 3USRA 4D11C 1R81A 1FR9A 4Y6NA 5L6VA 4C2SA 3SXEA 1S4NA 4CVHA 4HOCA 1LL2A 4EEMA 1G95A 4CJ8A 3V0QA 2FFVA 3SX5A 5C49A 5CMFX 1QGSA 2V0LA 4DDZA 1I52A 3OC9A 1O0RA 1YP4A 1INIA 4L41C 2O1FA 1VZUA 3KIAA 1ZI3A 3PKQA 3TQDA 3OH2A 1YP2A 4ASJA 1VZTA 1ZJ1A 1YROB 1XHBA 2AGDA 3DK5A 2V0HA 4HO2A 4GBPA 1R7UA 1VM8A 3JUKA 3SXCA 2P6WA 2WEEA 2AE7A 2WAWA 4BMAA 4ZDQA 2RJ7A 3NGWA 1OQMB 1ON6A 5C36A 3SX7A 1R7YA 2VXLA 2AM4A 3V0PA 3PNNA 1WVCA 2RJ4A 1SS9A 5C4DA 5JQQA 5CQPA 1H5TA 1JVDA 1INJA 3K8DA 4KC1A 3ST8A 3OAMA 4D0TA 2VFZA 2I5KA 2YESA 1G3LA 3RMVA 5C4BA 1ZDFA 5CMGX 4G3PA 4EEAA 1H7TA 4B2XA 5FU0A 2X60A 2XWNA 2RJ0A 4Y6UA 4AYLA 4ARWA 2P73A 2JCLA 1GA8A 2RJ9A 1O23B 2DPWA 3ZLKA 4HCQA 1ZCUA 2W0VA 1H4EA 2XWLA 4FRAA 3CKOA 3Q4SA 1H7HA 1WT1A 4KNRA 4M2AA 2OI5A 2UX8A 5FTSA 4CJBA 4YS8A 1HM0A 1O7OA 4JD0A 4DE7A 1TW1A 4LW6A 1NKHB 3D98A 3FWWA 1W77A 2Y4KA 4Y7FA 4FRQA 4DECA 3CKQA 3OGZA 1WT0A 2Y4MA 1H5SB 3QVBA 3SX3A 1MC3A 1H7EA 2V0IA 2VSHA 4FCUA 1VGWA 4EE5A 4IRQA 1ZCVA 3SXAA 1TZFA 5C38A 5CQOA 1MP4A 3O3PA 2XMEA 1ZDGA 2XMHA 5C4CA 2E8BA 2WE9A 2Y7AA 2XWMA 4MNDA 2FYBA 3T7MA 5C48A 3I0EA 2ICYA 2YQJA 1YP3A 2PA4A 1OMZA 4AYJA 1IINA 1HJJA 3SXGA 3V0MA 5IDSA 3POLA 2A8UA 1ZHJA 4HO4A 1R7VA 3E26A 1E5KA 4FRBA 5I1FA 1G8OA 2RIXA 2QH5A 4EEGA 4Y7VA 3SXBA 1ZJ3A 1PZTA 3DUVA 4NAKA 4MYBA 1V83A 3LW6A 1GWVA 1H7LA 1H5SD 1Z90A 1ZCTA 1LL0A 1GX0A 3OKRA 4HO3A 5C8RA 2PGYA 4P00A 3U2UA 2WVMA 4FREA 3D8VA 1FO9A 4D0ZA 5FYEA 5IDTA 5L6SA 3DJ4A 2RJ6A 4EEOA 2ICXA 2FYDB 4KC4A 1LZIA 1H5SA 2VS4A 3JTJA 1LVWA 1TW5A 1WSZA 2WGZA 2RIYA 1FG5N 1HV9A 2YCMA 4KXOA 2WVLA 1VGUA 3GUEA 5C1HA 2BO4A 2Y4LA 2ZU9A 2RJ1A 1JYKA 1JV3A 4E1KA 2OI7A 1ZJ2A 3V0NA 4NALA 3D5NA 2D0JA 1TVYA 2NXVA 1ZJPA 2X65A 5BXCA 1ZI1A 1G97A 3CKNA 4P02A 3PKPA 2FYCB 4KPXA 5CQLX 3SXDA 5CMJA 5C4EA 1GQ9A 1H3MA 1G93A 2RITA 3I0KA 3I0IX 5FU8A 1G0RA 3R3IA 2CU2A 1H4DA 3F1CA 2JCKA 2Y4JA 1ZI5A 4AC3A
chains in the Genus database with same CATH superfamily
3Q80A 1O7QA 4JH7A 4G87A 4Q7CA 5C3DA 3CT8A 1FXOA 5CMIA 1R7TA 2ZU8A 3V8ZA 3KOLA 1LZ0A 1G1LA 2FY7A 3OXHA 1NWGB 1F1VA 4B4MA 4NVSA 1VH3A 1GQCA 3U0XA 3U2WA 1W57A 4LW3A 4FRHA 1EZIA 1JIFA 1WT2A 4Z6LA 1NF5B 3OJNA 1S4OA 1F1XA 4HO6A 3CGXA 1JYLA 4UEGA 3OA4A 2Z86A 5AJNA 1XQAA 1FOAA 4G3SA 2P7QA 1ZJ0A 1K4VA 3T7NA 4EE3A 2FYAA 4FRMA 4HG6A 3PKVA 1K4NA 3RRIA 4D48A 1KW8B 1WT3A 2P7OA 1NQIB 1VH1A 4FROA 1Q0OA 2QNTA 1S4PA 2OEFA 1FA6A 2AECA 1NHEB 1SQDA 1KMYA 5KEFA 4EE4A 3OAJA 4Z6MA 4G3QA 2YC3A 4IRPA 3I0DA 1KWBB 5C3BA 4FRLA 3SPTA 3LHOA 2O1GA 3OH4A 1QWJA 3OH0A 4KT7A 2WVKA 1Q0CA 4G6XA 1R80A 2BO6A 4Y63A 3T7OA 5FUHA 2V0KA 3U2VA 4NAYA 5D91A 2EI0A 2X5ZA 2AESA 4KQLA 2I7BA 1KWSA 4Z6OA 2YQSA 1XRKA 5DDTA 2Z87A 3V8YA 2QKXA 3EE5A 1VGTA 2VS5A 1V82A 5C1GA 1LL3A 3HQ0A 1JC5A 2Y6PA 5EJ1A 1NMMB 2AM5A 4OPNA 2J0BA 2RK9A 3HL3A 4JH1A 3ZF8A 5C47A 1CJXA 4XWIA 5EIYA 2RIZA 5FV9A 4Y9XA 4GYMA 4J18A 5HS2A 1QG8A 4HO5A 4IAGA 3IOIA 1H5SC 3ECKA 1GWWA 2JCOA 4D11A 4JH2A 3BZAA 2X5SA 4Z6NA 3ISQA 3W0TA 1FGXA 2RJ5A 3V91A 2FFUA 2R5VA 5F6QA 1VZXA 1TWUA 2RJ8A 4KC2A 1ECSA 2QGIA 1G2VA 2W0WA 4LQBA 4B4BA 4NAIA 2VK9A 3I0GA 1OMXA 2WL3A 3ZI1A 1ZI4A 5CTOA 1DHYA 4CJCA 3RSBA 5CJ3A 4NB0A 1JV1A 4FIYA 3G12A 1R9CA 3L7TA 3OH3A 4Y62A 2AM3A 4M2BA 3RMWA 1R82A 5CB9A 4FIXA 1JC4A 2PGVA 3USQA 1KWCB 2EI1A 1NPBA 2ZYQA 1FR8A 2BO8A 3I0HA 2P72A 3ZGGA 4FCEA 4FRDA 5DDVA 4BQHA 4EVWA 3E0RA 1ON8A 5CMHA 4Z6TA 3U0YA 1ZCYA 1FGGA 2VXMA 4Z04A 4Z6SA 1G9RA 4M28A 1LZJA 1R7XA 3I0FA 3V0LA 3CU0A 1V84A 3R2WA 2V0JA 2P7LA 1SS4A 1H5RB 3HPYA 3BCVA 2YQHA 1FRWA 4NAZA 1ZIZA 3TZTA 2YC5A 3VW9A 1FA7A 2OEGA 4ASYA 3FOQA 1HM9A 1HM8A 2OI6A 4FRPA 3ZLLA 5CQMX 1H4CA 5AJOA 1HJLA 2EHZA 2D7IA 1FWYA 2MZBA 2BO7A 1SP9A 4R7PA 2PX7A 1W55A 1TFZA 2E3DA 4KRVA 4GHCA 5BWHA 4MIXA 3SX8A 5CQNX 4B4GA 4B42A 3I0LA 3BRKX 1VGZA 