1FO9A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
344
structure length
331
Chain Sequence
ELAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 109
structure length 331
sequence length 344
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo9A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo9A01
3DJ4A 2AM3A 2O1HA 2PX7A 1HV9A 2JCOA 1WT3A 4EEMA 1ZDFA 2Z87A 2D7IA 1JVDA 3SXAA 2E3DA 3SX7A 1INIA 3V91A 2WVMA 2DPWA 4HO2A 1ON8A 3I0IX 5CQPA 2JCKA 2D7RA 3I0KA 2FFVA 2FY7A 1INJA 2BO4A 2YQCA 4FRDA 3I0GA 1VGUA 2WAWA 3U2UA 4ASJA 3F1YA 4JISA 4P02A 1FR8A 4EE4A 1VZTA 2RITA 1LL2A 2W0VA 5C8RA 3U2WA 2XMHA 1ZI3A 3N9WA 5CMIA 5FTVA 4Y62A 1ZI1A 4FRBA 2CU2A 4EVWA 1QGQA 3I0LA 5AJNA 2XWMA 3I0CA 2ICYA 5FV9A 2RJ0A 5C38A 1IIMA 4DE7A 4HO0A 4DECA 3U2VA 4KPXA 4B3UA 3CKOA 3QVBA 4GBPA 1H5TA 3E25A 3SX8A 5C1LA 1NQIB 1ZDGA 3IOHA 1H3MA 4LW3A 3SX3A 5J49A 4AC3A 4G3PA 3CKVA 1IINA 4P00A 4EE3A 1FZWA 1H5RB 3I0FA 4HO8A 1PZTA 2I5KA 1H4EA 2AM5A 1NHEB 3I0EA 1HM0A 2WVLA 1O23B 2YQHA 1R81A 1QG8A 1FWYA 1E5KA 5CMGX 3O3PA 1MP5A 4KRVA 1H5SB 3Q80A 3FOQA 3CGXA 4HO3A 4HO5A 5EJZA 3CKJA 3EE5A 5C4CA 1ZCVA 2P73A 3NGWA 2V0KA 3U0YA 5C36A 4FCEA 3RMWA 4KT7A 4FRPA 4B42A 3ZLKA 2XMEA 4EEGA 4IRQA 1LZ7A 1R7XA 3V0OA 2ICXA 3U2XA 1LL3A 4BMAA 1G1LA 1JV3A 4G3SA 5CMFX 3V0PA 3SXBA 2OI7A 4KXOA 3CKNA 3IOJA 4B4MA 4HCQA 1GWVA 3SXEA 3SXGA 1TZFA 4EE5A 2RJ8A 2JCLA 2VSHA 2PA4A 2BO7A 2YQSA 1WT2A 5C3AA 4FRQA 1W55A 2AM4A 1EYRA 3USRA 4KNXA 1FOAA 1O0RA 3OH1A 4Y6UA 1S4PA 1OQMB 2RIXA 4IRPA 3E26A 4DDZA 2FFUA 1NF5B 1VGWA 2RJ4A 1HJJA 4ECMA 1FO8A 2VXLA 2VFZA 3SX5A 5FU0A 5EIYA 2VD4A 4M4KA 5DDVA 4Y7VA 2Z86A 4R7PA 5C1HA 3ZLLA 5L6SA 3BRKX 1PZYB 1ZI5A 1MP4A 3SPTA 3Q4SA 3RSBA 2P6WA 3V0NA 4M28A 4YS8A 3D8VA 2AE7A 1LZ0A 4FQWA 3V0MA 3TZTA 4FCUA 2V0IA 1G0RA 2ZU7A 3POLA 1LL0A 3OKRA 1WSZA 4Y7TA 5CQLX 2NXVA 1K4VA 3ST8A 4Y9XA 4B2WA 3OGZA 1KWSA 4ASYA 2RJ7A 3BCVA 5CQMX 1QGSA 5C4BA 2RIZA 4HO6A 1HM8A 4HG6A 1ZCUA 4Y6NA 5JQQA 4J18A 3DUVA 3OH0A 1WT1A 4FRHA 3HL3A 1H7LA 1SS9A 3FWWA 5C49A 1HM9A 4UEGA 4Y63A 4ZDQA 3PKQA 4HOCA 3PKPA 3U0XA 1H5TB 2UX8A 5AJPA 1V84A 1OMZA 2VS4A 1ZIZA 3KIAA 1JYLA 2RJ5A 3T7MA 2ZU8A 2BO8A 4KPZA 1H4CA 2YQJA 1TVYA 1G95A 4NANA 4KC1A 2X5SA 4M2BA 4CJBA 5C48A 4NALA 3RMVA 3OH2A 2AESA 2I7BA 2RJ9A 1ZCYA 2RJ6A 1XHBA 2V0JA 4D11C 1O7OA 2Y7AA 1FO9A 1VICA 4AAWA 4Y64A 5EJ1A 1JYKA 2YCMA 5IFYA 1H7FA 1G8OA 2PGVA 4NAIA 2WVKA 3CKQA 4MYBA 1H7TA 1G93A 4D48A 4Y7FA 2X5ZA 1G3LA 2I5EA 3JUJA 1FXJA 4D0TA 4ARWA 1ZHJA 3I0JA 4FRMA 2MZBA 1VH3A 4Y7GA 4L41C 2W0WA 1R82A 4D0ZA 1FRWA 2OI5A 1W57A 4B2XA 2V0HA 5IDTA 3T7OA 4CJCA 3V90A 2OEFA 1VGTA 3OH3A 1I52A 1VZUA 3SXDA 2YC3A 4HO4A 5CMJA 5DDTA 1WT0A 3TQDA 3R3IA 2VXMA 2AH9A 1JVGA 2Y4JA 3F1CA 4JD0A 1ZJOA 4KQLA 4CVHA 4Y7UA 1VPAA 1ZJ3A 5FYEA 1NWGB 1H5SC 3OC9A 5AJOA 2RJ1A 5C47A 2FYBA 2WGZA 1FXOA 1ZI4A 1OMXA 5HS2A 5FTSA 1H7QA 2PGYA 1O7QA 2O1GA 1VH1A 5BXCA 4B4BA 3Q7UA 1G97A 5C4FA 3T7NA 1H5SD 2Q4JA 5C1GA 1R7TA 4FROA 2WE9A 3K8DA 4CJ8A 5I1FA 4EEOA 4XWIA 1R80A 1GQ9A 4KC2A 1FGXA 1XZ6A 2QGIA 4D11A 1V83A 2XWNA 3V8ZA 1JV1A 2FYDB 2FYAA 3U2TA 4MNDA 1W77A 3USQA 4G3QA 4NAKA 1VGZA 2X65A 3LW6A 3D98A 1YROB 2O1FA 1MC3A 3SXCA 1H7HA 2X60A 4FRAA 2WEEA 4KC4A 3JTJA 3D5NA 2VS5A 3IOIA 5C4EA 1TW5A 2GGOA 3V8YA 2Y4LA 1GA8A 1ZJ2A 3K8EA 2RIYA 1ZJPA 1FGGA 2Y4MA 3I0DA 1H5RA 1LZIA 1LVWA 2D0JA 4HO9A 1YP4A 1S4NA 1H4DA 3JUKA 4C2SA 3OAMA 1R7UA 1G2VA 1S4OA 1FG5N 3V0QA 4K6RA 5CQOA 1GX0A 2GGQA 1YP3A 1VZXA 2BO6A 3CU0A 3ZF8A 2JCJA 1GQCA 5FU8A 3OH4A 2A8UA 2QKXA 4G87A 4B5BA 1V82A 1G23A 3ZGFA 1H5SA 4AYLA 2ZU9A 1R7YA 2AECA 4FRLA 1ON6A 5CQNX 1VM8A 5C3DA 3GUEA 1TW1A 5C4DA 1EZIA 4LW6A 1NKHB 5FUHA 1Z90A 2AGDA 1LZJA 4FREA 1H7EA 4EEAA 1QWJA 3V0LA 1HJLA 1ZJ1A 2A8WA 2XWLA 3DK5A 1NMMB 1MP3A 1G9RA 3R2WA 2YESA 4AYJA 3I0HA 1H7GA 2P72A 4KNRA 4E1KA 2APCA 1GX4A 5IDSA 1R7VA 2OEGA 2FYCB 2Y6PA 1GWWA 2V0LA 2VS3A 2QH5A 1FR9A 1YP2A 5C3BA 1WVCA 2E8BA 4M2AA 4BQHA 5CMHA 1ZJ0A 2OI6A 2Y4KA 3PNNA 4B4GA 2YC5A 3ZGGA 5L6VA 1ZCTA 2VSIA
chains in the Genus database with same CATH superfamily
