4AYJA

Molecular structure of a metal-independent bacterial glycosyltransferase that catalyzes the synthesis of histo-blood group a antigen
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
231
structure length
231
Chain Sequence
MRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDESLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BOGT - METAL-INDEPENDENT GLYCOSYLTRANSFERASE
publication title Structure of a Metal-Independent Bacterial Glycosyltransferase that Catalyzes the Synthesis of Histo-Blood Group a Antigen
pubmed doi rcsb
source organism Bacteroides ovatus
total genus 74
structure length 231
sequence length 231
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4ayjA00
3CKNA 3I0JA 4Y9XA 4BMAA 4DECA 2V0IA 2GGOA 2AESA 2VS4A 2PGVA 2QH5A 3OH0A 1H4CA 3SX3A 1JYKA 1ZI1A 3CKJA 1ZHJA 1GQCA 2VS3A 3Q7UA 4ASJA 1FXJA 4B5BA 1IIMA 3RMWA 1YP4A 1GA8A 5C49A 1S4PA 2O1FA 4M2BA 1LL3A 1R7TA 2P72A 2XWMA 3CU0A 5FV9A 4LW6A 2MZBA 3F1YA 1VZUA 2FYAA 1NKHB 2XMHA 2D7RA 4CJ8A 2Y4JA 2Z86A 3ST8A 1GX4A 2AECA 5EIYA 2RIYA 1VZXA 3D5NA 5CMHA 1FWYA 1WT3A 2YC3A 2JCLA 3I0DA 1FGGA 1H5RB 1W77A 1NQIB 4JISA 3O3PA 3U2TA 3T7OA 2O1HA 1XHBA 5L6VA 4L41C 2PX7A 2WVKA 1FG5N 1G95A 2X5SA 3PKQA 3OC9A 4NANA 1O7QA 3NGWA 1MP5A 2ICXA 4Y7UA 4FRDA 2ICYA 2GGQA 3U2UA 3OH2A 3ZLLA 4J18A 2ZU8A 5CQNX 1O23B 5FU8A 2FFUA 4Y7FA 5C36A 1TW1A 5C8RA 5FU0A 5CQOA 5C38A 2I7BA 4G3PA 5DDVA 1VGTA 4M2AA 3SXDA 2Q4JA 4D0TA 5JQQA 4Y6UA 2BO8A 1ZDGA 2FYDB 2I5EA 4G3QA 4HO2A 4P00A 1TZFA 1ZJOA 4B3UA 3K8EA 1MP3A 1R7XA 1R82A 4G87A 3N9WA 2WE9A 4FREA 1VICA 2W0VA 1JYLA 3Q4SA 2BO6A 2VXLA 2PGYA 3JTJA 5CQLX 5I1FA 4HO0A 4KPXA 5C48A 1V83A 4D0ZA 1VPAA 2AM3A 3U2WA 1JV1A 5CMFX 5DDTA 3DUVA 4FRQA 1H7EA 2WGZA 4NAIA 1WVCA 4R7PA 4KNXA 1ZJ2A 