5IFYA 4KNXA 1FXJA 1PZYB 1FROA 1FA5A 5C1LA 3K8EA 4Y7TA 2I5EA 5C4FA 3R4QA 3ZGFA 2C0NA 1LQOA 3IOHA 4M4KA 3CKVA 4JH6A 3CKJA 3HUHA 1MP5A 4Y7UA 4MTRA 4AAWA 3ZW5A 2VS3A 4KPZA 1H7QA 3IOJA 1TSJA 4NB2A 3JUJA 4Y7GA 4HO0A 3U2XA 4Y64A 4B5BA 4HO8A 3U2TA 3I0CA 5DRHA 3N9WA 5J49A 3ECJA 3OH1A 2D7RA 2JCJA 4JISA 4B2WA 1IIMA 1H7FA 2YQCA 4K6RA 1FZWA 1H5TB 1ZJOA 5C3AA 2Q4JA 3E25A 1U6LA 1G23A 2APCA 3P8AA 4B3UA 3IUZA 4PAVA 5C6XA 5AJPA 2RJBA 2ZHPA 4HO9A 1QGQA 2A8WA 1FO8A 1MP3A 3I0JA 4ECMA 1H7GA 2EI3A 2AH9A 2ZA0A 2O1HA 5EJZA 3B59A 1JVGA 2GGOA 4Z6QA 4GHHA 1VICA 1XZ6A 5HCWA 5FTVA 2VSIA 4FQWA 1H5RA 3BQXA 1EYRA 4X2AA 3OULA 1VPAA 2VD4A 2QH0A 1LZ7A 1GX4A 3W0UA 3Q7UA 3V90A 2ZU7A 1LGTA 3F1YA 4NANA 5D7ZA 2GGQA 3V0OA 3USRA 4D11C 1R81A 2WL9A 1FR9A 4Y6NA 5L6VA 4C2SA 3SXEA 1BH5A 1S4NA 4CVHA 4HOCA 1LL2A 2J0AA 1G95A 4CJ8A 4EEMA 4O6NA 3V0QA 4JH5A 2FFVA 3SX5A 5C49A 5CMFX 1MH6A 1QGSA 2V0LA 4DDZA 1HANA 1I52A 3OC9A 3EY7A 1F9ZA 1O0RA 1YP4A 1INIA 4L41C 2O1FA 1VZUA 3KIAA 1ZI3A 3PKQA 3R6AA 3TQDA 3OH2A 1YP2A 4ASJA 1VZTA 1ZJ1A 1YROB 1XHBA 2AGDA 3DK5A 2V0HA 4HO2A 4GBPA 1NKIA 1R7UA 1VM8A 3HPVA 4Z6UA 3JUKA 3SXCA 1SQIA 2P6WA 1T47A 2AE7A 2WAWA 1KW6B 2WEEA 4BMAA 4ZDQA 2RJ7A 3NGWA 1OQMB 3HDPA 1ON6A 5C36A 3SX7A 5C68A 1R7YA 2ZW5A 2VXLA 2AM4A 2QQZA 3V0PA 3PNNA 1FA8A 1WVCA 2RJ4A 1SS9A 5C4DA 5JQQA 2EI2A 5CQPA 4Z6VA 4NB1A 1H5TA 1JVDA 1INJA 3GHJA 3K8DA 4KC1A 1F1UA 3ST8A 2RK0A 3OAMA 4D0TA 2R6UA 2VFZA 2I5KA 2YESA 1G3LA 3RMVA 5C4BA 1ZDFA 3OUMA 1EIRA 1EILA 5CMGX 4G3PA 4EEAA 4GHGA 3OJJA 1H7TA 5FU0A 2X60A 1ZSWA 2XWNA 4B2XA 2RJ0A 4Y6UA 2P7MA 4AYLA 4ARWA 2P73A 2JCLA 1GA8A 2RJ9A 4QB5A 1O23B 2DPWA 3ZLKA 4HCQA 1ZCUA 2W0VA 1H4EA 2XWLA 4FRAA 1KLLA 3CKOA 3Q4SA 1LQKA 3LM4A 1H7HA 1WT1A 4KNRA 4M2AA 2ZW4A 2RBBA 2OI5A 2UX8A 5FTSA 4CJBA 4YS8A 1HM0A 1O7OA 1SP8A 1U69A 4JD0A 4DE7A 1TW1A 1NNRA 1NKHB 4LW6A 1QIPA 1QINA 3D98A 3FWWA 4JH8A 1W77A 2Y4KA 4Y7FA 4FRQA 5DHWA 4DECA 5C4PA 3CKQA 3OGZA 1WT0A 2IG9A 2Y4MA 1H5SB 3QVBA 3SX3A 1KNFA 1QTOA 3OJKA 4GHEA 4KYHA 1H7EA 1MC3A 3OJTA 5EC3A 2V0IA 2ZW6A 3OPYB 2VSHA 4FCUA 1KW9B 4Z6PA 1VGWA 3HNQA 4EE5A 4IRQA 1ZCVA 3SXAA 1TZFA 1NIQB 3PKXA 5C38A 5CQOA 1MP4A 3O3PA 2XMEA 1ZDGA 2XMHA 2C21A 5C4CA 2E8BA 2WE9A 2Y7AA 2XWMA 4Z6WA 4MNDA 4MTSA 2FYBA 3T7MA 5C48A 1KW3B 5BWGA 3I0EA 2ICYA 4Z6ZA 2YQJA 1YP3A 2IGAA 4RT5A 2PA4A 1OMZA 4AYJA 1IINA 1HJJA 3SK2A 1KNDA 4GHFA 3SXGA 4MYMA 3V0MA 3FCDA 5IDSA 3POLA 2A8UA 1ZHJA 4HO4A 1R7VA 1LKDA 3E26A 1E5KA 4FRBA 5I1FA 1G8OA 2RIXA 4Z6RA 2QH5A 4EEGA 4JH9A 1EWJA 4Y7VA 3SXBA 1ZJ3A 1PZTA 3RMUA 3DUVA 4NAKA 2PJSA 4JD1A 1F1RA 1V83A 4MTQA 4MYBA 2ZI8A 1XY7A 3LW6A 1GWVA 1LQPA 1H7LA 1TG5A 1H5SD 1Z90A 1ZCTA 1LL0A 1GX0A 3OKRA 3L20A 4PV5A 4GHDA 4HO3A 5C8RA 2PGYA 4P00A 3U2UA 2WVMA 4IR0A 3D8VA 4FREA 2P25A 1FO9A 4D0ZA 4HC5A 4N04A 4KYKA 5FYEA 1EIQA 1MPYA 5IDTA 3DJ4A 5L6SA 1KMZA 3VB0A 5D4FA 2RJ6A 4EEOA 2ICXA 2FYDB 1BYLA 2ZW7A 1LZIA 4KC4A 1H5SA 2Q48A 2VS4A 3JTJA 1LVWA 1TW5A 2I7RA 1WSZA 2WGZA 2RIYA 1FG5N 2A4WA 1HV9A 3OPYA 2YCMA 3E5DA 4KXOA 2WVLA 1VGUA 5D92A 3RHEA 3ZGJA 3GUEA 5C1HA 2BO4A 2Y4LA 2ZU9A 2RJ1A 1JYKA 1JV3A 4E1KA 2OI7A 1ZJ2A 3V0NA 4NALA 3D5NA 2D0JA 3PKWA 3EY8A 1TVYA 2NXVA 1ZJPA 2X65A 4O6MA 5BXCA 3GM5A 1ZI1A 1G97A 3CKNA 4P02A 3PKPA 2FYCB 4KPXA 5CQLX 3SXDA 5CMJA 5C4EA 1GQ9A 2P7PA 1H3MA 1G93A 2RITA 3I0KA 3I0IX 5FU8A 1G0RA 4JH4A 5DFGA 3R3IA 2CU2A 2A4XA 1H4DA 3F1CA 4HUZA 2JCKA 2Y4JA 4JH3A 1ZI5A 4MTTA 1JIEA 2P7KA 4AC3A
chains in the Genus database with same CATH topology
