1FO9A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
344
structure length
331
Chain Sequence
ELAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 109
structure length 331
sequence length 344
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo9A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo9A01
5IFYA 4NAIA 4P02A 1LZ0A 2VD4A 4G3QA 4HO0A 4KRVA 5EIYA 2X60A 1O0RA 2WE9A 1FG5N 1S4OA 3U2UA 1XHBA 5L6SA 3I0FA 4P00A 2ZU9A 3F1YA 5C38A 1LZJA 5C48A 2WVKA 1OMZA 2I5EA 3SXCA 1NHEB 1H7HA 1MP4A 3Q80A 3I0DA 4G3PA 2VS3A 2FFUA 4HOCA 3DUVA 5C4FA 2YESA 2JCOA 1ZDFA 4FREA 5FTSA 2JCKA 1VGTA 3I0KA 3PKPA 3CKQA 1O7OA 2V0KA 1G1LA 2Z87A 4EEMA 5C3AA 3R2WA 1WT3A 4DDZA 3V0MA 1ON6A 2VXLA 3SXDA 1GX0A 4EVWA 1FZWA 4NAKA 2GGQA 3USQA 4ASYA 4KNRA 1H7EA 1GWWA 1G0RA 1K4VA 2OEGA 2XWLA 1MP3A 1WT0A 1H5TA 1LL3A 5C4DA 1ZJ3A 2AM3A 4KNXA 1FO9A 3SXAA 1ZCTA 4Y6NA 4YS8A 4DECA 1WVCA 4J18A 4XWIA 3ZGFA 1HV9A 3E25A 3U2VA 1LL0A 2RIYA 2V0JA 1ZDGA 2ZU7A 2RJ0A 3IOJA 3POLA 4D0TA 3Q7UA 5EJ1A 1JYLA 2AE7A 3V0OA 2VSIA 5DDTA 1FRWA 1V83A 1JV3A 5FYEA 1H4DA 2E8BA 3I0CA 4D48A 1QWJA 4EEAA 2APCA 1GQ9A 2Z86A 2Y4KA 5C49A 1O7QA 2V0IA 4FRAA 4Y9XA 1INJA 1G3LA 2O1HA 3ZLLA 2DPWA 4HO4A 3O3PA 4KC4A 2YQSA 3V0LA 1HM0A 1OQMB 2RJ5A 4FCEA 1E5KA 3OH3A 2V0LA 2FYCB 2FYBA 2YQJA 4LW6A 4B5BA 1ZJOA 2Y4LA 1W57A 3D8VA 2YC3A 3D98A 4FQWA 2XWNA 5CMJA 1ZJ1A 1GA8A 5CMGX 2YQHA 2D0JA 2NXVA 2VS5A 1H5SD 2ZU8A 2OI6A 1SS9A 3IOHA 3PNNA 4HO2A 3EE5A 3T7MA 3I0IX 2X65A 5C1HA 5AJOA 1S4PA 4ARWA 3U0YA 4B42A 3V90A 3V0PA 5C3DA 1INIA 1G23A 1R82A 1O23B 1H3MA 2UX8A 5FTVA 4UEGA 4FRDA 4Y7VA 4G87A 1H7LA 2VFZA 1VH3A 2RJ4A 4HO5A 3U2TA 2FFVA 2Y4MA 3PKQA 4EEOA 4Y7UA 4Y7TA 4EE3A 2VS4A 3JTJA 3JUKA 4GBPA 1G2VA 5C1GA 5IDTA 1TW5A 2RJ9A 1ZCUA 5CMHA 3V8ZA 5C8RA 2FYAA 2D7RA 2I5KA 1VGWA 4KT7A 5CQMX 1NKHB 4CVHA 3SXGA 1FO8A 3CU0A 1FGGA 4HO8A 3RMVA 2ICXA 2JCJA 2PA4A 1H5TB 2WEEA 4AC3A 1XZ6A 2QKXA 3OKRA 2Y4JA 3V0QA 1H4CA 2VSHA 1R7YA 2P72A 4FRLA 3U0XA 2YC5A 4FCUA 2QGIA 1HJLA 1V82A 2XWMA 1VPAA 3KIAA 1FOAA 2BO8A 4FRPA 1V84A 2WAWA 1YP4A 4AYLA 1G8OA 2X5SA 3OAMA 2O1FA 5CQOA 4AAWA 1ZCVA 3V0NA 3V8YA 2FYDB 1W77A 2JCLA 1PZYB 2PGYA 4JD0A 5C4BA 1H5SC 1EZIA 1YP3A 1WSZA 5AJNA 5C47A 4Y62A 1VICA 1H7TA 1ZJ0A 2Y6PA 1H7FA 3NGWA 2FY7A 5CQNX 5L6VA 2RIXA 1G9RA 3SX7A 1H5RB 4G3SA 3V91A 4AYJA 1ZJPA 1W55A 2AM5A 2YQCA 4D11C 1FR9A 4KQLA 4IRPA 3IOIA 1WT2A 2MZBA 1PZTA 3CKNA 1H5RA 4ZDQA 4NANA 1HJJA 2AECA 2WVLA 2XMEA 3I0HA 2P73A 3I0LA 1YROB 2BO6A 3K8EA 1WT1A 4DE7A 4HO9A 2AESA 1VH1A 1GWVA 1KWSA 2YCMA 1QG8A 2O1GA 3SXBA 5C1LA 4KC2A 1G93A 2A8WA 5CQPA 3ZLKA 1R80A 5EJZA 1G97A 1R7TA 3LW6A 1VZTA 4FRHA 1FXJA 3TQDA 4IRQA 4Y64A 4KPZA 4HCQA 4MNDA 3ZF8A 2D7IA 1VM8A 2Q4JA 4NALA 4FRMA 3U2WA 1ZCYA 3BRKX 1VZXA 4KC1A 4K6RA 1R7UA 1IIMA 3DK5A 1I52A 4HG6A 3OH0A 2I7BA 4D0ZA 4BMAA 3ZGGA 4L41C 4R7PA 2VXMA 4B4GA 2RJ1A 1H7GA 1ZI3A 1JVDA 2RITA 1NWGB 1LZ7A 1ZJ2A 2AM4A 1LVWA 2RJ7A 3RSBA 2QH5A 3I0JA 4KXOA 4FRBA 1ZHJA 1NF5B 2RJ6A 4HO6A 4Y7FA 5JQQA 3USRA 4B2XA 4EE4A 1G95A 4CJCA 1QGSA 3JUJA 3SPTA 5C3BA 4JISA 1TVYA 2OEFA 5AJPA 1Z90A 4M4KA 2GGOA 2PX7A 4M2AA 5CMIA 3U2XA 5C4EA 3SX3A 1JVGA 1MP5A 3CGXA 3N9WA 1TZFA 3SXEA 1ZI5A 3I0EA 1FXOA 1JV1A 5BXCA 1HM8A 1NQIB 3CKVA 1FWYA 1H7QA 5I1FA 1ON8A 5FU0A 2Y7AA 2AGDA 1R81A 4ECMA 4BQHA 1GX4A 5J49A 4C2SA 1FGXA 2RJ8A 2OI7A 3R3IA 1EYRA 2AH9A 4B4MA 4B2WA 4Y63A 4CJ8A 4FROA 5CQLX 2CU2A 5C36A 2X5ZA 3DJ4A 1VGZA 1LL2A 3FWWA 1R7XA 3SX5A 1H5SB 3I0GA 1QGQA 4CJBA 5IDSA 3TZTA 2WVMA 1VZUA 3CKJA 3T7OA 2OI5A 2V0HA 4FRQA 4KPXA 1MC3A 3Q4SA 3GUEA 2P6WA 1H5SA 3FOQA 5CMFX 5C4CA 1S4NA 1VGUA 3QVBA 1ZI4A 4B3UA 5HS2A 5FV9A 1JYKA 1LZIA 3E26A 4B4BA 5FUHA 2W0WA 3CKOA 3OH2A 4E1KA 4MYBA 3OH4A 1IINA 1R7VA 3K8DA 2ICYA 2W0VA 5FU8A 2XMHA 2RIZA 3OC9A 4LW3A 3RMWA 3F1CA 1GQCA 4Y6UA 4M28A 1ZI1A 1YP2A 4EEGA 4D11A 1TW1A 4HO3A 2E3DA 1H4EA 3BCVA 3HL3A 3ST8A 2WGZA 4EE5A 5DDVA 3OGZA 4ASJA 3SX8A 2PGVA 1OMXA 2BO4A 3OH1A 4M2BA 2BO7A 4Y7GA 1NMMB 2A8UA 1ZIZA 3T7NA 3D5NA 1HM9A 1FR8A
chains in the Genus database with same CATH superfamily