2X60A 4CJCA 3GUEA 1ZJPA 5C3AA 3SXEA 3R3IA 2WAWA 1R7UA 5C1HA 1GQ9A 3V0MA 3SXGA 3V0OA 4DDZA 3SX7A 4Y64A 5C3BA 2YESA 4Y63A 2A8WA 5C4BA 2QGIA 4AYLA 2UX8A 1JVDA 4D11C 1G9RA 4FCUA 1SS9A 3I0EA 2X5ZA 4HO5A 3OH1A 4UEGA 5C4CA 3TZTA 1FR8A 4FRBA 2XWLA 1H4EA 5IFYA 2XWNA 4EEGA 1QWJA 2WEEA 1FRWA 2P6WA 1ZCUA 4KXOA 5J49A 3HL3A 5FYEA 3OH4A 4KRVA 1WT1A 2RITA 5C4FA 4Y7VA 1ZCYA 4AC3A 4B2WA 2PA4A 5AJOA 5C3DA 5L6SA 1INJA 1ON6A 1R80A 4HO6A 4B42A 2W0WA 3I0GA 3D8VA 3OH3A 2JCJA 3BRKX 3ZLKA 2RJ9A 3F1CA 3K8DA 1FR9A 4EEMA 4HO8A 2OI5A 2VSHA 1WSZA 1WT0A 2OEFA 3CGXA 3V0NA 1LL2A 1NF5B 3Q80A 1H5SC 3SPTA 5EJ1A 1V84A 3I0IX 4D48A 2AM5A 4MYBA 4FRMA 1H7QA 2YQCA 3ZF8A 2I5KA 1FGXA 1VGUA 1IINA 2E8BA 5CMJA 4DE7A 4K6RA 4Y7GA 4EE5A 2AGDA 3FWWA 4KQLA 3ZGGA 1ZJ3A 4KPZA 2D7IA 1QG8A 2VXMA 1O0RA 3SX8A 2BO4A 1G1LA 1HM0A 1VZTA 3CKVA 3R2WA 4FCEA 4G3SA 1ZI4A 1EYRA 4IRQA 1YP3A 4AYJA 1JV3A 1ZCTA 2NXVA 5HS2A 5CQMX 2V0HA 2DPWA 4HOCA 5CQPA 1S4OA 2CU2A 3D98A 1E5KA 5BXCA 5FTSA 2VS5A 1JVGA 2D0JA 4KNRA 1QGQA 1H5TB 1W55A 4HCQA 4EEOA 3DK5A 4KC4A 1LZ7A 1G8OA 1G97A 1H7TA 4MNDA 4ECMA 1LL0A 5AJPA 1NHEB 3V90A 5EJZA 4IRPA 3T7NA 4EE3A 4NAKA 3PKPA 1FO8A 2E3DA 4YS8A 2FY7A 3OGZA 4M4KA 4XWIA 2WVLA 3V0PA 2FFVA 1H7HA 3I0FA 1Z90A 2RJ5A 1HV9A 4EE4A 4FQWA 2OEGA 1H4DA 3USQA 1ZJ1A 3USRA 4AAWA 5FUHA 4D11A 3I0HA 4ZDQA 5CMGX 2RIXA 4Y6NA 1INIA 1G0RA 1H5SD 1VH1A 1ZDFA 4FROA 5C47A 1R7VA 3SXCA 1HM9A 2Y6PA 1PZTA 3SXAA 1XZ6A 2YC5A 5AJNA 3V8ZA 1MP4A 1KWSA 4EEAA 2WVMA 1MC3A 3IOIA 2RJ0A 1H5TA 1GWWA 1FZWA 4NALA 2XMEA 2ZU7A 1ZI5A 2VFZA 1GWVA 3CKQA 1ZIZA 1K4VA 2RJ7A 3KIAA 2FYBA 1QGSA 4M28A 4Y62A 3ZGFA 2Y4LA 1ZJ0A 2OI6A 3EE5A 1VM8A 3BCVA 2RJ1A 1GX0A 2BO7A 4B4GA 4HO9A 5C4EA 3U2XA 1LZJA 5CMIA 2V0KA 2RJ4A 1FO9A 1FXOA 1VGZA 4FRHA 2VSIA 1OQMB 3PNNA 4B4BA 4EVWA 