3DJ4A 2AM3A 2O1HA 2PX7A 1HV9A 2JCOA 2ZW5A 1WT3A 4EEMA 1SP9A 1ZDFA 2Z87A 3FCDA 2D7IA 1JVDA 1NIQB 1KNDA 1BYLA 3OXHA 5DRHA 2E3DA 3SX7A 3SXAA 3PKWA 1INIA 4RT5A 3V91A 2WVMA 2DPWA 4HO2A 1ON8A 3I0IX 5D91A 5CQPA 3VB0A 2JCKA 2D7RA 3I0KA 2FFVA 2FY7A 1INJA 2BO4A 4GHDA 1KLLA 1LQOA 2YQCA 4FRDA 3I0GA 1VGUA 3PKVA 2WAWA 3U2UA 4O6NA 5EC3A 3F1YA 4ASJA 4NB0A 4JISA 4P02A 1FR8A 4EE4A 4N04A 2RBBA 1VZTA 2RITA 1LL2A 2W0VA 5BWGA 5C8RA 3HUHA 3U2WA 2XMHA 1NPBA 1ZI3A 3N9WA 5CMIA 3OAJA 3P8AA 5FTVA 4Y62A 1ZI1A 4FRBA 5C4PA 2CU2A 4EVWA 1QGQA 1JIFA 2EI2A 2VK9A 3LHOA 3I0LA 5AJNA 2XWMA 2A4WA 3R6AA 3I0CA 2ICYA 5FV9A 2RJ0A 5C38A 1IIMA 3R4QA 4DE7A 4HO0A 4DECA 3U2VA 4GHHA 4KPXA 4B3UA 3CKOA 4LQBA 3QVBA 1U6LA 4GBPA 1H5TA 3ZGJA 3E25A 1KMYA 2P7LA 3SX8A 5C1LA 1NQIB 1ZDGA 3IOHA 1H3MA 4LW3A 3SX3A 5J49A 4AC3A 4G3PA 3CKVA 1IINA 4P00A 4EE3A 1FZWA 1H5RB 3I0FA 4HO8A 1PZTA 2I5KA 1H4EA 2AM5A 1NHEB 3I0EA 1HM0A 2WVLA 2QQZA 1O23B 1T47A 2C21A 3EY8A 2YQHA 1R81A 4Z04A 3KOLA 1QG8A 4Z6SA 1FWYA 1E5KA 5CMGX 3O3PA 1MPYA 1MP5A 3HDPA 4KRVA 1H5SB 3Q80A 1KNFA 3FOQA 1Q0CA 3CGXA 4HO3A 4MTTA 4HO5A 5EJZA 3CKJA 3EE5A 5C4CA 2P25A 1ZCVA 1JC5A 4Z6WA 2P73A 3NGWA 2V0KA 3SK2A 3U0YA 5C36A 4FCEA 2RK0A 3RMWA 4KT7A 2J0AA 4FRPA 4B42A 3ZLKA 2XMEA 4EEGA 4IRQA 1LZ7A 1R7XA 3V0OA 2ICXA 3U2XA 1LL3A 4Z6NA 4BMAA 1G1LA 2ZW6A 1JV3A 4G3SA 5CMFX 3V0PA 3SXBA 2OI7A 4KXOA 3CKNA 3IOJA 5DHWA 2P7KA 4HCQA 3OPYB 3B59A 2C0NA 4B4MA 1GWVA 3SXEA 3SXGA 1TZFA 4EE5A 2RJ8A 2JCLA 4IR0A 2VSHA 2PA4A 3ZW5A 2BO7A 2YQSA 1WT2A 5C3AA 4FRQA 3E5DA 1W55A 5CB9A 2AM4A 1EYRA 4NAZA 4X2AA 3USRA 4KNXA 1FOAA 4GYMA 1O0RA 3OH1A 2WL9A 4Y6UA 1S4PA 1OQMB 2RIXA 4IRPA 3E26A 4HUZA 4DDZA 2FFUA 1NF5B 1VGWA 4OPNA 2RJ4A 1QINA 1HJJA 4ECMA 1FO8A 5C6XA 1F1VA 1Q0OA 3L7TA 1XY7A 2VFZA 2VXLA 3SX5A 5FU0A 5EIYA 2VD4A 4M4KA 5DDVA 3ZI1A 3OJJA 4Y7VA 2Z86A 1SQIA 4R7PA 5C1HA 3ZLLA 5L6SA 3BRKX 1PZYB 1FA8A 1TFZA 1MP4A 1ZI5A 3SPTA 3Q4SA 3RSBA 1SP8A 2ZA0A 2P6WA 3V0NA 1LQPA 5D7ZA 4MTSA 4M28A 1MH6A 4YS8A 3D8VA 2I7RA 2AE7A 1LZ0A 1EILA 4FQWA 3V0MA 4FCUA 3TZTA 1HANA 2V0IA 1G0RA 2ZU7A 3POLA 1LL0A 3OKRA 2J0BA 1WSZA 3PKXA 4Y7TA 5CQLX 2NXVA 1K4VA 3ST8A 4Y9XA 1EIRA 1XQAA 3OGZA 4B2WA 1KWSA 4ASYA 2RJ7A 3BCVA 5CQMX 4NB2A 1QGSA 5C4BA 2RIZA 1FA5A 1HM8A 4HO6A 1ZCUA 4HG6A 4Y6NA 5JQQA 4G6XA 4J18A 5BWHA 3VW9A 3DUVA 3OH0A 1LKDA 4JH1A 1WT1A 4FRHA 1NNRA 3OUMA 3HL3A 1H7LA 1SS9A 4JH2A 3FWWA 5C49A 1HM9A 4UEGA 4Y63A 4ZDQA 3PKQA 4HOCA 3PKPA 3U0XA 1H5TB 4Z6ZA 1KW8B 2UX8A 3G12A 3W0TA 5AJPA 1KMZA 4HC5A 4GHGA 1V84A 1OMZA 2VS4A 1ZIZA 1JIEA 2RK9A 3KIAA 1JYLA 2EI3A 1QTOA 2RJ5A 3T7MA 2ZU8A 2BO8A 4KPZA 1SS4A 1H4CA 1KWBB 4JH3A 5D4FA 1TVYA 2YQJA 1BH5A 1G95A 2P7QA 4NANA 4KC1A 1FA6A 2X5SA 4M2BA 4CJBA 5C48A 4NALA 3RMVA 4GHFA 4Z6UA 3OH2A 2AESA 1F1XA 4Z6MA 1SQDA 2I7BA 2RJ9A 1K4NA 1ZCYA 2RJ6A 1XHBA 2V0JA 4D11C 2ZHPA 1LGTA 1O7OA 2IG9A 2Y7AA 1FO9A 1KW3B 1VICA 3GM5A 4Y64A 4AAWA 5EJ1A 1JYKA 2YCMA 2P7OA 1H7FA 5IFYA 1G8OA 1JC4A 2PGVA 4NAIA 2WVKA 5CTOA 3CKQA 4MYBA 1H7TA 3LM4A 4NAYA 1KWCB 1G93A 4D48A 4Y7FA 3W0UA 2X5ZA 1G3LA 2I5EA 4MTQA 1FXJA 3JUJA 4D0TA 4Q7CA 4ARWA 1ZHJA 3I0JA 4FRMA 1TSJA 2MZBA 1VH3A 4JH6A 4Y7GA 4L41C 2W0WA 1R82A 4D0ZA 1FRWA 2OI5A 1W57A 4B2XA 2V0HA 5IDTA 3T7OA 4CJCA 1F9ZA 1CJXA 2OEFA 1VGTA 3V90A 3OH3A 1I52A 1VZUA 4GHCA 4NVSA 3SXDA 2YC3A 4HO4A 5CMJA 1EIQA 4KYKA 5DDTA 1WT0A 3TQDA 2QNTA 3R3IA 3OPYA 2VXMA 2AH9A 1JVGA 2Y4JA 4PAVA 3F1CA 4JD0A 1ZJOA 4KQLA 4CVHA 2EHZA 4Y7UA 4JH4A 4MTRA 1VPAA 1ZJ3A 4PV5A 5FYEA 2EI0A 1NWGB 1H5SC 3OC9A 5AJOA 2RJ1A 2ZW4A 2IGAA 5C47A 2FYBA 2WGZA 2P7MA 1FXOA 1TWUA 1ZI4A 2ZI8A 5C68A 1OMXA 5HS2A 3ISQA 1DHYA 1H7QA 2PGYA 5FTSA 1O7QA 2O1GA 1VH1A 2QH0A 5BXCA 2PJSA 4Z6RA 4B4BA 2P7PA 3Q7UA 3ECKA 1G97A 5C4FA 3T7NA 1H5SD 2Q4JA 5C1GA 1R7TA 4Z6TA 4FROA 2WE9A 1ZSWA 2R5VA 3K8DA 4JH9A 2Q48A 4CJ8A 2A4XA 5I1FA 4MYMA 4EEOA 4XWIA 1KW6B 3IUZA 1EWJA 1GQ9A 1R80A 4KC2A 1FGXA 1XZ6A 5F6QA 2QGIA 4D11A 1V83A 2XWNA 3V8ZA 1JV1A 2FYDB 2FYAA 3U2TA 4MNDA 1R9CA 1W77A 3USQA 4G3QA 4NAKA 2RJBA 3HPYA 1VGZA 4Z6PA 