5IFYA 4NAIA 4P02A 1LZ0A 2VD4A 4G3QA 4HO0A 4KRVA 5EIYA 1K4NA 3HPVA 4NAZA 2X60A 1O0RA 2WE9A 1FG5N 1S4OA 3U2UA 1XHBA 5L6SA 4NB0A 3I0FA 4P00A 2ZU9A 3F1YA 3RMUA 4MTTA 1LZJA 5C38A 5C48A 3OA4A 4RT5A 5DRHA 3HPYA 4IR0A 2WVKA 1OMZA 2VK9A 2I5EA 3SXCA 2C21A 1NHEB 1H7HA 1MP4A 4JH2A 3Q80A 3I0DA 4G3PA 2VS3A 2FFUA 4HOCA 1LQKA 3DUVA 5C4FA 2YESA 4N04A 1XRKA 2JCOA 4GHEA 1ZDFA 4FREA 5FTSA 2JCKA 1VGTA 3VB0A 3I0KA 3PKPA 3CKQA 5C68A 1O7OA 2V0KA 1G1LA 2Z87A 4Z04A 4EEMA 5C3AA 3R2WA 1WT3A 4GHCA 4DDZA 3V0MA 5C4PA 3GHJA 3RHEA 3RRIA 1ON6A 4MTSA 1GX0A 2VXLA 3SXDA 3W0UA 4EVWA 3R4QA 1FZWA 2GGQA 4NAKA 3USQA 4KNRA 4ASYA 1H7EA 4JH6A 1GWWA 1G0RA 1K4VA 2OEGA 3OJJA 2XWLA 1MP3A 1WT0A 1H5TA 1LL3A 5C4DA 4GYMA 1ZJ3A 2AM3A 4KNXA 1FO9A 3SXAA 2ZW6A 1ZCTA 4Y6NA 4PAVA 4MYMA 4YS8A 4GHHA 4DECA 1WVCA 4J18A 4XWIA 3ZGFA 1HV9A 3E25A 4MTRA 3U2VA 2A4XA 1LL0A 2RIYA 2I7RA 2V0JA 2IGAA 1ZDGA 2ZU7A 2A4WA 2RJ0A 3IOJA 3POLA 4O6NA 4D0TA 3Q7UA 2RBBA 5EJ1A 1JYLA 2AE7A 3V0OA 2VSIA 3OUMA 5DDTA 1FRWA 1V83A 1JV3A 5FYEA 1H4DA 2E8BA 3I0CA 4D48A 1QWJA 4EEAA 2APCA 1GQ9A 2Z86A 1KNFA 2Y4KA 1O7QA 3B59A 2V0IA 4FRAA 4Y9XA 5C49A 3ISQA 1INJA 1G3LA 2O1HA 3ZLLA 1TG5A 4G6XA 4NB1A 2DPWA 4HO4A 3O3PA 2ZW4A 4JD1A 2YQSA 4KC4A 4Z6UA 3V0LA 1HM0A 1OQMB 2RJ5A 2P25A 3EY7A 1E5KA 3OH3A 2R6UA 2V0LA 2J0AA 4FCEA 2FYCB 4Z6LA 2FYBA 2YQJA 4LW6A 4B5BA 1FA5A 1ZJOA 4Z6ZA 2Y4LA 1W57A 3D8VA 2YC3A 3EY8A 3PKVA 4O6MA 2ZHPA 2ZW5A 3D98A 4FQWA 2XWNA 5CMJA 1ZJ1A 1GA8A 1XY7A 5CMGX 2YQHA 2D0JA 1KW6B 2NXVA 2VS5A 1H5SD 2ZU8A 3OULA 2OI6A 1SS9A 3IOHA 1XQAA 3PNNA 4HO2A 3LM4A 3EE5A 3T7MA 3I0IX 2X65A 5C1HA 5AJOA 1S4PA 4ARWA 3U0YA 1NNRA 4B42A 5BWHA 3V90A 3V0PA 1KWBB 5C3DA 1KW3B 2EI1A 1INIA 1G23A 1R82A 4JH7A 1O23B 1H3MA 2UX8A 1LQPA 5FTVA 4UEGA 4FRDA 4Y7VA 1QTOA 4G87A 1NPBA 4JH5A 1H7LA 5D91A 1EILA 2VFZA 1VH3A 4Z6RA 2RJ4A 4HO5A 3U2TA 2FFVA 2Y4MA 5CTOA 3PKQA 4EEOA 4Y7UA 1EIQA 4Y7TA 4EE3A 2P7LA 4Z6QA 2RK0A 2VS4A 2ZI8A 3JTJA 1F1UA 3JUKA 4GBPA 1G2VA 5C1GA 5IDTA 1TW5A 2RJ9A 1ZCUA 5CMHA 3V8ZA 5C8RA 2FYAA 1SQDA 2D7RA 2I5KA 3HUHA 1VGWA 4KT7A 5CQMX 3E0RA 1NKHB 4CVHA 3SXGA 1FO8A 4FIYA 3CU0A 1FGGA 1KMZA 2EI2A 4HO8A 3RMVA 2ICXA 2JCJA 2P7OA 3OPYB 2PA4A 1H5TB 2WEEA 4AC3A 1T47A 1XZ6A 2QKXA 3OKRA 2Y4JA 3V0QA 3OAJA 1H4CA 2VSHA 1R7YA 2P72A 4FRLA 3U0XA 2YC5A 4FCUA 2QGIA 1QIPA 3OPYA 3LHOA 1HJLA 1BYLA 1V82A 2XWMA 1KLLA 1VPAA 1F1RA 3KIAA 1FOAA 2BO8A 1F9ZA 4FRPA 1V84A 4HUZA 2WAWA 1YP4A 4AYLA 4JH4A 1G8OA 3ECKA 2X5SA 3OAMA 3SK2A 2O1FA 1U69A 5CQOA 4AAWA 1ZCVA 3V0NA 3V8YA 3E5DA 2FYDB 1W77A 2JCLA 1PZYB 5CJ3A 2PGYA 4Z6WA 4PV5A 2P7QA 4JD0A 5C4BA 1H5SC 2P7PA 1EZIA 1KNDA 1ZSWA 1YP3A 2ZYQA 5D7ZA 3OJNA 2PJSA 1WSZA 5AJNA 5C47A 4Q7CA 4Y62A 4KYHA 1VICA 1H7TA 1R9CA 2R5VA 1ZJ0A 2Y6PA 1H7FA 3P8AA 3NGWA 2FY7A 1F1XA 5D4FA 2RIXA 5CQNX 1G9RA 3SX7A 5KEFA 1H5RB 4G3SA 3V91A 5L6VA 4JH9A 3ECJA 4AYJA 1ZJPA 4IAGA 1W55A 2RJBA 1KW8B 1NKIA 2AM5A 2YQCA 4D11C 1FR9A 4KQLA 4IRPA 3IOIA 1WT2A 1U6LA 4NAYA 1Q0OA 2MZBA 1PZTA 3CKNA 1H5RA 4ZDQA 4NANA 1HJJA 2AECA 2WVLA 2XMEA 3I0HA 2P73A 1BH5A 4Z6PA 3I0LA 1YROB 2BO6A 4MTQA 3K8EA 1WT1A 4DE7A 4HO9A 2AESA 1CJXA 1VH1A 1GWVA 2C0NA 1KWSA 2YCMA 1QG8A 2O1GA 4GHFA 3SXBA 5C1LA 4KC2A 1G93A 2A8WA 5CQPA 3OJTA 3ZLKA 1R80A 2J0BA 5EJZA 1G97A 1R7TA 3LW6A 1VZTA 4FRHA 5DHWA 1FXJA 1LQOA 3TQDA 5HCWA 5D92A 4IRQA 4Y64A 2Q48A 4KPZA 4HCQA 4Z6SA 1LKDA 4MNDA 3ZF8A 2D7IA 1VM8A 2Q4JA 4JH8A 3ZGJA 4NALA 4FRMA 3U2WA 1ZCYA 1KWCB 5F6QA 3BRKX 1VZXA 4KC1A 4K6RA 1NIQB 1R7UA 1IIMA 3DK5A 1I52A 4HG6A 1EIRA 4OPNA 2I7BA 3OH0A 3L7TA 4D0ZA 4BMAA 3ZGGA 4Z6NA 4L41C 4R7PA 2VXMA 2P7MA 4B4GA 2RJ1A 1H7GA 1ZI3A 1JVDA 2RITA 4NB2A 1LZ7A 1NWGB 1ZJ2A 2AM4A 1LVWA 2RJ7A 3W0TA 3RSBA 2WL9A 2QH5A 3I0JA 4KXOA 4FRBA 1ZHJA 1NF5B 2WL3A 2RJ6A 4HO6A 4Y7FA 5JQQA 3USRA 4B2XA 4EE4A 1G95A 4CJCA 1QGSA 3JUJA 3SPTA 3KOLA 1EWJA 3PKXA 4JISA 1MPYA 1TVYA 2OEFA 5AJPA 5C3BA 1Z90A 4M4KA 2GGOA 2PX7A 4M2AA 3VW9A 4GHDA 3OJKA 5CMIA 3U2XA 4Z6MA 5C4EA 3SX3A 1LGTA 4KYKA 1JVGA 1MP5A 3CGXA 4NVSA 3N9WA 1TSJA 1TZFA 3SXEA 1ZI5A 3I0EA 