1YROB 1R81A 5IDTA 1TW5A 1G23A 1EZIA 4HO4A 4GBPA 2Y4KA 2YCMA 4B2XA 4CVHA 1LVWA 3I0CA 1H5SA 3IOJA 2O1GA 2ZU9A 4B4MA 2Z87A 2AE7A 4LW3A 5C1GA 3I0LA 4E1KA 4ARWA 5C1LA 3RMVA 3U0XA 2JCOA 1NWGB 1TVYA 2FYCB 1FOAA 3SXBA 5C4DA 1H3MA 3JUJA 3SX5A 1R7YA 3JUKA 1ON8A 1NMMB 4C2SA 4JD0A 1H7FA 1I52A 1ZCVA 1G93A 1HJLA 1VH3A 2AM4A 2VD4A 4Y7TA 1H7GA 1HM8A 2P73A 3V91A 1LZ0A 3RSBA 1PZYB 1S4NA 4FRAA 2YQJA 2YQHA 2V0LA 1V82A 4CJBA 4KT7A 4FRPA 3FOQA 2OI7A 1YP2A 1HJJA 2V0JA 3POLA 4ASYA 3OKRA 1G2VA 3LW6A 3V0QA 1LZIA 2Y7AA 1WT2A 4KC2A 3V0LA 1G3LA 2RJ6A 2YQSA 1OMZA 2QKXA 4HO3A 3CKOA 3QVBA 2JCKA 1O7OA 4BQHA 3V8YA 2APCA 4HG6A 5IDSA 3T7MA 1H5SB 1H5RA 1VGWA 1ZI3A 1W57A 4P02A 2RIZA 3U0YA 2RJ8A 5FTVA 3U2VA 1OMXA 2AH9A 4FRLA 3E26A 3TQDA 2X65A 3I0KA 3IOHA 1H7LA 2A8UA 3DJ4A 3OAMA 2Y4MA 3E25A 4KC1A
chains in the Genus database with same CATH superfamily
3CKNA 3I0JA 4Y9XA 4BMAA 4DECA 2V0IA 4Q7CA 2GGOA 2AESA 2VS4A 2PGVA 2QH5A 3OH0A 1H4CA 3SX3A 1JYKA 1ZI1A 3CKJA 1ZHJA 1GQCA 2VS3A 3Q7UA 4ASJA 1FXJA 4B5BA 1IIMA 3RMWA 1YP4A 1GA8A 5C49A 1S4PA 2O1FA 4M2BA 1LL3A 1R7TA 2P72A 2XWMA 3CU0A 5FV9A 4LW6A 2MZBA 3F1YA 1VZUA 4FIYA 2FYAA 1NKHB 2XMHA 2D7RA 4CJ8A 2Y4JA 2Z86A 3ST8A 1GX4A 2AECA 5EIYA 2RIYA 1VZXA 3D5NA 5CMHA 1FWYA 1WT3A 2YC3A 2JCLA 3I0DA 1FGGA 1H5RB 1W77A 1NQIB 4JISA 3O3PA 3U2TA 3T7OA 2O1HA 1XHBA 5L6VA 4L41C 2PX7A 2WVKA 1FG5N 1G95A 2X5SA 3PKQA 3OC9A 2J0BA 1O7QA 3NGWA 4NANA 1MP5A 2ICXA 4Y7UA 4FRDA 2ICYA 2GGQA 3U2UA 3OH2A 3ZLLA 5D91A 4J18A 2ZU8A 5CQNX 1O23B 5FU8A 2FFUA 4Y7FA 5C36A 1TW1A 5C8RA 5FU0A 5CQOA 5C38A 2I7BA 4G3PA 5DDVA 1VGTA 4M2AA 3SXDA 2Q4JA 4D0TA 5JQQA 4Y6UA 2BO8A 1ZDGA 2FYDB 2I5EA 4G3QA 4HO2A 4P00A 1TZFA 1ZJOA 4B3UA 3K8EA 1MP3A 1R7XA 1R82A 4G87A 3N9WA 2WE9A 4FREA 1VICA 2W0VA 1JYLA 3Q4SA 2BO6A 