3Q80A 1O7QA 4G87A 4Q7CA 5C3DA 1FXOA 5CMIA 1R7TA 2ZU8A 3V8ZA 1LZ0A 1G1LA 2FY7A 1NWGB 4B4MA 1VH3A 1GQCA 3U0XA 3U2WA 1W57A 4LW3A 4FRHA 1EZIA 1WT2A 1NF5B 1S4OA 4HO6A 3CGXA 1JYLA 4UEGA 5AJNA 2Z86A 1FOAA 4G3SA 1ZJ0A 1K4VA 3T7NA 4EE3A 2FYAA 4FRMA 4HG6A 4D48A 1WT3A 1NQIB 1VH1A 4FROA 1S4PA 2OEFA 2AECA 1NHEB 4EE4A 4G3QA 2YC3A 4IRPA 3I0DA 5C3BA 4FRLA 3SPTA 2O1GA 3OH4A 1QWJA 3OH0A 4KT7A 2WVKA 1R80A 2BO6A 4Y63A 3T7OA 5FUHA 2V0KA 3U2VA 5D91A 2X5ZA 2AESA 4KQLA 2I7BA 1KWSA 2YQSA 5DDTA 2Z87A 3V8YA 2QKXA 3EE5A 1VGTA 2VS5A 1V82A 5C1GA 1LL3A 2Y6PA 5EJ1A 1NMMB 2AM5A 2J0BA 3HL3A 3ZF8A 5C47A 4XWIA 5EIYA 5HS2A 2RIZA 5FV9A 4Y9XA 4J18A 1QG8A 4HO5A 3IOIA 1H5SC 1GWWA 2JCOA 4D11A 2X5SA 1FGXA 2RJ5A 3V91A 2FFUA 1VZXA 2RJ8A 4KC2A 2QGIA 1G2VA 2W0WA 4B4BA 4NAIA 2VK9A 3I0GA 1OMXA 1ZI4A 4CJCA 3RSBA 1JV1A 4FIYA 3OH3A 4Y62A 2AM3A 4M2BA 3RMWA 1R82A 4FIXA 3USQA 2PGVA 1FR8A 2BO8A 3I0HA 2P72A 3ZGGA 4FCEA 4FRDA 5DDVA 4BQHA 4EVWA 1ON8A 3U0YA 5CMHA 1ZCYA 1FGGA 2VXMA 1G9RA 4M28A 1LZJA 1R7XA 3I0FA 3V0LA 3CU0A 1V84A 3R2WA 2V0JA 1H5RB 3BCVA 2YQHA 1FRWA 1ZIZA 3TZTA 2YC5A 2OEGA 4ASYA 3FOQA 1HM9A 1HM8A 2OI6A 4FRPA 3ZLLA 5CQMX 1H4CA 5AJOA 1HJLA 2D7IA 1FWYA 2MZBA 2BO7A 4R7PA 2PX7A 1W55A 2E3DA 4KRVA 4MIXA 3SX8A 5CQNX 4B4GA 4B42A 3I0LA 3BRKX 1VGZA 5IFYA 4KNXA 1FXJA 1PZYB 5C1LA 3K8EA 4Y7TA 2I5EA 5C4FA 3ZGFA 2C0NA 3IOHA 4M4KA 3CKVA 3CKJA 1MP5A 4Y7UA 4AAWA 2VS3A 4KPZA 1H7QA 3IOJA 3JUJA 4Y7GA 4HO0A 3U2XA 4Y64A 4B5BA 4HO8A 3U2TA 3I0CA 5J49A 3N9WA 3OH1A 2D7RA 2JCJA 4JISA 4B2WA 1IIMA 1H7FA 2YQCA 4K6RA 1FZWA 1H5TB 1ZJOA 5C3AA 2Q4JA 3E25A 4B3UA 2APCA 1G23A 5AJPA 4HO9A 1QGQA 2A8WA 1FO8A 1MP3A 3I0JA 4ECMA 1H7GA 2AH9A 2O1HA 5EJZA 2GGOA 1JVGA 1VICA 1XZ6A 5FTVA 2VSIA 4FQWA 1H5RA 1EYRA 1VPAA 2VD4A 1LZ7A 3Q7UA 1GX4A 3V90A 2ZU7A 3F1YA 4NANA 2GGQA 3V0OA 3USRA 4D11C 1R81A 1FR9A 4Y6NA 5L6VA 4C2SA 3SXEA 1S4NA 4CVHA 4HOCA 1LL2A 2J0AA 1G95A 4CJ8A 4EEMA 4O6NA 3V0QA 2FFVA 3SX5A 5C49A 5CMFX 1QGSA 2V0LA 4DDZA 1I52A 3OC9A 1O0RA 1YP4A 1INIA 4L41C 2O1FA 1VZUA 3KIAA 1ZI3A 3PKQA 3TQDA 3OH2A 1YP2A 4ASJA 1VZTA 1ZJ1A 1YROB 1XHBA 2AGDA 3DK5A 2V0HA 4HO2A 4GBPA 1R7UA 1VM8A 3JUKA 3SXCA 2P6WA 2WEEA 2AE7A 2WAWA 4BMAA 4ZDQA 2RJ7A 3NGWA 1OQMB 1ON6A 5C36A 3SX7A 1R7YA 2VXLA 2AM4A 3V0PA 3PNNA 1WVCA 2RJ4A 1SS9A 5C4DA 5JQQA 5CQPA 1H5TA 1JVDA 1INJA 3K8DA 4KC1A 3ST8A 3OAMA 4D0TA 2VFZA 2I5KA 2YESA 1G3LA 3RMVA 5C4BA 1ZDFA 5CMGX 4G3PA 4EEAA 1H7TA 4B2XA 5FU0A 2X60A 2XWNA 2RJ0A 4Y6UA 4AYLA 4ARWA 2P73A 2JCLA 1GA8A 2RJ9A 1O23B 2DPWA 3ZLKA 4HCQA 1ZCUA 2W0VA 1H4EA 2XWLA 4FRAA 3CKOA 3Q4SA 1H7HA 1WT1A 4KNRA 4M2AA 2OI5A 2UX8A 5FTSA 4CJBA 4YS8A 1HM0A 1O7OA 4JD0A 4DE7A 1TW1A 4LW6A 1NKHB 3D98A 3FWWA 1W77A 2Y4KA 4Y7FA 4FRQA 4DECA 3CKQA 3OGZA 1WT0A 2Y4MA 1H5SB 3QVBA 3SX3A 1MC3A 1H7EA 2V0IA 2VSHA 4FCUA 1VGWA 4EE5A 4IRQA 1ZCVA 3SXAA 1TZFA 5C38A 5CQOA 1MP4A 3O3PA 2XMEA 1ZDGA 2XMHA 5C4CA 2E8BA 2WE9A 2Y7AA 2XWMA 4MNDA 2FYBA 3T7MA 5C48A 3I0EA 2ICYA 2YQJA 1YP3A 2PA4A 1OMZA 4AYJA 1IINA 1HJJA 3SXGA 3V0MA 5IDSA 3POLA 2A8UA 1ZHJA 4HO4A 1R7VA 3E26A 1E5KA 4FRBA 5I1FA 1G8OA 2RIXA 2QH5A 4EEGA 4Y7VA 3SXBA 1ZJ3A 1PZTA 3DUVA 4NAKA 4MYBA 1V83A 3LW6A 1GWVA 1H7LA 1H5SD 1Z90A 1ZCTA 1LL0A 1GX0A 3OKRA 4HO3A 5C8RA 2PGYA 4P00A 3U2UA 2WVMA 4FREA 3D8VA 1FO9A 4D0ZA 5FYEA 5IDTA 5L6SA 3DJ4A 2RJ6A 4EEOA 2ICXA 2FYDB 4KC4A 1LZIA 1H5SA 2VS4A 3JTJA 1LVWA 1TW5A 1WSZA 2WGZA 2RIYA 1FG5N 1HV9A 2YCMA 4KXOA 2WVLA 1VGUA 5D92A 3GUEA 5C1HA 2BO4A 2Y4LA 2ZU9A 2RJ1A 1JYKA 1JV3A 4E1KA 2OI7A 1ZJ2A 3V0NA 4NALA 3D5NA 2D0JA 1TVYA 2NXVA 1ZJPA 2X65A 4O6MA 5BXCA 1ZI1A 1G97A 3CKNA 4P02A 3PKPA 2FYCB 4KPXA 5CQLX 3SXDA 5CMJA 5C4EA 1GQ9A 1H3MA 1G93A 2RITA 3I0KA 3I0IX 5FU8A 1G0RA 3R3IA 2CU2A 1H4DA 3F1CA 2JCKA 2Y4JA 1ZI5A 4AC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q80 A;  1O7Q A;  4G87 A;  5C3D A;  1FXO A;  5CMI A;  1R7T A;  2ZU8 A;  3V8Z A;  1LZ0 A;  1G1L A;  2FY7 A;  1NWG B;  4B4M A;  1VH3 A;  1GQC A;  3U0X A;  3U2W A;  1W57 A;  4LW3 A;  4FRH A;  1EZI A;  1WT2 A;  1NF5 B;  1S4O A;  4HO6 A;  3CGX A;  1JYL A;  4UEG