1JC4A 3FCDA 1FXOA 1JV1A 3HDPA 3CT8A 5BXCA 1HM8A 1JIFA 5EC3A 1NQIB 3CKVA 1FWYA 1H7QA 3HNQA 3BZAA 5I1FA 1KW9B 1SQIA 1ON8A 5FU0A 1JIEA 2Y7AA 2AGDA 1FROA 2QH0A 1R81A 4ECMA 2ZA0A 4Z6VA 4BQHA 1GX4A 3GM5A 4C2SA 4GHGA 5J49A 1FGXA 2RJ8A 2OI7A 4MIXA 4X2AA 3R3IA 3ZW5A 1EYRA 2EI3A 3HQ0A 1DHYA 2AH9A 4B2WA 4LQBA 4Y63A 4B4MA 4CJ8A 4FROA 5CQLX 4Z6TA 2CU2A 2X5ZA 3DJ4A 1VGZA 5C36A 1LL2A 3FWWA 1R7XA 3SX5A 1H5SB 2EHZA 3BQXA 1TFZA 3I0GA 1Q0CA 3ZI1A 1QGQA 4CJBA 5IDSA 3TZTA 3PKWA 2RK9A 1VZUA 2WVMA 1KMYA 3CKJA 3T7OA 2OI5A 2V0HA 4FRQA 4QB5A 4KPXA 5C6XA 1MC3A 3GUEA 2P6WA 1H5SA 3FOQA 3Q4SA 1MH6A 3OXHA 5CMFX 5C4CA 1FA7A 1F1VA 1S4NA 1VGUA 3QVBA 1ZI4A 1TWUA 4B3UA 5HS2A 5FV9A 5CB9A 1JYKA 1LZIA 3E26A 4B4BA 5FUHA 2W0WA 3CKOA 3OH2A 4E1KA 4MYBA 4FIXA 3OH4A 1IINA 1R7VA 5BWGA 3K8DA 2ICYA 2W0VA 5FU8A 3G12A 2XMHA 1SP8A 2RIZA 3OC9A 4LW3A 3RMWA 3F1CA 3IUZA 2EI0A 1GQCA 4Y6UA 1SS4A 4M28A 5DFGA 1YP2A 1ZI1A 4EEGA 4D11A 2QNTA 1TW1A 4HO3A 2E3DA 1SP9A 1H4EA 3BCVA 3HL3A 3L20A 4Z6OA 3ST8A 2WGZA 2P7KA 1FA6A 4EE5A 1QINA 4HC5A 5DDVA 3R6AA 1ECSA 3OGZA 4ASJA 1FA8A 2QQZA 1JC5A 3SX8A 2PGVA 1OMXA 2BO4A 3OH1A 4M2BA 2BO7A 4Y7GA 1NMMB 1HANA 2A8UA 4JH1A 4JH3A 1ZIZA 3T7NA 2ZW7A 3D5NA 1HM9A 1FR8A 2IG9A
chains in the Genus database with same CATH topology
5IFYA 4NAIA 4P02A 1LZ0A 2VD4A 4G3QA 4HO0A 4KRVA 5EIYA 2X60A 1O0RA 2WE9A 1FG5N 1S4OA 3U2UA 1XHBA 5L6SA 3I0FA 4P00A 2ZU9A 3F1YA 5C38A 1LZJA 5C48A 2WVKA 1OMZA 2VK9A 2I5EA 3SXCA 1NHEB 1H7HA 1MP4A 3Q80A 3I0DA 4G3PA 2VS3A 2FFUA 4HOCA 3DUVA 5C4FA 2YESA 2JCOA 1ZDFA 4FREA 5FTSA 2JCKA 1VGTA 3I0KA 3PKPA 3CKQA 1O7OA 2V0KA 1G1LA 2Z87A 4EEMA 5C3AA 3R2WA 1WT3A 4DDZA 3V0MA 1ON6A 2VXLA 3SXDA 1GX0A 4EVWA 1FZWA 4NAKA 2GGQA 3USQA 4ASYA 4KNRA 1H7EA 1GWWA 1G0RA 1K4VA 2OEGA 2XWLA 1MP3A 1WT0A 1H5TA 1LL3A 5C4DA 1ZJ3A 2AM3A 4KNXA 1FO9A 3SXAA 1ZCTA 4Y6NA 4YS8A 4DECA 1WVCA 4J18A 4XWIA 3ZGFA 1HV9A 3E25A 3U2VA 1LL0A 2RIYA 2V0JA 1ZDGA 2ZU7A 2RJ0A 3IOJA 3POLA 4O6NA 4D0TA 3Q7UA 5EJ1A 1JYLA 2AE7A 3V0OA 2VSIA 5DDTA 1FRWA 1V83A 1JV3A 5FYEA 1H4DA 2E8BA 3I0CA 4D48A 1QWJA 4EEAA 2APCA 1GQ9A 2Z86A 2Y4KA 5C49A 1O7QA 2V0IA 4FRAA 4Y9XA 1INJA 1G3LA 2O1HA 3ZLLA 2DPWA 4HO4A 3O3PA 4KC4A 2YQSA 3V0LA 1HM0A 1OQMB 2RJ5A 4FCEA 1E5KA 3OH3A 2V0LA 2J0AA 2FYCB 2FYBA 2YQJA 4LW6A 4B5BA 1ZJOA 2Y4LA 1W57A 3D8VA 2YC3A 4O6MA 3D98A 4FQWA 2XWNA 5CMJA 1ZJ1A 1GA8A 5CMGX 2YQHA 2D0JA 2NXVA 2VS5A 1H5SD 2ZU8A 2OI6A 1SS9A 3IOHA 3PNNA 4HO2A 3EE5A 3T7MA 3I0IX 2X65A 5C1HA 5AJOA 1S4PA 4ARWA 3U0YA 4B42A 3V90A 3V0PA 5C3DA 1INIA 1G23A 1R82A 1O23B 1H3MA 2UX8A 5FTVA 4UEGA 4FRDA 4Y7VA 4G87A 5D91A 1H7LA 2VFZA 1VH3A 2RJ4A 4HO5A 3U2TA 2FFVA 2Y4MA 3PKQA 4EEOA 4Y7UA 4Y7TA 4EE3A 2VS4A 3JTJA 3JUKA 4GBPA 1G2VA 5C1GA 5IDTA 1TW5A 2RJ9A 1ZCUA 5CMHA 3V8ZA 5C8RA 2FYAA 2D7RA 2I5KA 1VGWA 4KT7A 5CQMX 1NKHB 4CVHA 3SXGA 1FO8A 4FIYA 3CU0A 1FGGA 4HO8A 3RMVA 2ICXA 2JCJA 2PA4A 1H5TB 2WEEA 4AC3A 1XZ6A 2QKXA 3OKRA 2Y4JA 3V0QA 1H4CA 2VSHA 1R7YA 2P72A 4FRLA 3U0XA 2YC5A 4FCUA 2QGIA 1HJLA 1V82A 2XWMA 1VPAA 3KIAA 1FOAA 2BO8A 4FRPA 1V84A 2WAWA 1YP4A 4AYLA 1G8OA 2X5SA 3OAMA 2O1FA 5CQOA 4AAWA 1ZCVA 3V0NA 3V8YA 2FYDB 1W77A 2JCLA 1PZYB 2PGYA 4JD0A 5C4BA 1H5SC 1EZIA 1YP3A 1WSZA 5AJNA 5C47A 4Q7CA 4Y62A 1VICA 1H7TA 1ZJ0A 2Y6PA 1H7FA 3NGWA 2FY7A 5CQNX 5L6VA 2RIXA 1G9RA 3SX7A 1H5RB 4G3SA 3V91A 4AYJA 1ZJPA 1W55A 2AM5A 2YQCA 4D11C 1FR9A 4KQLA 4IRPA 3IOIA 1WT2A 2MZBA 1PZTA 3CKNA 1H5RA 4ZDQA 4NANA 1HJJA 2AECA 2WVLA 2XMEA 3I0HA 2P73A 3I0LA 1YROB 2BO6A 3K8EA 1WT1A 4DE7A 4HO9A 2AESA 1VH1A 1GWVA 2C0NA 1KWSA 2YCMA 1QG8A 2O1GA 3SXBA 5C1LA 4KC2A 1G93A 2A8WA 5CQPA 3ZLKA 1R80A 2J0BA 5EJZA 1G97A 1R7TA 3LW6A 1VZTA 4FRHA 1FXJA 3TQDA 5D92A 4IRQA 4Y64A 4KPZA 4HCQA 4MNDA 3ZF8A 2D7IA 1VM8A 2Q4JA 4NALA 4FRMA 3U2WA 1ZCYA 3BRKX 1VZXA 4KC1A 4K6RA 1R7UA 1IIMA 3DK5A 1I52A 4HG6A 3OH0A 2I7BA 4D0ZA 4BMAA 3ZGGA 4L41C 4R7PA 2VXMA 4B4GA 2RJ1A 1H7GA 1ZI3A 1JVDA 2RITA 1NWGB 1LZ7A 1ZJ2A 2AM4A 1LVWA 2RJ7A 3RSBA 2QH5A 3I0JA 4KXOA 4FRBA 1ZHJA 1NF5B 2RJ6A 4HO6A 4Y7FA 5JQQA 3USRA 4B2XA 4EE4A 