2VXLA 2PGYA 3JTJA 5CQLX 5I1FA 4HO0A 4KPXA 5C48A 1V83A 4D0ZA 1VPAA 2AM3A 3U2WA 1JV1A 5CMFX 5DDTA 3DUVA 4FRQA 1H7EA 2WGZA 4NAIA 1WVCA 4R7PA 4KNXA 1ZJ2A 2X60A 4CJCA 3GUEA 1ZJPA 5C3AA 3SXEA 3R3IA 2WAWA 1R7UA 5C1HA 1GQ9A 3V0MA 3SXGA 3V0OA 4DDZA 3SX7A 4Y64A 5C3BA 2YESA 4Y63A 2A8WA 5C4BA 2QGIA 4AYLA 2UX8A 1JVDA 4D11C 1G9RA 4FCUA 1SS9A 3I0EA 2X5ZA 4HO5A 3OH1A 4UEGA 5C4CA 3TZTA 1FR8A 4FRBA 2XWLA 1H4EA 5IFYA 2XWNA 4EEGA 1QWJA 2WEEA 1FRWA 2P6WA 1ZCUA 4KXOA 5J49A 3HL3A 5FYEA 3OH4A 4KRVA 2RITA 1WT1A 5C4FA 4Y7VA 1ZCYA 4AC3A 4B2WA 2PA4A 5AJOA 5C3DA 5L6SA 1INJA 1ON6A 1R80A 4HO6A 4B42A 2W0WA 3I0GA 2C0NA 3D8VA 3OH3A 2JCJA 3BRKX 3ZLKA 2RJ9A 3F1CA 3K8DA 1FR9A 4EEMA 4HO8A 2OI5A 2VSHA 1WSZA 1WT0A 2OEFA 3CGXA 3V0NA 1LL2A 1NF5B 3Q80A 1H5SC 3SPTA 5EJ1A 1V84A 3I0IX 4D48A 2AM5A 4MYBA 4FRMA 1H7QA 2YQCA 3ZF8A 2I5KA 1FGXA 1VGUA 1IINA 2E8BA 5CMJA 4DE7A 4K6RA 4Y7GA 4EE5A 2AGDA 3FWWA 4KQLA 3ZGGA 1ZJ3A 4KPZA 2D7IA 1QG8A 2VXMA 1O0RA 4O6MA 3SX8A 2BO4A 1G1LA 1HM0A 1VZTA 3CKVA 3R2WA 4FCEA 4G3SA 1ZI4A 1EYRA 4IRQA 1YP3A 4AYJA 1JV3A 1ZCTA 2NXVA 5HS2A 5CQMX 2V0HA 2DPWA 4HOCA 5CQPA 1S4OA 2CU2A 3D98A 1E5KA 5BXCA 5FTSA 2VS5A 1JVGA 2D0JA 4KNRA 1QGQA 1H5TB 1W55A 2J0AA 4HCQA 4EEOA 3DK5A 4MIXA 4KC4A 1LZ7A 1G8OA 1G97A 1H7TA 4MNDA 4ECMA 1LL0A 5AJPA 1NHEB 3V90A 5EJZA 4IRPA 3T7NA 4EE3A 4NAKA 3PKPA 1FO8A 2E3DA 4YS8A 2FY7A 3OGZA 4M4KA 4XWIA 2WVLA 3V0PA 2FFVA 1H7HA 3I0FA 1Z90A 2RJ5A 1HV9A 4EE4A 4FQWA 2OEGA 1H4DA 3USQA 4O6NA 1ZJ1A 3USRA 4AAWA 5FUHA 4D11A 3I0HA 4ZDQA 2VK9A 5CMGX 2RIXA 4Y6NA 1INIA 1G0RA 1H5SD 1VH1A 1ZDFA 4FROA 5C47A 1R7VA 3SXCA 1HM9A 2Y6PA 1PZTA 3SXAA 1XZ6A 2YC5A 5AJNA 3V8ZA 1MP4A 1KWSA 4EEAA 2WVMA 1MC3A 3IOIA 2RJ0A 1H5TA 1GWWA 1FZWA 4NALA 2XMEA 2ZU7A 1ZI5A 2VFZA 1GWVA 3CKQA 1ZIZA 1K4VA 2RJ7A 3KIAA 