A;  5AJN A;  2Z86 A;  1FOA A;  4G3S A;  1ZJ0 A;  1K4V A;  3T7N A;  4EE3 A;  2FYA A;  4FRM A;  4HG6 A;  4D48 A;  1WT3 A;  1NQI B;  1VH1 A;  4FRO A;  1S4P A;  2OEF A;  2AEC A;  1NHE B;  4EE4 A;  4G3Q A;  2YC3 A;  4IRP A;  3I0D A;  5C3B A;  4FRL A;  3SPT A;  2O1G A;  3OH4 A;  1QWJ A;  3OH0 A;  4KT7 A;  2WVK A;  1R80 A;  2BO6 A;  4Y63 A;  3T7O A;  5FUH A;  2V0K A;  3U2V A;  2X5Z A;  2AES A;  4KQL A;  2I7B A;  1KWS A;  2YQS A;  5DDT A;  2Z87 A;  3V8Y A;  2QKX A;  3EE5 A;  1VGT A;  2VS5 A;  1V82 A;  5C1G A;  1LL3 A;  2Y6P A;  5EJ1 A;  1NMM B;  2AM5 A;  3HL3 A;  3ZF8 A;  5C47 A;  4XWI A;  5EIY A;  5HS2 A;  2RIZ A;  5FV9 A;  4Y9X A;  4J18 A;  1QG8 A;  4HO5 A;  3IOI A;  1H5S C;  1GWW A;  2JCO A;  4D11 A;  2X5S A;  1FGX A;  2RJ5 A;  3V91 A;  2FFU A;  1VZX A;  2RJ8 A;  4KC2 A;  2QGI A;  1G2V A;  2W0W A;  4B4B A;  4NAI A;  3I0G A;  1OMX A;  1ZI4 A;  4CJC A;  3RSB A;  1JV1 A;  3OH3 A;  4Y62 A;  2AM3 A;  4M2B A;  3RMW A;  1R82 A;  3USQ A;  2PGV A;  1FR8 A;  2BO8 A;  3I0H A;  2P72 A;  3ZGG A;  4FCE A;  4FRD A;  5DDV A;  4BQH A;  4EVW A;  1ON8 A;  3U0Y A;  5CMH A;  1ZCY A;  1FGG A;  2VXM A;  1G9R A;  4M28 A;  1LZJ A;  1R7X A;  3I0F A;  3V0L A;  3CU0 A;  1V84 A;  3R2W A;  2V0J A;  1H5R B;  3BCV A;  2YQH A;  1FRW A;  1ZIZ A;  3TZT A;  2YC5 A;  2OEG A;  4ASY A;  3FOQ A;  1HM9 A;  1HM8 A;  2OI6 A;  4FRP A;  3ZLL A;  5CQM X;  1H4C A;  5AJO A;  1HJL A;  2D7I A;  1FWY A;  2MZB A;  2BO7 A;  4R7P A;  2PX7 A;  1W55 A;  2E3D A;  4KRV A;  3SX8 A;  5CQN X;  4B4G A;  4B42 A;  3I0L A;  3BRK X;  1VGZ A;  5IFY A;  4KNX A;  1FXJ A;  1PZY B;  5C1L A;  3K8E A;  4Y7T A;  2I5E A;  5C4F A;  3ZGF A;  3IOH A;  4M4K A;  3CKV A;  3CKJ A;  1MP5 A;  4Y7U A;  4AAW A;  2VS3 A;  4KPZ A;  1H7Q A;  3IOJ A;  3JUJ A;  4Y7G A;  4HO0 A;  3U2X A;  4Y64 A;  4B5B A;  4HO8 A;  3U2T A;  3I0C A;  5J49 A;  3N9W A;  3OH1 A;  2D7R A;  2JCJ A;  4JIS A;  4B2W A;  1IIM A;  1H7F A;  2YQC A;  4K6R A;  1FZW A;  1H5T B;  1ZJO A;  5C3A A;  2Q4J A;  3E25 A;  4B3U A;  2APC A;  1G23 A;  5AJP A;  4HO9 A;  1QGQ A;  2A8W A;  1FO8 A;  1MP3 A;  3I0J A;  4ECM A;  1H7G A;  2AH9 A;  2O1H A;  5EJZ A;  2GGO A;  1JVG A;  1VIC A;  1XZ6 A;  5FTV A;  2VSI A;  4FQW A;  1H5R A;  1EYR A;  1VPA A;  2VD4 A;  1LZ7 A;  3Q7U A;  1GX4 A;  3V90 A;  2ZU7 A;  3F1Y A;  4NAN A;  2GGQ A;  3V0O A;  3USR A;  4D11 C;  1R81 A;  1FR9 A;  4Y6N A;  5L6V A;  4C2S A;  3SXE A;  1S4N A;  4CVH A;  4HOC A;  1LL2 A;  4EEM A;  1G95 A;  4CJ8 A;  3V0Q A;  2FFV A;  3SX5 A;  5C49 A;  5CMF X;  1QGS A;  2V0L A;  4DDZ A;  1I52 A;  3OC9 A;  1O0R A;  1YP4 A;  1INI A;  4L41 C;  2O1F A;  1VZU A;  3KIA A;  1ZI3 A;  3PKQ A;  3TQD A;  3OH2 A;  1YP2 A;  4ASJ A;  1VZT A;  1ZJ1 A;  1YRO B;  1XHB A;  2AGD A;  3DK5 A;  2V0H A;  4HO2 A;  4GBP A;  1R7U A;  1VM8 A;  3JUK A;  3SXC A;  2P6W A;  2WEE A;  2AE7 A;  2WAW A;  4BMA A;  4ZDQ A;  2RJ7 A;  3NGW A;  1OQM B;  1ON6 A;  5C36 A;  3SX7 A;  1R7Y A;  2VXL A;  2AM4 A;  3V0P A;  3PNN A;  1WVC A;  2RJ4 A;  1SS9 A;  5C4D A;  5JQQ A;  5CQP A;  1H5T A;  1JVD A;  1INJ A;  3K8D A;  4KC1 A;  3ST8 A;  3OAM A;  4D0T A;  2VFZ A;  2I5K A;  2YES A;  1G3L A;  3RMV A;  5C4B A;  1ZDF A;  5CMG X;  4G3P A;  4EEA A;  1H7T A;  4B2X A;  5FU0 A;  2X60 A;  2XWN A;  2RJ0 A;  4Y6U A;  4AYL A;  4ARW A;  2P73 A;  2JCL A;  1GA8 A;  2RJ9 A;  1O23 B;  2DPW A;  3ZLK A;  4HCQ A;  1ZCU A;  2W0V A;  1H4E A;  2XWL A;  4FRA A;  3CKO A;  3Q4S A;  1H7H A;  1WT1 A;  4KNR A;  4M2A A;  2OI5 A;  2UX8 A;  5FTS A;  4CJB A;  4YS8 A;  1HM0 A;  1O7O A;  4JD0 A;  4DE7 A;  1TW1 A;  4LW6 A;  1NKH B;  3D98 A;  3FWW A;  1W77 A;  2Y4K A;  4Y7F A;  4FRQ A;  4DEC A;  3CKQ A;  3OGZ A;  1WT0 A;  2Y4M A;  1H5S B;  3QVB A;  3SX3 