1G95A 4CJCA 1QGSA 3JUJA 3SPTA 5C3BA 4JISA 1TVYA 2OEFA 5AJPA 1Z90A 4M4KA 2GGOA 2PX7A 4M2AA 5CMIA 3U2XA 5C4EA 3SX3A 1JVGA 1MP5A 3CGXA 3N9WA 1TZFA 3SXEA 1ZI5A 3I0EA 1FXOA 1JV1A 5BXCA 1HM8A 1NQIB 3CKVA 1FWYA 1H7QA 5I1FA 1ON8A 5FU0A 2Y7AA 2AGDA 1R81A 4ECMA 4BQHA 1GX4A 5J49A 4C2SA 1FGXA 2RJ8A 2OI7A 4MIXA 3R3IA 1EYRA 2AH9A 4B4MA 4B2WA 4Y63A 4CJ8A 4FROA 5CQLX 2CU2A 5C36A 2X5ZA 3DJ4A 1VGZA 1LL2A 3FWWA 1R7XA 3SX5A 1H5SB 3I0GA 1QGQA 4CJBA 5IDSA 3TZTA 2WVMA 1VZUA 3CKJA 3T7OA 2OI5A 2V0HA 4FRQA 4KPXA 1MC3A 3Q4SA 3GUEA 2P6WA 1H5SA 3FOQA 5CMFX 5C4CA 1S4NA 1VGUA 3QVBA 1ZI4A 4B3UA 5HS2A 5FV9A 1JYKA 1LZIA 3E26A 4B4BA 5FUHA 2W0WA 3CKOA 3OH2A 4E1KA 4MYBA 4FIXA 3OH4A 1IINA 1R7VA 3K8DA 2ICYA 2W0VA 5FU8A 2XMHA 2RIZA 3OC9A 4LW3A 3RMWA 3F1CA 1GQCA 4Y6UA 4M28A 1ZI1A 1YP2A 4EEGA 4D11A 1TW1A 4HO3A 2E3DA 1H4EA 3BCVA 3HL3A 3ST8A 2WGZA 4EE5A 5DDVA 3OGZA 4ASJA 3SX8A 2PGVA 1OMXA 2BO4A 3OH1A 4M2BA 2BO7A 4Y7GA 1NMMB 2A8UA 1ZIZA 3T7NA 3D5NA 1HM9A 1FR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IFY A;  4NAI A;  4P02 A;  1LZ0 A;  2VD4 A;  4G3Q A;  4HO0 A;  4KRV A;  5EIY A;  2X60 A;  1O0R A;  2WE9 A;  1FG5 N;  1S4O A;  3U2U A;  1XHB A;  5L6S A;  3I0F A;  4P00 A;  2ZU9 A;  3F1Y A;  5C38 A;  1LZJ A;  5C48 A;  2WVK A;  1OMZ A;  2I5E A;  3SXC A;  1NHE B;  1H7H A;  1MP4 A;  3Q80 A;  3I0D A;  4G3P A;  2VS3 A;  2FFU A;  4HOC A;  3DUV A;  5C4F A;  2YES A;  2JCO A;  1ZDF A;  4FRE A;  5FTS A;  2JCK A;  1VGT A;  3I0K A;  3PKP A;  3CKQ A;  1O7O A;  2V0K A;  1G1L A;  2Z87 A;  4EEM A;  5C3A A;  3R2W A;  1WT3 A;  4DDZ A;  3V0M A;  1ON6 A;  2VXL A;  3SXD A;  1GX0 A;  4EVW A;  1FZW A;  4NAK A;  2GGQ A;  3USQ A;  4ASY A;  4KNR A;  1H7E A;  1GWW A;  1G0R A;  1K4V A;  2OEG A;  2XWL A;  1MP3 A;  1WT0 A;  1H5T A;  1LL3 A;  5C4D A;  1ZJ3 A;  2AM3 A;  4KNX A;  1FO9 A;  3SXA A;  1ZCT A;  4Y6N A;  4YS8 A;  4DEC A;  1WVC A;  4J18 A;  4XWI A;  3ZGF A;  1HV9 A;  3E25 A;  3U2V A;  1LL0 A;  2RIY A;  2V0J A;  1ZDG A;  2ZU7 A;  2RJ0 A;  3IOJ A;  3POL A;  4D0T A;  3Q7U A;  5EJ1 A;  1JYL A;  2AE7 A;  3V0O A;  2VSI A;  5DDT A;  1FRW A;  1V83 A;  1JV3 A;  5FYE A;  1H4D A;  2E8B A;  3I0C A;  4D48 A;  1QWJ A;  4EEA A;  2APC A;  1GQ9 A;  2Z86 A;  2Y4K A;  5C49 A;  1O7Q A;  2V0I A;  4FRA A;  4Y9X A;  1INJ A;  1G3L A;  2O1H A;  3ZLL A;  2DPW A;  4HO4 A;  3O3P A;  4KC4 A;  2YQS A;  3V0L A;  1HM0 A;  1OQM B;  2RJ5 A;  4FCE A;  1E5K A;  3OH3 A;  2V0L A;  2FYC B;  2FYB A;  2YQJ A;  4LW6 A;  4B5B A;  1ZJO A;  2Y4L A;  1W57 A;  3D8V A;  2YC3 A;  3D98 A;  4FQW A;  2XWN A;  5CMJ A;  1ZJ1 A;  1GA8 A;  5CMG X;  2YQH A;  2D0J A;  2NXV A;  2VS5 A;  1H5S D;  2ZU8 A;  2OI6 A;  1SS9 A;  3IOH A;  3PNN A;  4HO2 A;  3EE5 A;  3T7M A;  3I0I X;  2X65 A;  5C1H A;  5AJO A;  1S4P A;  4ARW A;  3U0Y A;  4B42 A;  3V90 A;  3V0P A;  5C3D A;  1INI A;  1G23 A;  1R82 A;  1O23 B;  1H3M A;  2UX8 A;  5FTV A;  4UEG A;  4FRD A;  4Y7V A;  4G87 A;  1H7L A;  2VFZ A;  1VH3 A;  2RJ4 A;  4HO5 A;  3U2T A;  2FFV A;  2Y4M A;  3PKQ A;  4EEO A;  4Y7U A;  4Y7T A;  4EE3 A;  2VS4 A;  3JTJ A;  3JUK A;  4GBP A;  1G2V A;  5C1G A;  5IDT A;  1TW5 A;  2RJ9 A;  1ZCU A;  5CMH A;  3V8Z A;  5C8R A;  2FYA A;  2D7R A;  2I5K A;  1VGW A;  4KT7 A;  5CQM X;  1NKH B;  4CVH A;  3SXG A;  1FO8 A;  3CU0 A;  1FGG A;  4HO8 A;  3RMV A;  2ICX A;  2JCJ A;  2PA4 A;  1H5T B;  2WEE A;  4AC3 A;  1XZ6 A;  2QKX A;  3OKR A;  2Y4J A;  3V0Q A;  1H4C A;  2VSH A;  1R7Y A;  2P72 A;  4FRL A;  3U0X A;  2YC5 A;  4FCU A;  2QGI A;  1HJL A;  1V82 A;  2XWM A;  1VPA A;  3KIA A;  1FOA A;  2BO8 A;  4FRP A;  1V84 A;  2WAW A;  1YP4 A;  4AYL A;  1G8O A;  2X5S A;  3OAM A;  2O1F A;  5CQO A;  4AAW A;  1ZCV A;  3V0N A;  3V8Y A;  2FYD B;  1W77 A;  2JCL A;  1PZY B;  2PGY A;  4JD0 A;  5C4B A;  1H5S C;  1EZI A;  1YP3 A;  1WSZ A;  5AJN A;  5C47 A;  4Y62 A;  1VIC A;  1H7T A;  1ZJ0 A;  2Y6P A;  1H7F A;  3NGW A;  2FY7 A;  5CQN X;  5L6V A;  2RIX A;  1G9R A;  3SX7 A;  1H5R B;  4G3S A;  3V91 A;  4AYJ A;  1ZJP