2X65A 4GHEA 3LW6A 3D98A 5CJ3A 1YROB 2O1FA 1MC3A 3EY7A 3SXCA 1H7HA 2WL3A 2X60A 4FRAA 2WEEA 4QB5A 4Z6OA 4KC4A 3OULA 1XRKA 3JTJA 1LQKA 1FA7A 3D5NA 2VS5A 4FIYA 3IOIA 5C4EA 1TW5A 2GGOA 3V8YA 2Y4LA 3BQXA 1GA8A 1ZJ2A 3K8EA 2RIYA 1ZJPA 1FGGA 2Y4MA 3HQ0A 3I0DA 1H5RA 1LZIA 1LVWA 3OA4A 2ZYQA 2D0JA 4HO9A 3OJNA 1FROA 2R6UA 1YP4A 4O6MA 1S4NA 1H4DA 3BZAA 3JUKA 4C2SA 4Z6LA 3OAMA 1R7UA 3HNQA 1G2VA 1S4OA 1FG5N 1QIPA 3GHJA 4NB1A 4K6RA 5CQOA 3V0QA 4JH7A 1GX0A 1YP3A 2GGQA 1F1RA 1VZXA 2BO6A 4KYHA 3CU0A 2EI1A 3ZF8A 1U69A 2JCJA 4Z6VA 1GQCA 5FU8A 1NKIA 3OH4A 3OJKA 2A8UA 2QKXA 4G87A 4B5BA 4JH8A 3RMUA 1V82A 1G23A 3ZGFA 1H5SA 4AYLA 2ZU9A 1R7YA 2AECA 4FRLA 1ON6A 5CQNX 1VM8A 3CT8A 5C3DA 4Z6QA 2ZW7A 4JH5A 3GUEA 1TW1A 5C4DA 1EZIA 4LW6A 1NKHB 5DFGA 4JD1A 5FUHA 1Z90A 2AGDA 1KW9B 1LZJA 4FREA 1H7EA 4EEAA 3ECJA 1QWJA 3V0LA 5HCWA 1HJLA 1ZJ1A 2A8WA 2XWLA 3DK5A 1TG5A 1NMMB 1MP3A 5KEFA 1G9RA 2YESA 3R2WA 3I0HA 4AYJA 1H7GA 2P72A 4KNRA 4E1KA 2APCA 4FIXA 1GX4A 5IDSA 3RRIA 1R7VA 5D92A 2OEGA 2FYCB 3HPVA 2Y6PA 1GWWA 2V0LA 2VS3A 2QH5A 1FR9A 3RHEA 1YP2A 5C3BA 1ECSA 1WVCA 3OJTA 2E8BA 4M2AA 5CMHA 1ZJ0A 4BQHA 2OI6A 2Y4KA 4IAGA 3L20A 3PNNA 4MIXA 1F1UA 3E0RA 4B4GA 2YC5A 3ZGGA 5L6VA 1ZCTA 2VSIA
chains in the Genus database with same CATH topology
3DJ4A 2AM3A 2O1HA 2PX7A 1HV9A 2JCOA 1WT3A 4EEMA 1ZDFA 2Z87A 2D7IA 1JVDA 3SXAA 2E3DA 3SX7A 1INIA 3V91A 2WVMA 2DPWA 4HO2A 1ON8A 3I0IX 5D91A 5CQPA 2JCKA 2D7RA 3I0KA 2FFVA 2FY7A 1INJA 2BO4A 2YQCA 4FRDA 3I0GA 1VGUA 2WAWA 3U2UA 4O6NA 4ASJA 3F1YA 4JISA 4P02A 1FR8A 4EE4A 1VZTA 2RITA 1LL2A 2W0VA 5C8RA 3U2WA 2XMHA 1ZI3A 3N9WA 5CMIA 5FTVA 4Y62A 1ZI1A 4FRBA 2CU2A 4EVWA 1QGQA 2VK9A 3I0LA 5AJNA 2XWMA 3I0CA 2ICYA 5FV9A 2RJ0A 5C38A 1IIMA 4DE7A 4HO0A 4DECA 3U2VA 4KPXA 4B3UA 3CKOA 3QVBA 4GBPA 1H5TA 3E25A 3SX8A 5C1LA 1NQIB 1ZDGA 3IOHA 1H3MA 4LW3A 3SX3A 5J49A 4AC3A 4G3PA 3CKVA 1IINA 4P00A 4EE3A 1FZWA 1H5RB 3I0FA 4HO8A 1PZTA 2I5KA 1H4EA 2AM5A 1NHEB 3I0EA 1HM0A 2WVLA 1O23B 2YQHA 1R81A 1QG8A 1FWYA 1E5KA 5CMGX 3O3PA 1MP5A 4KRVA 1H5SB 3Q80A 3FOQA 3CGXA 4HO3A 4HO5A 5EJZA 3CKJA 3EE5A 5C4CA 1ZCVA 2P73A 3NGWA 2V0KA 3U0YA 5C36A 4FCEA 3RMWA 4KT7A 2J0AA 4FRPA 4B42A 3ZLKA 2XMEA 4EEGA 4IRQA 1LZ7A 1R7XA 3V0OA 2ICXA 3U2XA 1LL3A 4BMAA 1G1LA 1JV3A 4G3SA 5CMFX 3V0PA 3SXBA 2OI7A 4KXOA 3CKNA 3IOJA 4B4MA 4HCQA 2C0NA 1GWVA 3SXEA 3SXGA 1TZFA 4EE5A 2RJ8A 2JCLA 2VSHA 2PA4A 2BO7A 2YQSA 1WT2A 5C3AA 4FRQA 1W55A 2AM4A 1EYRA 3USRA 4KNXA 1FOAA 1O0RA 3OH1A 4Y6UA 1S4PA 1OQMB 2RIXA 4IRPA 3E26A 4DDZA 2FFUA 1NF5B 1VGWA 2RJ4A 1HJJA 4ECMA 1FO8A 2VXLA 2VFZA 3SX5A 5FU0A 5EIYA 2VD4A 4M4KA 5DDVA 4Y7VA 2Z86A 4R7PA 5C1HA 3ZLLA 5L6SA 3BRKX 1PZYB 1ZI5A 1MP4A 3SPTA 3Q4SA 3RSBA 2P6WA 3V0NA 4M28A 4YS8A 3D8VA 2AE7A 1LZ0A 4FQWA 3V0MA 3TZTA 4FCUA 2V0IA 1G0RA 2ZU7A 3POLA 1LL0A 3OKRA 2J0BA 1WSZA 4Y7TA 5CQLX 2NXVA 1K4VA 3ST8A 4Y9XA 4B2WA 3OGZA 1KWSA 4ASYA 2RJ7A 3BCVA 5CQMX 1QGSA 5C4BA 2RIZA 4HO6A 1HM8A 4HG6A 1ZCUA 4Y6NA 5JQQA 4J18A 3DUVA 3OH0A 1WT1A 4FRHA 3HL3A 1H7LA 1SS9A 3FWWA 5C49A 1HM9A 4UEGA 4Y63A 4ZDQA 3PKQA 4HOCA 3PKPA 3U0XA 1H5TB 2UX8A 5AJPA 1V84A 1OMZA 2VS4A 1ZIZA 3KIAA 1JYLA 2RJ5A 3T7MA 2ZU8A 2BO8A 4KPZA 1H4CA 2YQJA 1TVYA 1G95A 4NANA 4KC1A 2X5SA 4M2BA 4CJBA 5C48A 4NALA 3RMVA 3OH2A 2AESA 2I7BA 2RJ9A 1ZCYA 2RJ6A 1XHBA 2V0JA 4D11C 1O7OA 2Y7AA 1FO9A 1VICA 4AAWA 4Y64A 5EJ1A 1JYKA 2YCMA 5IFYA 1H7FA 1G8OA 2PGVA 4NAIA 2WVKA 3CKQA 4MYBA 1H7TA 1G93A 4D48A 4Y7FA 2X5ZA 1G3LA 2I5EA 3JUJA 1FXJA 4D0TA 4Q7CA 4ARWA 1ZHJA 3I0JA 4FRMA 2MZBA 1VH3A 4Y7GA 4L41C 2W0WA 1R82A 4D0ZA 1FRWA 2OI5A 1W57A 4B2XA 2V0HA 5IDTA 3T7OA 4CJCA 3V90A 2OEFA 1VGTA 3OH3A 1I52A 1VZUA 3SXDA 2YC3A 4HO4A 5CMJA 5DDTA 1WT0A 3TQDA 3R3IA 2VXMA 2AH9A 1JVGA 2Y4JA 3F1CA 4JD0A 1ZJOA 4KQLA 4CVHA 4Y7UA 1VPAA 1ZJ3A 5FYEA 1NWGB 1H5SC 3OC9A 5AJOA 2RJ1A 5C47A 2FYBA 2WGZA 1FXOA 1ZI4A 1OMXA 5HS2A 5FTSA 1H7QA 2PGYA 1O7QA 2O1GA 1VH1A 5BXCA 4B4BA 3Q7UA 1G97A 5C4FA 3T7NA 1H5SD 2Q4JA 5C1GA 1R7TA 4FROA 2WE9A 3K8DA 4CJ8A 5I1FA 4EEOA 4XWIA 1R80A 1GQ9A 4KC2A 1FGXA 1XZ6A 