A;  1MC3 A;  1H7E A;  2V0I A;  2VSH A;  4FCU A;  1VGW A;  4EE5 A;  4IRQ A;  1ZCV A;  3SXA A;  1TZF A;  5C38 A;  5CQO A;  1MP4 A;  3O3P A;  2XME A;  1ZDG A;  2XMH A;  5C4C A;  2E8B A;  2WE9 A;  2Y7A A;  2XWM A;  4MND A;  2FYB A;  3T7M A;  5C48 A;  3I0E A;  2ICY A;  2YQJ A;  1YP3 A;  2PA4 A;  1OMZ A;  4AYJ A;  1IIN A;  1HJJ A;  3SXG A;  3V0M A;  5IDS A;  3POL A;  2A8U A;  1ZHJ A;  4HO4 A;  1R7V A;  3E26 A;  1E5K A;  4FRB A;  5I1F A;  1G8O A;  2RIX A;  2QH5 A;  4EEG A;  4Y7V A;  3SXB A;  1ZJ3 A;  1PZT A;  3DUV A;  4NAK A;  4MYB A;  1V83 A;  3LW6 A;  1GWV A;  1H7L A;  1H5S D;  1Z90 A;  1ZCT A;  1LL0 A;  1GX0 A;  3OKR A;  4HO3 A;  5C8R A;  2PGY A;  4P00 A;  3U2U A;  2WVM A;  4FRE A;  3D8V A;  1FO9 A;  4D0Z A;  5FYE A;  5IDT A;  5L6S A;  3DJ4 A;  2RJ6 A;  4EEO A;  2ICX A;  2FYD B;  4KC4 A;  1LZI A;  1H5S A;  2VS4 A;  3JTJ A;  1LVW A;  1TW5 A;  1WSZ A;  2WGZ A;  2RIY A;  1FG5 N;  1HV9 A;  2YCM A;  4KXO A;  2WVL A;  1VGU A;  3GUE A;  5C1H A;  2BO4 A;  2Y4L A;  2ZU9 A;  2RJ1 A;  1JYK A;  1JV3 A;  4E1K A;  2OI7 A;  1ZJ2 A;  3V0N A;  4NAL A;  3D5N A;  2D0J A;  1TVY A;  2NXV A;  1ZJP A;  2X65 A;  5BXC A;  1ZI1 A;  1G97 A;  3CKN A;  4P02 A;  3PKP A;  2FYC B;  4KPX A;  5CQL X;  3SXD A;  5CMJ A;  5C4E A;  1GQ9 A;  1H3M A;  1G93 A;  2RIT A;  3I0K A;  3I0I X;  5FU8 A;  1G0R A;  3R3I A;  2CU2 A;  1H4D A;  3F1C A;  2JCK A;  2Y4J A;  1ZI5 A;  4AC3 A; 
#chains in the Genus database with same CATH topology
 3Q80 A;  1O7Q A;  4JH7 A;  4G87 A;  4Q7C A;  5C3D A;  3CT8 A;  1FXO A;  5CMI A;  1R7T A;  2ZU8 A;  3V8Z A;  3KOL A;  1LZ0 A;  1G1L A;  2FY7 A;  3OXH A;  1NWG B;  1F1V A;  4B4M A;  4NVS A;  1VH3 A;  1GQC A;  3U0X A;  3U2W A;  1W57 A;  4LW3 A;  4FRH A;  1EZI A;  1JIF A;  1WT2 A;  4Z6L A;  1NF5 B;  3OJN A;  1S4O A;  1F1X A;  4HO6 A;  3CGX A;  1JYL A;  4UEG A;  3OA4 A;  2Z86 A;  5AJN A;  1XQA A;  1FOA A;  4G3S A;  2P7Q A;  1ZJ0 A;  1K4V A;  3T7N A;  4EE3 A;  2FYA A;  4FRM A;  4HG6 A;  3PKV A;  1K4N A;  3RRI A;  4D48 A;  1KW8 B;  1WT3 A;  2P7O A;  1NQI B;  1VH1 A;  4FRO A;  1Q0O A;  2QNT A;  1S4P A;  2OEF A;  1FA6 A;  2AEC A;  1NHE B;  1SQD A;  1KMY A;  5KEF A;  4EE4 A;  3OAJ A;  4Z6M A;  4G3Q A;  2YC3 A;  4IRP A;  3I0D A;  1KWB B;  5C3B A;  4FRL A;  3SPT A;  3LHO A;  2O1G A;  3OH4 A;  1QWJ A;  3OH0 A;  4KT7 A;  2WVK A;  1Q0C A;  4G6X A;  1R80 A;  2BO6 A;  4Y63 A;  3T7O A;  5FUH A;  2V0K A;  3U2V A;  4NAY A;  5D91 A;  2EI0 A;  2X5Z A;  2AES A;  4KQL A;  2I7B A;  1KWS A;  4Z6O A;  2YQS A;  1XRK A;  5DDT A;  2Z87 A;  3V8Y A;  2QKX A;  3EE5 A;  1VGT A;  2VS5 A;  1V82 A;  5C1G A;  1LL3 A;  3HQ0 A;  1JC5 A;  2Y6P A;  5EJ1 A;  1NMM B;  2AM5 A;  4OPN A;  2J0B A;  2RK9 A;  3HL3 A;  4JH1 A;  3ZF8 A;  5C47 A;  1CJX A;  4XWI A;  5EIY A;  2RIZ A;  5FV9 A;  4Y9X A;  4GYM A;  4J18 A;  5HS2 A;  1QG8 A;  4HO5 A;  4IAG A;  3IOI A;  1H5S C;  3ECK A;  1GWW A;  2JCO A;  4D11 A;  4JH2 A;  3BZA A;  2X5S A;  4Z6N A;  3ISQ A;  3W0T A;  1FGX A;  2RJ5 A;  3V91 A;  2FFU A;  2R5V A;  5F6Q A;  1VZX A;  1TWU A;  2RJ8 A;  4KC2 A;  1ECS A;  2QGI A;  1G2V A;  2W0W A;  4LQB A;  4B4B A;  4NAI A;  2VK9 A;  3I0G A;  1OMX A;  2WL3 A;  3ZI1 A;  1ZI4 A;  5CTO A;  1DHY A;  4CJC A;  3RSB A;  5CJ3 A;  4NB0 A;  1JV1 A;  4FIY A;  3G12 A;  1R9C A;  3L7T A;  3OH3 A;  4Y62 A;  2AM3 A;  4M2B A;  3RMW A;  1R82 A;  5CB9 A;  4FIX A;  1JC4 A;  2PGV A;  3USQ A;  1KWC B;  2EI1 A;  1NPB A;  2ZYQ A;  1FR8 A;  2BO8 A;  3I0H A;  2P72 A;  3ZGG A;  4FCE A;  4FRD A;  5DDV A;  4BQH A;  4EVW A;  3E0R A;  1ON8 A;  5CMH A;  4Z6T A;  3U0Y A;  1ZCY A;  1FGG A;  2VXM A;  4Z04 A;  4Z6S A;  1G9R A;  4M28 A;  1LZJ A;  1R7X A;  3I0F A;  3V0L A;  3CU0 A;  1V84 A;  3R2W A;  