A;  1W55 A;  2AM5 A;  2YQC A;  4D11 C;  1FR9 A;  4KQL A;  4IRP A;  3IOI A;  1WT2 A;  2MZB A;  1PZT A;  3CKN A;  1H5R A;  4ZDQ A;  4NAN A;  1HJJ A;  2AEC A;  2WVL A;  2XME A;  3I0H A;  2P73 A;  3I0L A;  1YRO B;  2BO6 A;  3K8E A;  1WT1 A;  4DE7 A;  4HO9 A;  2AES A;  1VH1 A;  1GWV A;  1KWS A;  2YCM A;  1QG8 A;  2O1G A;  3SXB A;  5C1L A;  4KC2 A;  1G93 A;  2A8W A;  5CQP A;  3ZLK A;  1R80 A;  5EJZ A;  1G97 A;  1R7T A;  3LW6 A;  1VZT A;  4FRH A;  1FXJ A;  3TQD A;  4IRQ A;  4Y64 A;  4KPZ A;  4HCQ A;  4MND A;  3ZF8 A;  2D7I A;  1VM8 A;  2Q4J A;  4NAL A;  4FRM A;  3U2W A;  1ZCY A;  3BRK X;  1VZX A;  4KC1 A;  4K6R A;  1R7U A;  1IIM A;  3DK5 A;  1I52 A;  4HG6 A;  3OH0 A;  2I7B A;  4D0Z A;  4BMA A;  3ZGG A;  4L41 C;  4R7P A;  2VXM A;  4B4G A;  2RJ1 A;  1H7G A;  1ZI3 A;  1JVD A;  2RIT A;  1NWG B;  1LZ7 A;  1ZJ2 A;  2AM4 A;  1LVW A;  2RJ7 A;  3RSB A;  2QH5 A;  3I0J A;  4KXO A;  4FRB A;  1ZHJ A;  1NF5 B;  2RJ6 A;  4HO6 A;  4Y7F A;  5JQQ A;  3USR A;  4B2X A;  4EE4 A;  1G95 A;  4CJC A;  1QGS A;  3JUJ A;  3SPT A;  5C3B A;  4JIS A;  1TVY A;  2OEF A;  5AJP A;  1Z90 A;  4M4K A;  2GGO A;  2PX7 A;  4M2A A;  5CMI A;  3U2X A;  5C4E A;  3SX3 A;  1JVG A;  1MP5 A;  3CGX A;  3N9W A;  1TZF A;  3SXE A;  1ZI5 A;  3I0E A;  1FXO A;  1JV1 A;  5BXC A;  1HM8 A;  1NQI B;  3CKV A;  1FWY A;  1H7Q A;  5I1F A;  1ON8 A;  5FU0 A;  2Y7A A;  2AGD A;  1R81 A;  4ECM A;  4BQH A;  1GX4 A;  5J49 A;  4C2S A;  1FGX A;  2RJ8 A;  2OI7 A;  3R3I A;  1EYR A;  2AH9 A;  4B4M A;  4B2W A;  4Y63 A;  4CJ8 A;  4FRO A;  5CQL X;  2CU2 A;  5C36 A;  2X5Z A;  3DJ4 A;  1VGZ A;  1LL2 A;  3FWW A;  1R7X A;  3SX5 A;  1H5S B;  3I0G A;  1QGQ A;  4CJB A;  5IDS A;  3TZT A;  2WVM A;  1VZU A;  3CKJ A;  3T7O A;  2OI5 A;  2V0H A;  4FRQ A;  4KPX A;  1MC3 A;  3Q4S A;  3GUE A;  2P6W A;  1H5S A;  3FOQ A;  5CMF X;  5C4C A;  1S4N A;  1VGU A;  3QVB A;  1ZI4 A;  4B3U A;  5HS2 A;  5FV9 A;  1JYK A;  1LZI A;  3E26 A;  4B4B A;  5FUH A;  2W0W A;  3CKO A;  3OH2 A;  4E1K A;  4MYB A;  3OH4 A;  1IIN A;  1R7V A;  3K8D A;  2ICY A;  2W0V A;  5FU8 A;  2XMH A;  2RIZ A;  3OC9 A;  4LW3 A;  3RMW A;  3F1C A;  1GQC A;  4Y6U A;  4M28 A;  1ZI1 A;  1YP2 A;  4EEG A;  4D11 A;  1TW1 A;  4HO3 A;  2E3D A;  1H4E A;  3BCV A;  3HL3 A;  3ST8 A;  2WGZ A;  4EE5 A;  5DDV A;  3OGZ A;  4ASJ A;  3SX8 A;  2PGV A;  1OMX A;  2BO4 A;  3OH1 A;  4M2B A;  2BO7 A;  4Y7G A;  1NMM B;  2A8U A;  1ZIZ A;  3T7N A;  3D5N A;  1HM9 A;  1FR8 A; 
#chains in the Genus database with same CATH topology
 5IFY A;  4NAI A;  4P02 A;  1LZ0 A;  2VD4 A;  4G3Q A;  4HO0 A;  4KRV A;  5EIY A;  1K4N A;  3HPV A;  4NAZ A;  2X60 A;  1O0R A;  2WE9 A;  1FG5 N;  1S4O A;  3U2U A;  1XHB A;  5L6S A;  4NB0 A;  3I0F A;  4P00 A;  2ZU9 A;  3F1Y A;  3RMU A;  4MTT A;  1LZJ A;  5C38 A;  5C48 A;  3OA4 A;  4RT5 A;  5DRH A;  3HPY A;  4IR0 A;  2WVK A;  1OMZ A;  2VK9 A;  2I5E A;  3SXC A;  2C21 A;  1NHE B;  1H7H A;  1MP4 A;  4JH2 A;  3Q80 A;  3I0D A;  4G3P A;  2VS3 A;  2FFU A;  4HOC A;  1LQK A;  3DUV A;  5C4F A;  2YES A;  4N04 A;  1XRK A;  2JCO A;  4GHE A;  1ZDF A;  4FRE A;  5FTS A;  2JCK A;  1VGT A;  3VB0 A;  3I0K A;  3PKP A;  3CKQ A;  5C68 A;  1O7O A;  2V0K A;  1G1L A;  2Z87 A;  4Z04 A;  4EEM A;  5C3A A;  3R2W A;  1WT3 A;  4GHC A;  4DDZ A;  3V0M A;  5C4P A;  3GHJ A;  3RHE A;  3RRI A;  1ON6 A;  4MTS A;  1GX0 A;  2VXL A;  3SXD A;  3W0U A;  4EVW A;  3R4Q A;  1FZW A;  2GGQ A;  4NAK A;  3USQ A;  4KNR A;  4ASY A;  1H7E A;  4JH6 A;  1GWW A;  1G0R A;  1K4V A;  2OEG A;  3OJJ A;  2XWL A;  1MP3 A;  1WT0 A;  1H5T A;  1LL3 A;  5C4D A;  4GYM A;  1ZJ3 A;  2AM3 A;  4KNX A;  1FO9 A;  3SXA A;  2ZW6 A;  1ZCT A;  4Y6N A;  4PAV A;  4MYM A;  4YS8 A;  4GHH A;  4DEC A;  1WVC A;  4J18 A;  4XWI A;  3ZGF A;  1HV9 A;  3E25 A;  4MTR A;  3U2V A;  2A4X A;  1LL0 A;  2RIY A;  2I7R A;  2V0J A;  2IGA A;  1ZDG A;  2ZU7 A;  2A4W A;  2RJ0 A;  3IOJ A;  3POL A;  4O6N A;  4D0T A;  3Q7U A;  2RBB A;  5EJ1 A;  1JYL A;  2AE7 A;  3V0O A;  2VSI