2QGIA 4D11A 1V83A 2XWNA 3V8ZA 1JV1A 2FYDB 2FYAA 3U2TA 4MNDA 1W77A 3USQA 4G3QA 4NAKA 1VGZA 2X65A 3LW6A 3D98A 1YROB 2O1FA 1MC3A 3SXCA 1H7HA 2X60A 4FRAA 2WEEA 4KC4A 3JTJA 3D5NA 2VS5A 4FIYA 3IOIA 5C4EA 1TW5A 2GGOA 3V8YA 2Y4LA 1GA8A 1ZJ2A 3K8EA 2RIYA 1ZJPA 1FGGA 2Y4MA 3I0DA 1H5RA 1LZIA 1LVWA 2D0JA 4HO9A 1YP4A 4O6MA 1S4NA 1H4DA 3JUKA 4C2SA 3OAMA 1R7UA 1G2VA 1S4OA 1FG5N 3V0QA 4K6RA 5CQOA 1GX0A 2GGQA 1YP3A 1VZXA 2BO6A 3CU0A 3ZF8A 2JCJA 1GQCA 5FU8A 3OH4A 2A8UA 2QKXA 4G87A 4B5BA 1V82A 1G23A 3ZGFA 1H5SA 4AYLA 2ZU9A 1R7YA 2AECA 4FRLA 1ON6A 5CQNX 1VM8A 5C3DA 3GUEA 1TW1A 5C4DA 1EZIA 4LW6A 1NKHB 5FUHA 1Z90A 2AGDA 1LZJA 4FREA 1H7EA 4EEAA 1QWJA 3V0LA 1HJLA 1ZJ1A 2A8WA 2XWLA 3DK5A 1NMMB 1MP3A 1G9RA 3R2WA 2YESA 4AYJA 3I0HA 1H7GA 2P72A 4KNRA 4E1KA 2APCA 4FIXA 1GX4A 5IDSA 1R7VA 5D92A 2OEGA 2FYCB 2Y6PA 1GWWA 2V0LA 2VS3A 2QH5A 1FR9A 1YP2A 5C3BA 1WVCA 2E8BA 4M2AA 4BQHA 5CMHA 1ZJ0A 2OI6A 2Y4KA 3PNNA 4MIXA 4B4GA 2YC5A 3ZGGA 5L6VA 1ZCTA 2VSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJ4 A;  2AM3 A;  2O1H A;  2PX7 A;  1HV9 A;  2JCO A;  1WT3 A;  4EEM A;  1ZDF A;  2Z87 A;  2D7I A;  1JVD A;  3SXA A;  2E3D A;  3SX7 A;  1INI A;  3V91 A;  2WVM A;  2DPW A;  4HO2 A;  1ON8 A;  3I0I X;  5CQP A;  2JCK A;  2D7R A;  3I0K A;  2FFV A;  2FY7 A;  1INJ A;  2BO4 A;  2YQC A;  4FRD A;  3I0G A;  1VGU A;  2WAW A;  3U2U A;  4ASJ A;  3F1Y A;  4JIS A;  4P02 A;  1FR8 A;  4EE4 A;  1VZT A;  2RIT A;  1LL2 A;  2W0V A;  5C8R A;  3U2W A;  2XMH A;  1ZI3 A;  3N9W A;  5CMI A;  5FTV A;  4Y62 A;  1ZI1 A;  4FRB A;  2CU2 A;  4EVW A;  1QGQ A;  3I0L A;  5AJN A;  2XWM A;  3I0C A;  2ICY A;  5FV9 A;  2RJ0 A;  5C38 A;  1IIM A;  4DE7 A;  4HO0 A;  4DEC A;  3U2V A;  4KPX A;  4B3U A;  3CKO A;  3QVB A;  4GBP A;  1H5T A;  3E25 A;  3SX8 A;  5C1L A;  1NQI B;  1ZDG A;  3IOH A;  1H3M A;  4LW3 A;  3SX3 A;  5J49 A;  4AC3 A;  4G3P A;  3CKV A;  1IIN A;  4P00 A;  4EE3 A;  1FZW A;  1H5R B;  3I0F A;  4HO8 A;  1PZT A;  2I5K A;  1H4E A;  2AM5 A;  1NHE B;  3I0E A;  1HM0 A;  2WVL A;  1O23 B;  2YQH A;  1R81 A;  1QG8 A;  1FWY A;  1E5K A;  5CMG X;  3O3P A;  1MP5 A;  4KRV A;  1H5S B;  3Q80 A;  3FOQ A;  3CGX A;  4HO3 A;  4HO5 A;  5EJZ A;  3CKJ A;  3EE5 A;  5C4C A;  1ZCV A;  2P73 A;  3NGW A;  2V0K A;  3U0Y A;  5C36 A;  4FCE A;  3RMW A;  4KT7 A;  4FRP A;  4B42 A;  3ZLK A;  2XME A;  4EEG A;  4IRQ A;  1LZ7 A;  1R7X A;  3V0O A;  2ICX A;  3U2X A;  1LL3 A;  4BMA A;  1G1L A;  1JV3 A;  4G3S A;  5CMF X;  3V0P A;  3SXB A;  2OI7 A;  4KXO A;  3CKN A;  3IOJ A;  4B4M A;  4HCQ A;  1GWV A;  3SXE A;  3SXG A;  1TZF A;  4EE5 A;  2RJ8 A;  2JCL A;  2VSH A;  2PA4 A;  2BO7 A;  2YQS A;  1WT2 A;  5C3A A;  4FRQ A;  1W55 A;  2AM4 A;  1EYR A;  3USR A;  4KNX A;  1FOA A;  1O0R A;  3OH1 A;  4Y6U A;  1S4P A;  1OQM B;  2RIX A;  4IRP A;  3E26 A;  4DDZ A;  2FFU A;  1NF5 B;  1VGW A;  2RJ4 A;  1HJJ A;  4ECM A;  1FO8 A;  2VXL A;  2VFZ A;  3SX5 A;  5FU0 A;  5EIY A;  2VD4 A;  4M4K A;  5DDV A;  4Y7V A;  2Z86 A;  4R7P A;  5C1H A;  3ZLL A;  5L6S A;  3BRK X;  1PZY B;  1ZI5 A;  1MP4 A;  3SPT A;  3Q4S A;  3RSB A;  2P6W A;  3V0N A;  4M28 A;  4YS8 A;  3D8V A;  2AE7 A;  1LZ0 A;  4FQW A;  3V0M A;  3TZT A;  4FCU A;  2V0I A;  1G0R A;  2ZU7 A;  3POL A;  1LL0 A;  3OKR A;  1WSZ A;  4Y7T A;  5CQL X;  2NXV A;  1K4V A;  3ST8 A;  4Y9X A;  4B2W A;  3OGZ A;  1KWS A;  4ASY A;  2RJ7 A;  3BCV A;  5CQM X;  1QGS A;  5C4B A;  2RIZ A;  4HO6 A;  1HM8 A;  4HG6 A;  1ZCU A;  4Y6N A;  5JQQ A;  4J18 A;  3DUV A;  3OH0 A;  1WT1 A;  4FRH A;  3HL3 A;  1H7L A;  1SS9 A;  3FWW A;  5C49 A;  1HM9 A;  4UEG A;  4Y63 A;  4ZDQ A;  3PKQ A;  4HOC A;  3PKP A;  3U0X A;  1H5T B;  2UX8 A;  5AJP A;  1V84 A;  1OMZ A;  2VS4 A;  1ZIZ A;  3KIA A;  1JYL A;  2RJ5 A;  3T7M A;  2ZU8 A;  2BO8 A;  4KPZ A;  1H4C A;  2YQJ A;  1TVY A;  1G95 A;  4NAN A;  4KC1 A;  2X5S A;  4M2B A;  4CJB A;  5C48 A;  4NAL A;  3RMV A;  3OH2 A;  2AES A;  2I7B A;  2RJ9 A;  1ZCY A;  2RJ6 A;  1XHB A;  2V0J A;  4D11 C;  1O7O A;  2Y7A A;  1FO9 