2V0J A;  2P7L A;  1SS4 A;  1H5R B;  3HPY A;  3BCV A;  2YQH A;  1FRW A;  4NAZ A;  1ZIZ A;  3TZT A;  2YC5 A;  3VW9 A;  1FA7 A;  2OEG A;  4ASY A;  3FOQ A;  1HM9 A;  1HM8 A;  2OI6 A;  4FRP A;  3ZLL A;  5CQM X;  1H4C A;  5AJO A;  1HJL A;  2EHZ A;  2D7I A;  1FWY A;  2MZB A;  2BO7 A;  1SP9 A;  4R7P A;  2PX7 A;  1W55 A;  1TFZ A;  2E3D A;  4KRV A;  4GHC A;  5BWH A;  4MIX A;  3SX8 A;  5CQN X;  4B4G A;  4B42 A;  3I0L A;  3BRK X;  1VGZ A;  5IFY A;  4KNX A;  1FXJ A;  1PZY B;  1FRO A;  1FA5 A;  5C1L A;  3K8E A;  4Y7T A;  2I5E A;  5C4F A;  3R4Q A;  3ZGF A;  2C0N A;  1LQO A;  3IOH A;  4M4K A;  3CKV A;  4JH6 A;  3CKJ A;  3HUH A;  1MP5 A;  4Y7U A;  4MTR A;  4AAW A;  3ZW5 A;  2VS3 A;  4KPZ A;  1H7Q A;  3IOJ A;  1TSJ A;  4NB2 A;  3JUJ A;  4Y7G A;  4HO0 A;  3U2X A;  4Y64 A;  4B5B A;  4HO8 A;  3U2T A;  3I0C A;  5DRH A;  3N9W A;  5J49 A;  3ECJ A;  3OH1 A;  2D7R A;  2JCJ A;  4JIS A;  4B2W A;  1IIM A;  1H7F A;  2YQC A;  4K6R A;  1FZW A;  1H5T B;  1ZJO A;  5C3A A;  2Q4J A;  3E25 A;  1U6L A;  1G23 A;  2APC A;  3P8A A;  4B3U A;  3IUZ A;  4PAV A;  5C6X A;  5AJP A;  2RJB A;  2ZHP A;  4HO9 A;  1QGQ A;  2A8W A;  1FO8 A;  1MP3 A;  3I0J A;  4ECM A;  1H7G A;  2EI3 A;  2AH9 A;  2ZA0 A;  2O1H A;  5EJZ A;  3B59 A;  1JVG A;  2GGO A;  4Z6Q A;  4GHH A;  1VIC A;  1XZ6 A;  5HCW A;  5FTV A;  2VSI A;  4FQW A;  1H5R A;  3BQX A;  1EYR A;  4X2A A;  3OUL A;  1VPA A;  2VD4 A;  2QH0 A;  1LZ7 A;  1GX4 A;  3W0U A;  3Q7U A;  3V90 A;  2ZU7 A;  1LGT A;  3F1Y A;  4NAN A;  5D7Z A;  2GGQ A;  3V0O A;  3USR A;  4D11 C;  1R81 A;  2WL9 A;  1FR9 A;  4Y6N A;  5L6V A;  4C2S A;  3SXE A;  1BH5 A;  1S4N A;  4CVH A;  4HOC A;  1LL2 A;  2J0A A;  1G95 A;  4CJ8 A;  4EEM A;  4O6N A;  3V0Q A;  4JH5 A;  2FFV A;  3SX5 A;  5C49 A;  5CMF X;  1MH6 A;  1QGS A;  2V0L A;  4DDZ A;  1HAN A;  1I52 A;  3OC9 A;  3EY7 A;  1F9Z A;  1O0R A;  1YP4 A;  1INI A;  4L41 C;  2O1F A;  1VZU A;  3KIA A;  1ZI3 A;  3PKQ A;  3R6A A;  3TQD A;  3OH2 A;  1YP2 A;  4ASJ A;  1VZT A;  1ZJ1 A;  1YRO B;  1XHB A;  2AGD A;  3DK5 A;  2V0H A;  4HO2 A;  4GBP A;  1NKI A;  1R7U A;  1VM8 A;  3HPV A;  4Z6U A;  3JUK A;  3SXC A;  1SQI A;  2P6W A;  1T47 A;  2AE7 A;  2WAW A;  1KW6 B;  2WEE A;  4BMA A;  4ZDQ A;  2RJ7 A;  3NGW A;  1OQM B;  3HDP A;  1ON6 A;  5C36 A;  3SX7 A;  5C68 A;  1R7Y A;  2ZW5 A;  2VXL A;  2AM4 A;  2QQZ A;  3V0P A;  3PNN A;  1FA8 A;  1WVC A;  2RJ4 A;  1SS9 A;  5C4D A;  5JQQ A;  2EI2 A;  5CQP A;  4Z6V A;  4NB1 A;  1H5T A;  1JVD A;  1INJ A;  3GHJ A;  3K8D A;  4KC1 A;  1F1U A;  3ST8 A;  2RK0 A;  3OAM A;  4D0T A;  2R6U A;  2VFZ A;  2I5K A;  2YES A;  1G3L A;  3RMV A;  5C4B A;  1ZDF A;  3OUM A;  1EIR A;  1EIL A;  5CMG X;  4G3P A;  4EEA A;  4GHG A;  3OJJ A;  1H7T A;  5FU0 A;  2X60 A;  1ZSW A;  2XWN A;  4B2X A;  2RJ0 A;  4Y6U A;  2P7M A;  4AYL A;  4ARW A;  2P73 A;  2JCL A;  1GA8 A;  2RJ9 A;  4QB5 A;  1O23 B;  2DPW A;  3ZLK A;  4HCQ A;  1ZCU A;  2W0V A;  1H4E A;  2XWL A;  4FRA A;  1KLL A;  3CKO A;  3Q4S A;  1LQK A;  3LM4 A;  1H7H A;  1WT1 A;  4KNR A;  4M2A A;  2ZW4 A;  2RBB A;  2OI5 A;  2UX8 A;  5FTS A;  4CJB A;  4YS8 A;  1HM0 A;  1O7O A;  1SP8 A;  1U69 A;  4JD0 A;  4DE7 A;  1TW1 A;  1NNR A;  1NKH B;  4LW6 A;  1QIP A;  1QIN A;  3D98 A;  3FWW A;  4JH8 A;  1W77 A;  2Y4K A;  4Y7F A;  4FRQ A;  5DHW A;  4DEC A;  5C4P A;  3CKQ A;  3OGZ A;  1WT0 A;  2IG9 A;  2Y4M A;  1H5S B;  3QVB A;  3SX3 A;  1KNF A;  1QTO A;  3OJK A;  4GHE A;  4KYH A;  1H7E A;  1MC3 A;  3OJT A;  5EC3 A;  2V0I A;  2ZW6 A;  3OPY B;  2VSH A;  4FCU A;  1KW9 B;  4Z6P A;  1VGW A;  3HNQ A;  4EE5 A;  4IRQ A;  1ZCV A;  3SXA A;  1TZF A;  1NIQ B;  3PKX A;  5C38 A;  5CQO A;  1MP4 A;  3O3P A;  2XME A;  1ZDG A;  2XMH A;  2C21 A;  5C4C A;  2E8B A;  