A;  3OUM A;  5DDT A;  1FRW A;  1V83 A;  1JV3 A;  5FYE A;  1H4D A;  2E8B A;  3I0C A;  4D48 A;  1QWJ A;  4EEA A;  2APC A;  1GQ9 A;  2Z86 A;  1KNF A;  2Y4K A;  1O7Q A;  3B59 A;  2V0I A;  4FRA A;  4Y9X A;  5C49 A;  3ISQ A;  1INJ A;  1G3L A;  2O1H A;  3ZLL A;  1TG5 A;  4G6X A;  4NB1 A;  2DPW A;  4HO4 A;  3O3P A;  2ZW4 A;  4JD1 A;  2YQS A;  4KC4 A;  4Z6U A;  3V0L A;  1HM0 A;  1OQM B;  2RJ5 A;  2P25 A;  3EY7 A;  1E5K A;  3OH3 A;  2R6U A;  2V0L A;  2J0A A;  4FCE A;  2FYC B;  4Z6L A;  2FYB A;  2YQJ A;  4LW6 A;  4B5B A;  1FA5 A;  1ZJO A;  4Z6Z A;  2Y4L A;  1W57 A;  3D8V A;  2YC3 A;  3EY8 A;  3PKV A;  4O6M A;  2ZHP A;  2ZW5 A;  3D98 A;  4FQW A;  2XWN A;  5CMJ A;  1ZJ1 A;  1GA8 A;  1XY7 A;  5CMG X;  2YQH A;  2D0J A;  1KW6 B;  2NXV A;  2VS5 A;  1H5S D;  2ZU8 A;  3OUL A;  2OI6 A;  1SS9 A;  3IOH A;  1XQA A;  3PNN A;  4HO2 A;  3LM4 A;  3EE5 A;  3T7M A;  3I0I X;  2X65 A;  5C1H A;  5AJO A;  1S4P A;  4ARW A;  3U0Y A;  1NNR A;  4B42 A;  5BWH A;  3V90 A;  3V0P A;  1KWB B;  5C3D A;  1KW3 B;  2EI1 A;  1INI A;  1G23 A;  1R82 A;  4JH7 A;  1O23 B;  1H3M A;  2UX8 A;  1LQP A;  5FTV A;  4UEG A;  4FRD A;  4Y7V A;  1QTO A;  4G87 A;  1NPB A;  4JH5 A;  1H7L A;  5D91 A;  1EIL A;  2VFZ A;  1VH3 A;  4Z6R A;  2RJ4 A;  4HO5 A;  3U2T A;  2FFV A;  2Y4M A;  5CTO A;  3PKQ A;  4EEO A;  4Y7U A;  1EIQ A;  4Y7T A;  4EE3 A;  2P7L A;  4Z6Q A;  2RK0 A;  2VS4 A;  2ZI8 A;  3JTJ A;  1F1U A;  3JUK A;  4GBP A;  1G2V A;  5C1G A;  5IDT A;  1TW5 A;  2RJ9 A;  1ZCU A;  5CMH A;  3V8Z A;  5C8R A;  2FYA A;  1SQD A;  2D7R A;  2I5K A;  3HUH A;  1VGW A;  4KT7 A;  5CQM X;  3E0R A;  1NKH B;  4CVH A;  3SXG A;  1FO8 A;  4FIY A;  3CU0 A;  1FGG A;  1KMZ A;  2EI2 A;  4HO8 A;  3RMV A;  2ICX A;  2JCJ A;  2P7O A;  3OPY B;  2PA4 A;  1H5T B;  2WEE A;  4AC3 A;  1T47 A;  1XZ6 A;  2QKX A;  3OKR A;  2Y4J A;  3V0Q A;  3OAJ A;  1H4C A;  2VSH A;  1R7Y A;  2P72 A;  4FRL A;  3U0X A;  2YC5 A;  4FCU A;  2QGI A;  1QIP A;  3OPY A;  3LHO A;  1HJL A;  1BYL A;  1V82 A;  2XWM A;  1KLL A;  1VPA A;  1F1R A;  3KIA A;  1FOA A;  2BO8 A;  1F9Z A;  4FRP A;  1V84 A;  4HUZ A;  2WAW A;  1YP4 A;  4AYL A;  4JH4 A;  1G8O A;  3ECK A;  2X5S A;  3OAM A;  3SK2 A;  2O1F A;  1U69 A;  5CQO A;  4AAW A;  1ZCV A;  3V0N A;  3V8Y A;  3E5D A;  2FYD B;  1W77 A;  2JCL A;  1PZY B;  5CJ3 A;  2PGY A;  4Z6W A;  4PV5 A;  2P7Q A;  4JD0 A;  5C4B A;  1H5S C;  2P7P A;  1EZI A;  1KND A;  1ZSW A;  1YP3 A;  2ZYQ A;  5D7Z A;  3OJN A;  2PJS A;  1WSZ A;  5AJN A;  5C47 A;  4Q7C A;  4Y62 A;  4KYH A;  1VIC A;  1H7T A;  1R9C A;  2R5V A;  1ZJ0 A;  2Y6P A;  1H7F A;  3P8A A;  3NGW A;  2FY7 A;  1F1X A;  5D4F A;  2RIX A;  5CQN X;  1G9R A;  3SX7 A;  5KEF A;  1H5R B;  4G3S A;  3V91 A;  5L6V A;  4JH9 A;  3ECJ A;  4AYJ A;  1ZJP A;  4IAG A;  1W55 A;  2RJB A;  1KW8 B;  1NKI A;  2AM5 A;  2YQC A;  4D11 C;  1FR9 A;  4KQL A;  4IRP A;  3IOI A;  1WT2 A;  1U6L A;  4NAY A;  1Q0O A;  2MZB A;  1PZT A;  3CKN A;  1H5R A;  4ZDQ A;  4NAN A;  1HJJ A;  2AEC A;  2WVL A;  2XME A;  3I0H A;  2P73 A;  1BH5 A;  4Z6P A;  3I0L A;  1YRO B;  2BO6 A;  4MTQ A;  3K8E A;  1WT1 A;  4DE7 A;  4HO9 A;  2AES A;  1CJX A;  1VH1 A;  1GWV A;  2C0N A;  1KWS A;  2YCM A;  1QG8 A;  2O1G A;  4GHF A;  3SXB A;  5C1L A;  4KC2 A;  1G93 A;  2A8W A;  5CQP A;  3OJT A;  3ZLK A;  1R80 A;  2J0B A;  5EJZ A;  1G97 A;  1R7T A;  3LW6 A;  1VZT A;  4FRH A;  5DHW A;  1FXJ A;  1LQO A;  3TQD A;  5HCW A;  5D92 A;  4IRQ A;  4Y64 A;  2Q48 A;  4KPZ A;  4HCQ A;  4Z6S A;  1LKD A;  4MND A;  3ZF8 A;  2D7I A;  1VM8 A;  2Q4J A;  4JH8 A;  3ZGJ A;  4NAL A;  4FRM A;  3U2W A;  1ZCY A;  1KWC B;  5F6Q A;  3BRK X;  1VZX A;  4KC1 A;  4K6R A;  1NIQ B;  1R7U A;  1IIM A;  3DK5 A;  1I52 A;  4HG6 A;  1EIR A;  4OPN A;  2I7B A;  3OH0 A;  3L7T A;  4D0Z A;  4BMA A;  3ZGG A;  4Z6N A;  4L41 C;  4R7P A;  2VXM A;  2P7M A;  4B4G A;  2RJ1 A;  1H7G A;  1ZI3 A;  1JVD A;  2RIT A;  4NB2 A;  1LZ7 A;  1NWG B;  1ZJ2 A;  2AM4 A;  1LVW A;  2RJ7 A;  3W0T A;  3RSB A;  2WL9 A;  