A;  1VIC A;  4AAW A;  4Y64 A;  5EJ1 A;  1JYK A;  2YCM A;  5IFY A;  1H7F A;  1G8O A;  2PGV A;  4NAI A;  2WVK A;  3CKQ A;  4MYB A;  1H7T A;  1G93 A;  4D48 A;  4Y7F A;  2X5Z A;  1G3L A;  2I5E A;  3JUJ A;  1FXJ A;  4D0T A;  4ARW A;  1ZHJ A;  3I0J A;  4FRM A;  2MZB A;  1VH3 A;  4Y7G A;  4L41 C;  2W0W A;  1R82 A;  4D0Z A;  1FRW A;  2OI5 A;  1W57 A;  4B2X A;  2V0H A;  5IDT A;  3T7O A;  4CJC A;  3V90 A;  2OEF A;  1VGT A;  3OH3 A;  1I52 A;  1VZU A;  3SXD A;  2YC3 A;  4HO4 A;  5CMJ A;  5DDT A;  1WT0 A;  3TQD A;  3R3I A;  2VXM A;  2AH9 A;  1JVG A;  2Y4J A;  3F1C A;  4JD0 A;  1ZJO A;  4KQL A;  4CVH A;  4Y7U A;  1VPA A;  1ZJ3 A;  5FYE A;  1NWG B;  1H5S C;  3OC9 A;  5AJO A;  2RJ1 A;  5C47 A;  2FYB A;  2WGZ A;  1FXO A;  1ZI4 A;  1OMX A;  5HS2 A;  5FTS A;  1H7Q A;  2PGY A;  1O7Q A;  2O1G A;  1VH1 A;  5BXC A;  4B4B A;  3Q7U A;  1G97 A;  5C4F A;  3T7N A;  1H5S D;  2Q4J A;  5C1G A;  1R7T A;  4FRO A;  2WE9 A;  3K8D A;  4CJ8 A;  5I1F A;  4EEO A;  4XWI A;  1R80 A;  1GQ9 A;  4KC2 A;  1FGX A;  1XZ6 A;  2QGI A;  4D11 A;  1V83 A;  2XWN A;  3V8Z A;  1JV1 A;  2FYD B;  2FYA A;  3U2T A;  4MND A;  1W77 A;  3USQ A;  4G3Q A;  4NAK A;  1VGZ A;  2X65 A;  3LW6 A;  3D98 A;  1YRO B;  2O1F A;  1MC3 A;  3SXC A;  1H7H A;  2X60 A;  4FRA A;  2WEE A;  4KC4 A;  3JTJ A;  3D5N A;  2VS5 A;  3IOI A;  5C4E A;  1TW5 A;  2GGO A;  3V8Y A;  2Y4L A;  1GA8 A;  1ZJ2 A;  3K8E A;  2RIY A;  1ZJP A;  1FGG A;  2Y4M A;  3I0D A;  1H5R A;  1LZI A;  1LVW A;  2D0J A;  4HO9 A;  1YP4 A;  1S4N A;  1H4D A;  3JUK A;  4C2S A;  3OAM A;  1R7U A;  1G2V A;  1S4O A;  1FG5 N;  3V0Q A;  4K6R A;  5CQO A;  1GX0 A;  2GGQ A;  1YP3 A;  1VZX A;  2BO6 A;  3CU0 A;  3ZF8 A;  2JCJ A;  1GQC A;  5FU8 A;  3OH4 A;  2A8U A;  2QKX A;  4G87 A;  4B5B A;  1V82 A;  1G23 A;  3ZGF A;  1H5S A;  4AYL A;  2ZU9 A;  1R7Y A;  2AEC A;  4FRL A;  1ON6 A;  5CQN X;  1VM8 A;  5C3D A;  3GUE A;  1TW1 A;  5C4D A;  1EZI A;  4LW6 A;  1NKH B;  5FUH A;  1Z90 A;  2AGD A;  1LZJ A;  4FRE A;  1H7E A;  4EEA A;  1QWJ A;  3V0L A;  1HJL A;  1ZJ1 A;  2A8W A;  2XWL A;  3DK5 A;  1NMM B;  1MP3 A;  1G9R A;  3R2W A;  2YES A;  4AYJ A;  3I0H A;  1H7G A;  2P72 A;  4KNR A;  4E1K A;  2APC A;  1GX4 A;  5IDS A;  1R7V A;  2OEG A;  2FYC B;  2Y6P A;  1GWW A;  2V0L A;  2VS3 A;  2QH5 A;  1FR9 A;  1YP2 A;  5C3B A;  1WVC A;  2E8B A;  4M2A A;  4BQH A;  5CMH A;  1ZJ0 A;  2OI6 A;  2Y4K A;  3PNN A;  4B4G A;  2YC5 A;  3ZGG A;  5L6V A;  1ZCT A;  2VSI A; 
#chains in the Genus database with same CATH topology
 3DJ4 A;  2AM3 A;  2O1H A;  2PX7 A;  1HV9 A;  2JCO A;  2ZW5 A;  1WT3 A;  4EEM A;  1SP9 A;  1ZDF A;  2Z87 A;  3FCD A;  2D7I A;  1JVD A;  1NIQ B;  1KND A;  1BYL A;  3OXH A;  5DRH A;  2E3D A;  3SX7 A;  3SXA A;  3PKW A;  1INI A;  4RT5 A;  3V91 A;  2WVM A;  2DPW A;  4HO2 A;  1ON8 A;  3I0I X;  5D91 A;  5CQP A;  3VB0 A;  2JCK A;  2D7R A;  3I0K A;  2FFV A;  2FY7 A;  1INJ A;  2BO4 A;  4GHD A;  1KLL A;  1LQO A;  2YQC A;  4FRD A;  3I0G A;  1VGU A;  3PKV A;  2WAW A;  3U2U A;  4O6N A;  5EC3 A;  3F1Y A;  4ASJ A;  4NB0 A;  4JIS A;  4P02 A;  1FR8 A;  4EE4 A;  4N04 A;  2RBB A;  1VZT A;  2RIT A;  1LL2 A;  2W0V A;  5BWG A;  5C8R A;  3HUH A;  3U2W A;  2XMH A;  1NPB A;  1ZI3 A;  3N9W A;  5CMI A;  3OAJ A;  3P8A A;  5FTV A;  4Y62 A;  1ZI1 A;  4FRB A;  5C4P A;  2CU2 A;  4EVW A;  1QGQ A;  1JIF A;  2EI2 A;  2VK9 A;  3LHO A;  3I0L A;  5AJN A;  2XWM A;  2A4W A;  3R6A A;  3I0C A;  2ICY A;  5FV9 A;  2RJ0 A;  5C38 A;  1IIM A;  3R4Q A;  4DE7 A;  4HO0 A;  4DEC A;  3U2V A;  4GHH A;  4KPX A;  4B3U A;  3CKO A;  4LQB A;  3QVB A;  1U6L A;  4GBP A;  1H5T A;  3ZGJ A;  3E25 A;  1KMY A;  2P7L A;  3SX8 A;  5C1L A;  1NQI B;  1ZDG A;  3IOH A;  1H3M A;  4LW3 A;  3SX3 A;  5J49 A;  4AC3 A;  4G3P A;  3CKV A;  1IIN A;  4P00 A;  4EE3 A;  1FZW A;  1H5R B;  3I0F A;  4HO8 A;  1PZT A;  2I5K A;  1H4E A;  2AM5 A;  1NHE B;  3I0E A;  1HM0 A;  2WVL A;  2QQZ A;  1O23 B;  1T47 A;  2C21 A;  3EY8 A;  2YQH A;  1R81 A;  4Z04 A;  3KOL A;  