2WE9 A;  2Y7A A;  2XWM A;  4Z6W A;  4MND A;  4MTS A;  2FYB A;  3T7M A;  5C48 A;  1KW3 B;  5BWG A;  3I0E A;  2ICY A;  4Z6Z A;  2YQJ A;  1YP3 A;  2IGA A;  4RT5 A;  2PA4 A;  1OMZ A;  4AYJ A;  1IIN A;  1HJJ A;  3SK2 A;  1KND A;  4GHF A;  3SXG A;  4MYM A;  3V0M A;  3FCD A;  5IDS A;  3POL A;  2A8U A;  1ZHJ A;  4HO4 A;  1R7V A;  1LKD A;  3E26 A;  1E5K A;  4FRB A;  5I1F A;  1G8O A;  2RIX A;  4Z6R A;  2QH5 A;  4EEG A;  4JH9 A;  1EWJ A;  4Y7V A;  3SXB A;  1ZJ3 A;  1PZT A;  3RMU A;  3DUV A;  4NAK A;  2PJS A;  4JD1 A;  1F1R A;  1V83 A;  4MTQ A;  4MYB A;  2ZI8 A;  1XY7 A;  3LW6 A;  1GWV A;  1LQP A;  1H7L A;  1TG5 A;  1H5S D;  1Z90 A;  1ZCT A;  1LL0 A;  1GX0 A;  3OKR A;  3L20 A;  4PV5 A;  4GHD A;  4HO3 A;  5C8R A;  2PGY A;  4P00 A;  3U2U A;  2WVM A;  4IR0 A;  3D8V A;  4FRE A;  2P25 A;  1FO9 A;  4D0Z A;  4HC5 A;  4N04 A;  4KYK A;  5FYE A;  1EIQ A;  1MPY A;  5IDT A;  3DJ4 A;  5L6S A;  1KMZ A;  3VB0 A;  5D4F A;  2RJ6 A;  4EEO A;  2ICX A;  2FYD B;  1BYL A;  2ZW7 A;  1LZI A;  4KC4 A;  1H5S A;  2Q48 A;  2VS4 A;  3JTJ A;  1LVW A;  1TW5 A;  2I7R A;  1WSZ A;  2WGZ A;  2RIY A;  1FG5 N;  2A4W A;  1HV9 A;  3OPY A;  2YCM A;  3E5D A;  4KXO A;  2WVL A;  1VGU A;  5D92 A;  3RHE A;  3ZGJ A;  3GUE A;  5C1H A;  2BO4 A;  2Y4L A;  2ZU9 A;  2RJ1 A;  1JYK A;  1JV3 A;  4E1K A;  2OI7 A;  1ZJ2 A;  3V0N A;  4NAL A;  3D5N A;  2D0J A;  3PKW A;  3EY8 A;  1TVY A;  2NXV A;  1ZJP A;  2X65 A;  4O6M A;  5BXC A;  3GM5 A;  1ZI1 A;  1G97 A;  3CKN A;  4P02 A;  3PKP A;  2FYC B;  4KPX A;  5CQL X;  3SXD A;  5CMJ A;  5C4E A;  1GQ9 A;  2P7P A;  1H3M A;  1G93 A;  2RIT A;  3I0K A;  3I0I X;  5FU8 A;  1G0R A;  4JH4 A;  5DFG A;  3R3I A;  2CU2 A;  2A4X A;  1H4D A;  3F1C A;  4HUZ A;  2JCK A;  2Y4J A;  4JH3 A;  1ZI5 A;  4MTT A;  1JIE A;  2P7K A;  4AC3 A; 
#chains in the Genus database with same CATH homology
 3Q80 A;  1O7Q A;  4G87 A;  4Q7C A;  5C3D A;  1FXO A;  5CMI A;  1R7T A;  2ZU8 A;  3V8Z A;  1LZ0 A;  1G1L A;  2FY7 A;  1NWG B;  4B4M A;  1VH3 A;  1GQC A;  3U0X A;  3U2W A;  1W57 A;  4LW3 A;  4FRH A;  1EZI A;  1WT2 A;  1NF5 B;  1S4O A;  4HO6 A;  3CGX A;  1JYL A;  4UEG A;  5AJN A;  2Z86 A;  1FOA A;  4G3S A;  1ZJ0 A;  1K4V A;  3T7N A;  4EE3 A;  2FYA A;  4FRM A;  4HG6 A;  4D48 A;  1WT3 A;  1NQI B;  1VH1 A;  4FRO A;  1S4P A;  2OEF A;  2AEC A;  1NHE B;  4EE4 A;  4G3Q A;  2YC3 A;  4IRP A;  3I0D A;  5C3B A;  4FRL A;  3SPT A;  2O1G A;  3OH4 A;  1QWJ A;  3OH0 A;  4KT7 A;  2WVK A;  1R80 A;  2BO6 A;  4Y63 A;  3T7O A;  5FUH A;  2V0K A;  3U2V A;  5D91 A;  2X5Z A;  2AES A;  4KQL A;  2I7B A;  1KWS A;  2YQS A;  5DDT A;  2Z87 A;  3V8Y A;  2QKX A;  3EE5 A;  1VGT A;  2VS5 A;  1V82 A;  5C1G A;  1LL3 A;  2Y6P A;  5EJ1 A;  1NMM B;  2AM5 A;  2J0B A;  3HL3 A;  3ZF8 A;  5C47 A;  4XWI A;  5EIY A;  5HS2 A;  2RIZ A;  5FV9 A;  4Y9X A;  4J18 A;  1QG8 A;  4HO5 A;  3IOI A;  1H5S C;  1GWW A;  2JCO A;  4D11 A;  2X5S A;  1FGX A;  2RJ5 A;  3V91 A;  2FFU A;  1VZX A;  2RJ8 A;  4KC2 A;  2QGI A;  1G2V A;  2W0W A;  4B4B A;  4NAI A;  2VK9 A;  3I0G A;  1OMX A;  1ZI4 A;  4CJC A;  3RSB A;  1JV1 A;  4FIY A;  3OH3 A;  4Y62 A;  2AM3 A;  4M2B A;  3RMW A;  1R82 A;  4FIX A;  3USQ A;  2PGV A;  1FR8 A;  2BO8 A;  3I0H A;  2P72 A;  3ZGG A;  4FCE A;  4FRD A;  5DDV A;  4BQH A;  4EVW A;  1ON8 A;  3U0Y A;  5CMH A;  1ZCY A;  1FGG A;  2VXM A;  1G9R A;  4M28 A;  1LZJ A;  1R7X A;  3I0F A;  3V0L A;  3CU0 A;  1V84 A;  3R2W A;  2V0J A;  1H5R B;  3BCV A;  2YQH A;  1FRW A;  1ZIZ A;  3TZT A;  2YC5 A;  2OEG A;  4ASY A;  3FOQ A;  1HM9 A;  1HM8 A;  2OI6 A;  4FRP A;  3ZLL A;  5CQM X;  1H4C A;  5AJO A;  1HJL A;  2D7I A;  1FWY A;  2MZB A;  2BO7 A;  4R7P A;  2PX7 A;  1W55 A;  2E3D A;  4KRV A;  4MIX A;  3SX8 A;  5CQN