2QH5 A;  3I0J A;  4KXO A;  4FRB A;  1ZHJ A;  1NF5 B;  2WL3 A;  2RJ6 A;  4HO6 A;  4Y7F A;  5JQQ A;  3USR A;  4B2X A;  4EE4 A;  1G95 A;  4CJC A;  1QGS A;  3JUJ A;  3SPT A;  3KOL A;  1EWJ A;  3PKX A;  4JIS A;  1MPY A;  1TVY A;  2OEF A;  5AJP A;  5C3B A;  1Z90 A;  4M4K A;  2GGO A;  2PX7 A;  4M2A A;  3VW9 A;  4GHD A;  3OJK A;  5CMI A;  3U2X A;  4Z6M A;  5C4E A;  3SX3 A;  1LGT A;  4KYK A;  1JVG A;  1MP5 A;  3CGX A;  4NVS A;  3N9W A;  1TSJ A;  1TZF A;  3SXE A;  1ZI5 A;  3I0E A;  1JC4 A;  3FCD A;  1FXO A;  1JV1 A;  3HDP A;  3CT8 A;  5BXC A;  1HM8 A;  1JIF A;  5EC3 A;  1NQI B;  3CKV A;  1FWY A;  1H7Q A;  3HNQ A;  3BZA A;  5I1F A;  1KW9 B;  1SQI A;  1ON8 A;  5FU0 A;  1JIE A;  2Y7A A;  2AGD A;  1FRO A;  2QH0 A;  1R81 A;  4ECM A;  2ZA0 A;  4Z6V A;  4BQH A;  1GX4 A;  3GM5 A;  4C2S A;  4GHG A;  5J49 A;  1FGX A;  2RJ8 A;  2OI7 A;  4MIX A;  4X2A A;  3R3I A;  3ZW5 A;  1EYR A;  2EI3 A;  3HQ0 A;  1DHY A;  2AH9 A;  4B2W A;  4LQB A;  4Y63 A;  4B4M A;  4CJ8 A;  4FRO A;  5CQL X;  4Z6T A;  2CU2 A;  2X5Z A;  3DJ4 A;  1VGZ A;  5C36 A;  1LL2 A;  3FWW A;  1R7X A;  3SX5 A;  1H5S B;  2EHZ A;  3BQX A;  1TFZ A;  3I0G A;  1Q0C A;  3ZI1 A;  1QGQ A;  4CJB A;  5IDS A;  3TZT A;  3PKW A;  2RK9 A;  1VZU A;  2WVM A;  1KMY A;  3CKJ A;  3T7O A;  2OI5 A;  2V0H A;  4FRQ A;  4QB5 A;  4KPX A;  5C6X A;  1MC3 A;  3GUE A;  2P6W A;  1H5S A;  3FOQ A;  3Q4S A;  1MH6 A;  3OXH A;  5CMF X;  5C4C A;  1FA7 A;  1F1V A;  1S4N A;  1VGU A;  3QVB A;  1ZI4 A;  1TWU A;  4B3U A;  5HS2 A;  5FV9 A;  5CB9 A;  1JYK A;  1LZI A;  3E26 A;  4B4B A;  5FUH A;  2W0W A;  3CKO A;  3OH2 A;  4E1K A;  4MYB A;  4FIX A;  3OH4 A;  1IIN A;  1R7V A;  5BWG A;  3K8D A;  2ICY A;  2W0V A;  5FU8 A;  3G12 A;  2XMH A;  1SP8 A;  2RIZ A;  3OC9 A;  4LW3 A;  3RMW A;  3F1C A;  3IUZ A;  2EI0 A;  1GQC A;  4Y6U A;  1SS4 A;  4M28 A;  5DFG A;  1YP2 A;  1ZI1 A;  4EEG A;  4D11 A;  2QNT A;  1TW1 A;  4HO3 A;  2E3D A;  1SP9 A;  1H4E A;  3BCV A;  3HL3 A;  3L20 A;  4Z6O A;  3ST8 A;  2WGZ A;  2P7K A;  1FA6 A;  4EE5 A;  1QIN A;  4HC5 A;  5DDV A;  3R6A A;  1ECS A;  3OGZ A;  4ASJ A;  1FA8 A;  2QQZ A;  1JC5 A;  3SX8 A;  2PGV A;  1OMX A;  2BO4 A;  3OH1 A;  4M2B A;  2BO7 A;  4Y7G A;  1NMM B;  1HAN A;  2A8U A;  4JH1 A;  4JH3 A;  1ZIZ A;  3T7N A;  2ZW7 A;  3D5N A;  1HM9 A;  1FR8 A;  2IG9 A; 
#chains in the Genus database with same CATH homology
 5IFY A;  4NAI A;  4P02 A;  1LZ0 A;  2VD4 A;  4G3Q A;  4HO0 A;  4KRV A;  5EIY A;  2X60 A;  1O0R A;  2WE9 A;  1FG5 N;  1S4O A;  3U2U A;  1XHB A;  5L6S A;  3I0F A;  4P00 A;  2ZU9 A;  3F1Y A;  5C38 A;  1LZJ A;  5C48 A;  2WVK A;  1OMZ A;  2VK9 A;  2I5E A;  3SXC A;  1NHE B;  1H7H A;  1MP4 A;  3Q80 A;  3I0D A;  4G3P A;  2VS3 A;  2FFU A;  4HOC A;  3DUV A;  5C4F A;  2YES A;  2JCO A;  1ZDF A;  4FRE A;  5FTS A;  2JCK A;  1VGT A;  3I0K A;  3PKP A;  3CKQ A;  1O7O A;  2V0K A;  1G1L A;  2Z87 A;  4EEM A;  5C3A A;  3R2W A;  1WT3 A;  4DDZ A;  3V0M A;  1ON6 A;  2VXL A;  3SXD A;  1GX0 A;  4EVW A;  1FZW A;  4NAK A;  2GGQ A;  3USQ A;  4ASY A;  4KNR A;  1H7E A;  1GWW A;  1G0R A;  1K4V A;  2OEG A;  2XWL A;  1MP3 A;  1WT0 A;  1H5T A;  1LL3 A;  5C4D A;  1ZJ3 A;  2AM3 A;  4KNX A;  1FO9 A;  3SXA A;  1ZCT A;  4Y6N A;  4YS8 A;  4DEC A;  1WVC A;  4J18 A;  4XWI A;  3ZGF A;  1HV9 A;  3E25 A;  3U2V A;  1LL0 A;  2RIY A;  2V0J A;  1ZDG A;  2ZU7 A;  2RJ0 A;  3IOJ A;  3POL A;  4O6N A;  4D0T A;  3Q7U A;  5EJ1 A;  1JYL A;  2AE7 A;  3V0O A;  2VSI A;  5DDT A;  1FRW A;  1V83 A;  1JV3 A;  5FYE A;  1H4D A;  2E8B A;  3I0C A;  4D48 A;  1QWJ A;  4EEA A;  2APC A;  1GQ9 A;  2Z86 A;  2Y4K A;  5C49 A;  1O7Q A;  2V0I A;  4FRA A;  4Y9X A;  1INJ A;  1G3L A;  2O1H A;  3ZLL A;  2DPW A;  4HO4 A;  3O3P A;  4KC4 A;  2YQS A;  3V0L A;  1HM0 A;  1OQM B;  2RJ5 A;  4FCE A;  1E5K A;  3OH3 A;  2V0L A;  2J0A A;  2FYC B;  2FYB A;  2YQJ A;  4LW6 A;  4B5B A;  1ZJO A;  2Y4L A;  1W57 A;  3D8V A;  2YC3 A;  4O6M A;  3D98 A;  4FQW A;  2XWN A;  5CMJ A;  1ZJ1 A;  1GA8 A;  