1QG8 A;  4Z6S A;  1FWY A;  1E5K A;  5CMG X;  3O3P A;  1MPY A;  1MP5 A;  3HDP A;  4KRV A;  1H5S B;  3Q80 A;  1KNF A;  3FOQ A;  1Q0C A;  3CGX A;  4HO3 A;  4MTT A;  4HO5 A;  5EJZ A;  3CKJ A;  3EE5 A;  5C4C A;  2P25 A;  1ZCV A;  1JC5 A;  4Z6W A;  2P73 A;  3NGW A;  2V0K A;  3SK2 A;  3U0Y A;  5C36 A;  4FCE A;  2RK0 A;  3RMW A;  4KT7 A;  2J0A A;  4FRP A;  4B42 A;  3ZLK A;  2XME A;  4EEG A;  4IRQ A;  1LZ7 A;  1R7X A;  3V0O A;  2ICX A;  3U2X A;  1LL3 A;  4Z6N A;  4BMA A;  1G1L A;  2ZW6 A;  1JV3 A;  4G3S A;  5CMF X;  3V0P A;  3SXB A;  2OI7 A;  4KXO A;  3CKN A;  3IOJ A;  5DHW A;  2P7K A;  4HCQ A;  3OPY B;  3B59 A;  2C0N A;  4B4M A;  1GWV A;  3SXE A;  3SXG A;  1TZF A;  4EE5 A;  2RJ8 A;  2JCL A;  4IR0 A;  2VSH A;  2PA4 A;  3ZW5 A;  2BO7 A;  2YQS A;  1WT2 A;  5C3A A;  4FRQ A;  3E5D A;  1W55 A;  5CB9 A;  2AM4 A;  1EYR A;  4NAZ A;  4X2A A;  3USR A;  4KNX A;  1FOA A;  4GYM A;  1O0R A;  3OH1 A;  2WL9 A;  4Y6U A;  1S4P A;  1OQM B;  2RIX A;  4IRP A;  3E26 A;  4HUZ A;  4DDZ A;  2FFU A;  1NF5 B;  1VGW A;  4OPN A;  2RJ4 A;  1QIN A;  1HJJ A;  4ECM A;  1FO8 A;  5C6X A;  1F1V A;  1Q0O A;  3L7T A;  1XY7 A;  2VFZ A;  2VXL A;  3SX5 A;  5FU0 A;  5EIY A;  2VD4 A;  4M4K A;  5DDV A;  3ZI1 A;  3OJJ A;  4Y7V A;  2Z86 A;  1SQI A;  4R7P A;  5C1H A;  3ZLL A;  5L6S A;  3BRK X;  1PZY B;  1FA8 A;  1TFZ A;  1MP4 A;  1ZI5 A;  3SPT A;  3Q4S A;  3RSB A;  1SP8 A;  2ZA0 A;  2P6W A;  3V0N A;  1LQP A;  5D7Z A;  4MTS A;  4M28 A;  1MH6 A;  4YS8 A;  3D8V A;  2I7R A;  2AE7 A;  1LZ0 A;  1EIL A;  4FQW A;  3V0M A;  4FCU A;  3TZT A;  1HAN A;  2V0I A;  1G0R A;  2ZU7 A;  3POL A;  1LL0 A;  3OKR A;  2J0B A;  1WSZ A;  3PKX A;  4Y7T A;  5CQL X;  2NXV A;  1K4V A;  3ST8 A;  4Y9X A;  1EIR A;  1XQA A;  3OGZ A;  4B2W A;  1KWS A;  4ASY A;  2RJ7 A;  3BCV A;  5CQM X;  4NB2 A;  1QGS A;  5C4B A;  2RIZ A;  1FA5 A;  1HM8 A;  4HO6 A;  1ZCU A;  4HG6 A;  4Y6N A;  5JQQ A;  4G6X A;  4J18 A;  5BWH A;  3VW9 A;  3DUV A;  3OH0 A;  1LKD A;  4JH1 A;  1WT1 A;  4FRH A;  1NNR A;  3OUM A;  3HL3 A;  1H7L A;  1SS9 A;  4JH2 A;  3FWW A;  5C49 A;  1HM9 A;  4UEG A;  4Y63 A;  4ZDQ A;  3PKQ A;  4HOC A;  3PKP A;  3U0X A;  1H5T B;  4Z6Z A;  1KW8 B;  2UX8 A;  3G12 A;  3W0T A;  5AJP A;  1KMZ A;  4HC5 A;  4GHG A;  1V84 A;  1OMZ A;  2VS4 A;  1ZIZ A;  1JIE A;  2RK9 A;  3KIA A;  1JYL A;  2EI3 A;  1QTO A;  2RJ5 A;  3T7M A;  2ZU8 A;  2BO8 A;  4KPZ A;  1SS4 A;  1H4C A;  1KWB B;  4JH3 A;  5D4F A;  1TVY A;  2YQJ A;  1BH5 A;  1G95 A;  2P7Q A;  4NAN A;  4KC1 A;  1FA6 A;  2X5S A;  4M2B A;  4CJB A;  5C48 A;  4NAL A;  3RMV A;  4GHF A;  4Z6U A;  3OH2 A;  2AES A;  1F1X A;  4Z6M A;  1SQD A;  2I7B A;  2RJ9 A;  1K4N A;  1ZCY A;  2RJ6 A;  1XHB A;  2V0J A;  4D11 C;  2ZHP A;  1LGT A;  1O7O A;  2IG9 A;  2Y7A A;  1FO9 A;  1KW3 B;  1VIC A;  3GM5 A;  4Y64 A;  4AAW A;  5EJ1 A;  1JYK A;  2YCM A;  2P7O A;  1H7F A;  5IFY A;  1G8O A;  1JC4 A;  2PGV A;  4NAI A;  2WVK A;  5CTO A;  3CKQ A;  4MYB A;  1H7T A;  3LM4 A;  4NAY A;  1KWC B;  1G93 A;  4D48 A;  4Y7F A;  3W0U A;  2X5Z A;  1G3L A;  2I5E A;  4MTQ A;  1FXJ A;  3JUJ A;  4D0T A;  4Q7C A;  4ARW A;  1ZHJ A;  3I0J A;  4FRM A;  1TSJ A;  2MZB A;  1VH3 A;  4JH6 A;  4Y7G A;  4L41 C;  2W0W A;  1R82 A;  4D0Z A;  1FRW A;  2OI5 A;  1W57 A;  4B2X A;  2V0H A;  5IDT A;  3T7O A;  4CJC A;  1F9Z A;  1CJX A;  2OEF A;  1VGT A;  3V90 A;  3OH3 A;  1I52 A;  1VZU A;  4GHC A;  4NVS A;  3SXD A;  2YC3 A;  4HO4 A;  5CMJ A;  1EIQ A;  4KYK A;  5DDT A;  1WT0 A;  3TQD A;  2QNT A;  3R3I A;  3OPY A;  2VXM A;  2AH9 A;  1JVG A;  2Y4J A;  4PAV A;  3F1C A;  4JD0 A;  1ZJO A;  4KQL A;  4CVH A;  2EHZ A;  4Y7U A;  4JH4 A;  4MTR A;  1VPA A;  1ZJ3 A;  4PV5 A;  5FYE A;  2EI0 A;  1NWG B;  1H5S C;  3OC9 A;  5AJO A;  2RJ1 A;  2ZW4 A;  2IGA A;  5C47 A;  2FYB A;  2WGZ A;  2P7M A;  1FXO A;  1TWU A;  1ZI4 A;  2ZI8 A;  5C68 A;  1OMX A;  5HS2 A;  3ISQ A;  1DHY A;  1H7Q A;  2PGY A;  5FTS A;  1O7Q A;  2O1G A;  1VH1 A;  2QH0 A;  5BXC A;  2PJS A;  4Z6R A;  