X;  4B4G A;  4B42 A;  3I0L A;  3BRK X;  1VGZ A;  5IFY A;  4KNX A;  1FXJ A;  1PZY B;  5C1L A;  3K8E A;  4Y7T A;  2I5E A;  5C4F A;  3ZGF A;  2C0N A;  3IOH A;  4M4K A;  3CKV A;  3CKJ A;  1MP5 A;  4Y7U A;  4AAW A;  2VS3 A;  4KPZ A;  1H7Q A;  3IOJ A;  3JUJ A;  4Y7G A;  4HO0 A;  3U2X A;  4Y64 A;  4B5B A;  4HO8 A;  3U2T A;  3I0C A;  5J49 A;  3N9W A;  3OH1 A;  2D7R A;  2JCJ A;  4JIS A;  4B2W A;  1IIM A;  1H7F A;  2YQC A;  4K6R A;  1FZW A;  1H5T B;  1ZJO A;  5C3A A;  2Q4J A;  3E25 A;  4B3U A;  2APC A;  1G23 A;  5AJP A;  4HO9 A;  1QGQ A;  2A8W A;  1FO8 A;  1MP3 A;  3I0J A;  4ECM A;  1H7G A;  2AH9 A;  2O1H A;  5EJZ A;  2GGO A;  1JVG A;  1VIC A;  1XZ6 A;  5FTV A;  2VSI A;  4FQW A;  1H5R A;  1EYR A;  1VPA A;  2VD4 A;  1LZ7 A;  3Q7U A;  1GX4 A;  3V90 A;  2ZU7 A;  3F1Y A;  4NAN A;  2GGQ A;  3V0O A;  3USR A;  4D11 C;  1R81 A;  1FR9 A;  4Y6N A;  5L6V A;  4C2S A;  3SXE A;  1S4N A;  4CVH A;  4HOC A;  1LL2 A;  2J0A A;  1G95 A;  4CJ8 A;  4EEM A;  4O6N A;  3V0Q A;  2FFV A;  3SX5 A;  5C49 A;  5CMF X;  1QGS A;  2V0L A;  4DDZ A;  1I52 A;  3OC9 A;  1O0R A;  1YP4 A;  1INI A;  4L41 C;  2O1F A;  1VZU A;  3KIA A;  1ZI3 A;  3PKQ A;  3TQD A;  3OH2 A;  1YP2 A;  4ASJ A;  1VZT A;  1ZJ1 A;  1YRO B;  1XHB A;  2AGD A;  3DK5 A;  2V0H A;  4HO2 A;  4GBP A;  1R7U A;  1VM8 A;  3JUK A;  3SXC A;  2P6W A;  2WEE A;  2AE7 A;  2WAW A;  4BMA A;  4ZDQ A;  2RJ7 A;  3NGW A;  1OQM B;  1ON6 A;  5C36 A;  3SX7 A;  1R7Y A;  2VXL A;  2AM4 A;  3V0P A;  3PNN A;  1WVC A;  2RJ4 A;  1SS9 A;  5C4D A;  5JQQ A;  5CQP A;  1H5T A;  1JVD A;  1INJ A;  3K8D A;  4KC1 A;  3ST8 A;  3OAM A;  4D0T A;  2VFZ A;  2I5K A;  2YES A;  1G3L A;  3RMV A;  5C4B A;  1ZDF A;  5CMG X;  4G3P A;  4EEA A;  1H7T A;  4B2X A;  5FU0 A;  2X60 A;  2XWN A;  2RJ0 A;  4Y6U A;  4AYL A;  4ARW A;  2P73 A;  2JCL A;  1GA8 A;  2RJ9 A;  1O23 B;  2DPW A;  3ZLK A;  4HCQ A;  1ZCU A;  2W0V A;  1H4E A;  2XWL A;  4FRA A;  3CKO A;  3Q4S A;  1H7H A;  1WT1 A;  4KNR A;  4M2A A;  2OI5 A;  2UX8 A;  5FTS A;  4CJB A;  4YS8 A;  1HM0 A;  1O7O A;  4JD0 A;  4DE7 A;  1TW1 A;  4LW6 A;  1NKH B;  3D98 A;  3FWW A;  1W77 A;  2Y4K A;  4Y7F A;  4FRQ A;  4DEC A;  3CKQ A;  3OGZ A;  1WT0 A;  2Y4M A;  1H5S B;  3QVB A;  3SX3 A;  1MC3 A;  1H7E A;  2V0I A;  2VSH A;  4FCU A;  1VGW A;  4EE5 A;  4IRQ A;  1ZCV A;  3SXA A;  1TZF A;  5C38 A;  5CQO A;  1MP4 A;  3O3P A;  2XME A;  1ZDG A;  2XMH A;  5C4C A;  2E8B A;  2WE9 A;  2Y7A A;  2XWM A;  4MND A;  2FYB A;  3T7M A;  5C48 A;  3I0E A;  2ICY A;  2YQJ A;  1YP3 A;  2PA4 A;  1OMZ A;  4AYJ A;  1IIN A;  1HJJ A;  3SXG A;  3V0M A;  5IDS A;  3POL A;  2A8U A;  1ZHJ A;  4HO4 A;  1R7V A;  3E26 A;  1E5K A;  4FRB A;  5I1F A;  1G8O A;  2RIX A;  2QH5 A;  4EEG A;  4Y7V A;  3SXB A;  1ZJ3 A;  1PZT A;  3DUV A;  4NAK A;  4MYB A;  1V83 A;  3LW6 A;  1GWV A;  1H7L A;  1H5S D;  1Z90 A;  1ZCT A;  1LL0 A;  1GX0 A;  3OKR A;  4HO3 A;  5C8R A;  2PGY A;  4P00 A;  3U2U A;  2WVM A;  4FRE A;  3D8V A;  1FO9 A;  4D0Z A;  5FYE A;  5IDT A;  5L6S A;  3DJ4 A;  2RJ6 A;  4EEO A;  2ICX A;  2FYD B;  4KC4 A;  1LZI A;  1H5S A;  2VS4 A;  3JTJ A;  1LVW A;  1TW5 A;  1WSZ A;  2WGZ A;  2RIY A;  1FG5 N;  1HV9 A;  2YCM A;  4KXO A;  2WVL A;  1VGU A;  5D92 A;  3GUE A;  5C1H A;  2BO4 A;  2Y4L A;  2ZU9 A;  2RJ1 A;  1JYK A;  1JV3 A;  4E1K A;  2OI7 A;  1ZJ2 A;  3V0N A;  4NAL A;  3D5N A;  2D0J A;  1TVY A;  2NXV A;  1ZJP A;  2X65 A;  4O6M A;  5BXC A;  1ZI1 A;  1G97 A;  3CKN A;  4P02 A;  3PKP A;  2FYC B;  4KPX A;  5CQL X;  3SXD A;  5CMJ A;  5C4E A;  1GQ9 A;  1H3M A;  1G93 A;  2RIT A;  3I0K A;  3I0I X;  5FU8 A;  1G0R A;  3R3I A;  2CU2 A;  1H4D A;  3F1C A;  2JCK A;  2Y4J A;  1ZI5 A;  4AC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...