5CMG X;  2YQH A;  2D0J A;  2NXV A;  2VS5 A;  1H5S D;  2ZU8 A;  2OI6 A;  1SS9 A;  3IOH A;  3PNN A;  4HO2 A;  3EE5 A;  3T7M A;  3I0I X;  2X65 A;  5C1H A;  5AJO A;  1S4P A;  4ARW A;  3U0Y A;  4B42 A;  3V90 A;  3V0P A;  5C3D A;  1INI A;  1G23 A;  1R82 A;  1O23 B;  1H3M A;  2UX8 A;  5FTV A;  4UEG A;  4FRD A;  4Y7V A;  4G87 A;  5D91 A;  1H7L A;  2VFZ A;  1VH3 A;  2RJ4 A;  4HO5 A;  3U2T A;  2FFV A;  2Y4M A;  3PKQ A;  4EEO A;  4Y7U A;  4Y7T A;  4EE3 A;  2VS4 A;  3JTJ A;  3JUK A;  4GBP A;  1G2V A;  5C1G A;  5IDT A;  1TW5 A;  2RJ9 A;  1ZCU A;  5CMH A;  3V8Z A;  5C8R A;  2FYA A;  2D7R A;  2I5K A;  1VGW A;  4KT7 A;  5CQM X;  1NKH B;  4CVH A;  3SXG A;  1FO8 A;  4FIY A;  3CU0 A;  1FGG A;  4HO8 A;  3RMV A;  2ICX A;  2JCJ A;  2PA4 A;  1H5T B;  2WEE A;  4AC3 A;  1XZ6 A;  2QKX A;  3OKR A;  2Y4J A;  3V0Q A;  1H4C A;  2VSH A;  1R7Y A;  2P72 A;  4FRL A;  3U0X A;  2YC5 A;  4FCU A;  2QGI A;  1HJL A;  1V82 A;  2XWM A;  1VPA A;  3KIA A;  1FOA A;  2BO8 A;  4FRP A;  1V84 A;  2WAW A;  1YP4 A;  4AYL A;  1G8O A;  2X5S A;  3OAM A;  2O1F A;  5CQO A;  4AAW A;  1ZCV A;  3V0N A;  3V8Y A;  2FYD B;  1W77 A;  2JCL A;  1PZY B;  2PGY A;  4JD0 A;  5C4B A;  1H5S C;  1EZI A;  1YP3 A;  1WSZ A;  5AJN A;  5C47 A;  4Q7C A;  4Y62 A;  1VIC A;  1H7T A;  1ZJ0 A;  2Y6P A;  1H7F A;  3NGW A;  2FY7 A;  5CQN X;  5L6V A;  2RIX A;  1G9R A;  3SX7 A;  1H5R B;  4G3S A;  3V91 A;  4AYJ A;  1ZJP A;  1W55 A;  2AM5 A;  2YQC A;  4D11 C;  1FR9 A;  4KQL A;  4IRP A;  3IOI A;  1WT2 A;  2MZB A;  1PZT A;  3CKN A;  1H5R A;  4ZDQ A;  4NAN A;  1HJJ A;  2AEC A;  2WVL A;  2XME A;  3I0H A;  2P73 A;  3I0L A;  1YRO B;  2BO6 A;  3K8E A;  1WT1 A;  4DE7 A;  4HO9 A;  2AES A;  1VH1 A;  1GWV A;  2C0N A;  1KWS A;  2YCM A;  1QG8 A;  2O1G A;  3SXB A;  5C1L A;  4KC2 A;  1G93 A;  2A8W A;  5CQP A;  3ZLK A;  1R80 A;  2J0B A;  5EJZ A;  1G97 A;  1R7T A;  3LW6 A;  1VZT A;  4FRH A;  1FXJ A;  3TQD A;  5D92 A;  4IRQ A;  4Y64 A;  4KPZ A;  4HCQ A;  4MND A;  3ZF8 A;  2D7I A;  1VM8 A;  2Q4J A;  4NAL A;  4FRM A;  3U2W A;  1ZCY A;  3BRK X;  1VZX A;  4KC1 A;  4K6R A;  1R7U A;  1IIM A;  3DK5 A;  1I52 A;  4HG6 A;  3OH0 A;  2I7B A;  4D0Z A;  4BMA A;  3ZGG A;  4L41 C;  4R7P A;  2VXM A;  4B4G A;  2RJ1 A;  1H7G A;  1ZI3 A;  1JVD A;  2RIT A;  1NWG B;  1LZ7 A;  1ZJ2 A;  2AM4 A;  1LVW A;  2RJ7 A;  3RSB A;  2QH5 A;  3I0J A;  4KXO A;  4FRB A;  1ZHJ A;  1NF5 B;  2RJ6 A;  4HO6 A;  4Y7F A;  5JQQ A;  3USR A;  4B2X A;  4EE4 A;  1G95 A;  4CJC A;  1QGS A;  3JUJ A;  3SPT A;  5C3B A;  4JIS A;  1TVY A;  2OEF A;  5AJP A;  1Z90 A;  4M4K A;  2GGO A;  2PX7 A;  4M2A A;  5CMI A;  3U2X A;  5C4E A;  3SX3 A;  1JVG A;  1MP5 A;  3CGX A;  3N9W A;  1TZF A;  3SXE A;  1ZI5 A;  3I0E A;  1FXO A;  1JV1 A;  5BXC A;  1HM8 A;  1NQI B;  3CKV A;  1FWY A;  1H7Q A;  5I1F A;  1ON8 A;  5FU0 A;  2Y7A A;  2AGD A;  1R81 A;  4ECM A;  4BQH A;  1GX4 A;  5J49 A;  4C2S A;  1FGX A;  2RJ8 A;  2OI7 A;  4MIX A;  3R3I A;  1EYR A;  2AH9 A;  4B4M A;  4B2W A;  4Y63 A;  4CJ8 A;  4FRO A;  5CQL X;  2CU2 A;  5C36 A;  2X5Z A;  3DJ4 A;  1VGZ A;  1LL2 A;  3FWW A;  1R7X A;  3SX5 A;  1H5S B;  3I0G A;  1QGQ A;  4CJB A;  5IDS A;  3TZT A;  2WVM A;  1VZU A;  3CKJ A;  3T7O A;  2OI5 A;  2V0H A;  4FRQ A;  4KPX A;  1MC3 A;  3Q4S A;  3GUE A;  2P6W A;  1H5S A;  3FOQ A;  5CMF X;  5C4C A;  1S4N A;  1VGU A;  3QVB A;  1ZI4 A;  4B3U A;  5HS2 A;  5FV9 A;  1JYK A;  1LZI A;  3E26 A;  4B4B A;  5FUH A;  2W0W A;  3CKO A;  3OH2 A;  4E1K A;  4MYB A;  4FIX A;  3OH4 A;  1IIN A;  1R7V A;  3K8D A;  2ICY A;  2W0V A;  5FU8 A;  2XMH A;  2RIZ A;  3OC9 A;  4LW3 A;  3RMW A;  3F1C A;  1GQC A;  4Y6U A;  4M28 A;  1ZI1 A;  1YP2 A;  4EEG A;  4D11 A;  1TW1 A;  4HO3 A;  2E3D A;  1H4E A;  3BCV A;  3HL3 A;  3ST8 A;  2WGZ A;  4EE5 A;  5DDV A;  3OGZ A;  4ASJ A;  3SX8 A;  2PGV A;  1OMX A;  2BO4 A;  3OH1 A;  4M2B A;  2BO7 A;  4Y7G A;  1NMM B;  2A8U A;  1ZIZ A;  3T7N A;  3D5N A;  1HM9 A;  1FR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...