4B4B A;  2P7P A;  3Q7U A;  3ECK A;  1G97 A;  5C4F A;  3T7N A;  1H5S D;  2Q4J A;  5C1G A;  1R7T A;  4Z6T A;  4FRO A;  2WE9 A;  1ZSW A;  2R5V A;  3K8D A;  4JH9 A;  2Q48 A;  4CJ8 A;  2A4X A;  5I1F A;  4MYM A;  4EEO A;  4XWI A;  1KW6 B;  3IUZ A;  1EWJ A;  1GQ9 A;  1R80 A;  4KC2 A;  1FGX A;  1XZ6 A;  5F6Q A;  2QGI A;  4D11 A;  1V83 A;  2XWN A;  3V8Z A;  1JV1 A;  2FYD B;  2FYA A;  3U2T A;  4MND A;  1R9C A;  1W77 A;  3USQ A;  4G3Q A;  4NAK A;  2RJB A;  3HPY A;  1VGZ A;  4Z6P A;  2X65 A;  4GHE A;  3LW6 A;  3D98 A;  5CJ3 A;  1YRO B;  2O1F A;  1MC3 A;  3EY7 A;  3SXC A;  1H7H A;  2WL3 A;  2X60 A;  4FRA A;  2WEE A;  4QB5 A;  4Z6O A;  4KC4 A;  3OUL A;  1XRK A;  3JTJ A;  1LQK A;  1FA7 A;  3D5N A;  2VS5 A;  4FIY A;  3IOI A;  5C4E A;  1TW5 A;  2GGO A;  3V8Y A;  2Y4L A;  3BQX A;  1GA8 A;  1ZJ2 A;  3K8E A;  2RIY A;  1ZJP A;  1FGG A;  2Y4M A;  3HQ0 A;  3I0D A;  1H5R A;  1LZI A;  1LVW A;  3OA4 A;  2ZYQ A;  2D0J A;  4HO9 A;  3OJN A;  1FRO A;  2R6U A;  1YP4 A;  4O6M A;  1S4N A;  1H4D A;  3BZA A;  3JUK A;  4C2S A;  4Z6L A;  3OAM A;  1R7U A;  3HNQ A;  1G2V A;  1S4O A;  1FG5 N;  1QIP A;  3GHJ A;  4NB1 A;  4K6R A;  5CQO A;  3V0Q A;  4JH7 A;  1GX0 A;  1YP3 A;  2GGQ A;  1F1R A;  1VZX A;  2BO6 A;  4KYH A;  3CU0 A;  2EI1 A;  3ZF8 A;  1U69 A;  2JCJ A;  4Z6V A;  1GQC A;  5FU8 A;  1NKI A;  3OH4 A;  3OJK A;  2A8U A;  2QKX A;  4G87 A;  4B5B A;  4JH8 A;  3RMU A;  1V82 A;  1G23 A;  3ZGF A;  1H5S A;  4AYL A;  2ZU9 A;  1R7Y A;  2AEC A;  4FRL A;  1ON6 A;  5CQN X;  1VM8 A;  3CT8 A;  5C3D A;  4Z6Q A;  2ZW7 A;  4JH5 A;  3GUE A;  1TW1 A;  5C4D A;  1EZI A;  4LW6 A;  1NKH B;  5DFG A;  4JD1 A;  5FUH A;  1Z90 A;  2AGD A;  1KW9 B;  1LZJ A;  4FRE A;  1H7E A;  4EEA A;  3ECJ A;  1QWJ A;  3V0L A;  5HCW A;  1HJL A;  1ZJ1 A;  2A8W A;  2XWL A;  3DK5 A;  1TG5 A;  1NMM B;  1MP3 A;  5KEF A;  1G9R A;  2YES A;  3R2W A;  3I0H A;  4AYJ A;  1H7G A;  2P72 A;  4KNR A;  4E1K A;  2APC A;  4FIX A;  1GX4 A;  5IDS A;  3RRI A;  1R7V A;  5D92 A;  2OEG A;  2FYC B;  3HPV A;  2Y6P A;  1GWW A;  2V0L A;  2VS3 A;  2QH5 A;  1FR9 A;  3RHE A;  1YP2 A;  5C3B A;  1ECS A;  1WVC A;  3OJT A;  2E8B A;  4M2A A;  5CMH A;  1ZJ0 A;  4BQH A;  2OI6 A;  2Y4K A;  4IAG A;  3L20 A;  3PNN A;  4MIX A;  1F1U A;  3E0R A;  4B4G A;  2YC5 A;  3ZGG A;  5L6V A;  1ZCT A;  2VSI A; 
#chains in the Genus database with same CATH homology
 3DJ4 A;  2AM3 A;  2O1H A;  2PX7 A;  1HV9 A;  2JCO A;  1WT3 A;  4EEM A;  1ZDF A;  2Z87 A;  2D7I A;  1JVD A;  3SXA A;  2E3D A;  3SX7 A;  1INI A;  3V91 A;  2WVM A;  2DPW A;  4HO2 A;  1ON8 A;  3I0I X;  5D91 A;  5CQP A;  2JCK A;  2D7R A;  3I0K A;  2FFV A;  2FY7 A;  1INJ A;  2BO4 A;  2YQC A;  4FRD A;  3I0G A;  1VGU A;  2WAW A;  3U2U A;  4O6N A;  4ASJ A;  3F1Y A;  4JIS A;  4P02 A;  1FR8 A;  4EE4 A;  1VZT A;  2RIT A;  1LL2 A;  2W0V A;  5C8R A;  3U2W A;  2XMH A;  1ZI3 A;  3N9W A;  5CMI A;  5FTV A;  4Y62 A;  1ZI1 A;  4FRB A;  2CU2 A;  4EVW A;  1QGQ A;  2VK9 A;  3I0L A;  5AJN A;  2XWM A;  3I0C A;  2ICY A;  5FV9 A;  2RJ0 A;  5C38 A;  1IIM A;  4DE7 A;  4HO0 A;  4DEC A;  3U2V A;  4KPX A;  4B3U A;  3CKO A;  3QVB A;  4GBP A;  1H5T A;  3E25 A;  3SX8 A;  5C1L A;  1NQI B;  1ZDG A;  3IOH A;  1H3M A;  4LW3 A;  3SX3 A;  5J49 A;  4AC3 A;  4G3P A;  3CKV A;  1IIN A;  4P00 A;  4EE3 A;  1FZW A;  1H5R B;  3I0F A;  4HO8 A;  1PZT A;  2I5K A;  1H4E A;  2AM5 A;  1NHE B;  3I0E A;  1HM0 A;  2WVL A;  1O23 B;  2YQH A;  1R81 A;  1QG8 A;  1FWY A;  1E5K A;  5CMG X;  3O3P A;  1MP5 A;  4KRV A;  1H5S B;  3Q80 A;  3FOQ A;  3CGX A;  4HO3 A;  4HO5 A;  5EJZ A;  3CKJ A;  3EE5 A;  5C4C A;  1ZCV A;  2P73 A;  3NGW A;  2V0K A;  3U0Y A;  5C36 A;  4FCE A;  3RMW A;  4KT7 A;  2J0A A;  4FRP A;  4B42 A;  3ZLK A;  2XME A;  4EEG A;  4IRQ A;  1LZ7 A;  1R7X A;  3V0O A;  2ICX A;  3U2X A;  1LL3 A;  4BMA A;  1G1L A;  1JV3 A;  4G3S A;  5CMF X;  3V0P A;  3SXB A;  2OI7 A;  4KXO A;  3CKN A;  3IOJ A;  4B4M A;  4HCQ A;  2C0N A;  1GWV A;  3SXE A;  3SXG A;  1TZF A;  4EE5 A;  2RJ8 A;  2JCL A;  2VSH A;  2PA4 A;  2BO7 A;  2YQS A;  1WT2 A;  5C3A A;  4FRQ A;  1W55 A;  2AM4 A;  1EYR A;  3USR A;  4KNX A;  1FOA A;  1O0R A;  3OH1 A;  4Y6U A;  1S4P A;  1OQM B;  2RIX A;  4IRP A;  3E26 A;  4DDZ A;  2FFU A;  1NF5 B;  1VGW A;  2RJ4 A;  1HJJ A;  4ECM A;  1FO8 A;  2VXL A;  2VFZ A;  3SX5 A;  5FU0 A;  5EIY A;  2VD4 A;  4M4K A;  5DDV A;  4Y7V A;  2Z86 A;  4R7P A;  5C1H A;  3ZLL A;  5L6S A;  3BRK X;  1PZY B;  1ZI5 A;  1MP4 A;  3SPT A;  3Q4S A;  3RSB A;  2P6W A;  3V0N A;  4M28 A;  4YS8 A;  3D8V A;  2AE7 A;  1LZ0 A;  4FQW A;  3V0M A;  3TZT A;  4FCU A;  2V0I A;  1G0R A;  2ZU7 A;  3POL A;  1LL0 A;  3OKR A;  2J0B A;  1WSZ A;  4Y7T A;  5CQL X;  2NXV A;  1K4V A;  3ST8 A;  4Y9X A;  4B2W A;  3OGZ A;  1KWS A;  4ASY A;  2RJ7 A;  3BCV A;  5CQM X;  1QGS A;  5C4B A;  2RIZ A;  4HO6 A;  1HM8 A;  4HG6 A;  1ZCU A;  4Y6N A;  5JQQ A;  4J18 A;  3DUV A;  3OH0 A;  1WT1 A;  4FRH A;  3HL3 A;  1H7L A;  1SS9 A;  3FWW A;  5C49 A;  1HM9 A;  4UEG A;  4Y63 A;  4ZDQ A;  3PKQ A;  4HOC A;  3PKP A;  3U0X A;  1H5T B;  2UX8 A;  5AJP A;  1V84 A;  1OMZ A;  2VS4 A;  1ZIZ A;  3KIA A;  1JYL A;  2RJ5 A;  3T7M A;  2ZU8 A;  2BO8 A;  4KPZ A;  1H4C A;  2YQJ A;  1TVY A;  1G95 A;  4NAN A;  4KC1 A;  2X5S A;  4M2B A;  4CJB A;  5C48 A;  4NAL A;  3RMV A;  3OH2 A;  2AES A;  2I7B A;  2RJ9 A;  1ZCY A;  2RJ6 A;  1XHB A;  2V0J A;  4D11 C;  1O7O A;  2Y7A A;  1FO9 A;  1VIC A;  4AAW A;  4Y64 A;  5EJ1 A;  1JYK A;  2YCM A;  5IFY A;  1H7F A;  1G8O A;  2PGV A;  4NAI A;  2WVK A;  3CKQ A;  4MYB A;  1H7T A;  1G93 A;  4D48 A;  4Y7F A;  2X5Z A;  1G3L A;  2I5E A;  3JUJ A;  1FXJ A;  4D0T A;  4Q7C A;  4ARW A;  1ZHJ A;  3I0J A;  4FRM A;  2MZB A;  1VH3 A;  4Y7G A;  4L41 C;  2W0W A;  1R82 A;  4D0Z A;  1FRW A;  2OI5 A;  1W57 A;  4B2X A;  2V0H A;  5IDT A;  3T7O A;  4CJC A;  3V90 A;  2OEF A;  1VGT A;  3OH3 A;  1I52 A;  1VZU A;  3SXD A;  2YC3 A;  4HO4 A;  5CMJ A;  5DDT A;  1WT0 A;  3TQD A;  3R3I A;  2VXM A;  2AH9 A;  1JVG A;  2Y4J A;  3F1C A;  4JD0 A;  1ZJO A;  4KQL A;  4CVH A;  4Y7U A;  1VPA A;  1ZJ3 A;  5FYE A;  1NWG B;  1H5S C;  3OC9 A;  5AJO A;  2RJ1 A;  5C47 A;  2FYB A;  2WGZ A;  1FXO A;  1ZI4 A;  1OMX A;  5HS2 A;  5FTS A;  1H7Q A;  2PGY A;  1O7Q A;  2O1G A;  1VH1 A;  5BXC A;  4B4B A;  3Q7U A;  1G97 A;  5C4F A;  3T7N A;  1H5S D;  2Q4J A;  5C1G A;  1R7T A;  4FRO A;  2WE9 A;  3K8D A;  4CJ8 A;  5I1F A;  4EEO A;  4XWI A;  1R80 A;  1GQ9 A;  4KC2 A;  1FGX A;  1XZ6 A;  2QGI A;  4D11 A;  1V83 A;  2XWN A;  3V8Z A;  1JV1 A;  2FYD B;  2FYA A;  3U2T A;  4MND A;  1W77 A;  3USQ A;  4G3Q A;  4NAK A;  1VGZ A;  2X65 A;  3LW6 A;  3D98 A;  1YRO B;  2O1F A;  1MC3 A;  3SXC A;  1H7H A;  2X60 A;  4FRA A;  2WEE A;  4KC4 A;  3JTJ A;  3D5N A;  2VS5 A;  4FIY A;  3IOI A;  5C4E A;  1TW5 A;  2GGO A;  3V8Y A;  2Y4L A;  1GA8 A;  1ZJ2 A;  3K8E A;  2RIY A;  1ZJP A;  1FGG A;  2Y4M A;  3I0D A;  1H5R A;  1LZI A;  1LVW A;  2D0J A;  4HO9 A;  1YP4 A;  4O6M A;  1S4N A;  1H4D A;  3JUK A;  4C2S A;  3OAM A;  1R7U A;  1G2V A;  1S4O A;  1FG5 N;  3V0Q A;  4K6R A;  5CQO A;  1GX0 A;  2GGQ A;  1YP3 A;  1VZX A;  2BO6 A;  3CU0 A;  3ZF8 A;  2JCJ A;  1GQC A;  5FU8 A;  3OH4 A;  2A8U A;  2QKX A;  4G87 A;  4B5B A;  1V82 A;  1G23 A;  3ZGF A;  1H5S A;  4AYL A;  2ZU9 A;  1R7Y A;  2AEC A;  4FRL A;  1ON6 A;  5CQN X;  1VM8 A;  5C3D A;  3GUE A;  1TW1 A;  5C4D A;  1EZI A;  4LW6 A;  1NKH B;  5FUH A;  1Z90 A;  2AGD A;  1LZJ A;  4FRE A;  1H7E A;  4EEA A;  1QWJ A;  3V0L A;  1HJL A;  1ZJ1 A;  2A8W A;  2XWL A;  3DK5 A;  1NMM B;  1MP3 A;  1G9R A;  3R2W A;  2YES A;  4AYJ A;  3I0H A;  1H7G A;  2P72 A;  4KNR A;  4E1K A;  2APC A;  4FIX A;  1GX4 A;  5IDS A;  1R7V A;  5D92 A;  2OEG A;  2FYC B;  2Y6P A;  1GWW A;  2V0L A;  2VS3 A;  2QH5 A;  1FR9 A;  1YP2 A;  5C3B A;  1WVC A;  2E8B A;  4M2A A;  4BQH A;  5CMH A;  1ZJ0 A;  2OI6 A;  2Y4K A;  3PNN A;  4MIX A;  4B4G A;  2YC5 A;  3ZGG A;  5L6V A;  1ZCT A;  2VSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...