2FYBA 1QGSA 4M28A 4Y62A 3ZGFA 2Y4LA 1ZJ0A 2OI6A 3EE5A 1VM8A 3BCVA 2RJ1A 1GX0A 2BO7A 4B4GA 4HO9A 5C4EA 3U2XA 1LZJA 5CMIA 2V0KA 2RJ4A 1FO9A 1FXOA 1VGZA 5D92A 4FRHA 2VSIA 1OQMB 3PNNA 4B4BA 4EVWA 1YROB 1R81A 5IDTA 1TW5A 1G23A 1EZIA 4HO4A 4GBPA 2Y4KA 2YCMA 4B2XA 4CVHA 1LVWA 3I0CA 1H5SA 3IOJA 2O1GA 2ZU9A 4B4MA 2Z87A 2AE7A 4LW3A 5C1GA 3I0LA 4E1KA 4ARWA 5C1LA 3RMVA 3U0XA 2JCOA 1NWGB 1TVYA 2FYCB 1FOAA 3SXBA 5C4DA 1H3MA 3JUJA 3SX5A 1R7YA 3JUKA 1ON8A 1NMMB 4C2SA 4JD0A 1H7FA 1I52A 1ZCVA 1G93A 1HJLA 1VH3A 2AM4A 2VD4A 4Y7TA 1H7GA 1HM8A 2P73A 3V91A 1LZ0A 3RSBA 1PZYB 1S4NA 4FRAA 2YQJA 2YQHA 2V0LA 1V82A 4CJBA 4KT7A 4FIXA 4FRPA 3FOQA 2OI7A 1YP2A 1HJJA 2V0JA 3POLA 4ASYA 3OKRA 1G2VA 3LW6A 3V0QA 1LZIA 2Y7AA 1WT2A 4KC2A 3V0LA 1G3LA 2RJ6A 2YQSA 1OMZA 2QKXA 4HO3A 3CKOA 3QVBA 2JCKA 1O7OA 4BQHA 3V8YA 2APCA 4HG6A 5IDSA 3T7MA 1H5SB 1H5RA 1VGWA 1ZI3A 1W57A 4P02A 2RIZA 3U0YA 2RJ8A 5FTVA 3U2VA 1OMXA 2AH9A 4FRLA 3E26A 3TQDA 2X65A 3I0KA 3IOHA 1H7LA 2A8UA 3DJ4A 3OAMA 2Y4MA 3E25A 4KC1A
chains in the Genus database with same CATH topology
3CKNA 3I0JA 4Y9XA 4BMAA 4DECA 2V0IA 4Q7CA 2GGOA 2AESA 2VS4A 2PGVA 2QH5A 3OH0A 1H4CA 3SX3A 1JYKA 1ZI1A 3CKJA 1ZHJA 1GQCA 2VS3A 3Q7UA 4ASJA 1FXJA 4B5BA 1IIMA 3RMWA 1YP4A 1GA8A 5C49A 1S4PA 2O1FA 4M2BA 1LL3A 1R7TA 2P72A 2XWMA 3CU0A 5FV9A 4LW6A 2MZBA 3F1YA 1VZUA 4FIYA 2FYAA 1NKHB 2XMHA 2D7RA 4CJ8A 2Y4JA 2Z86A 3ST8A 1GX4A 2AECA 5EIYA 2RIYA 1VZXA 3D5NA 5CMHA 1FWYA 1WT3A 2YC3A 2JCLA 3I0DA 1FGGA 1H5RB 1W77A 1NQIB 4JISA 3O3PA 3U2TA 3T7OA 2O1HA 1XHBA 5L6VA 4L41C 2PX7A 2WVKA 1FG5N 1G95A 2X5SA 3PKQA 3OC9A 2J0BA 1O7QA 3NGWA 4NANA 1MP5A 2ICXA 4Y7UA 4FRDA 2ICYA 2GGQA 3U2UA 3OH2A 3ZLLA 5D91A 4J18A 2ZU8A 5CQNX 1O23B 5FU8A 2FFUA 4Y7FA 5C36A 1TW1A 5C8RA 5FU0A 5CQOA 5C38A 2I7BA 4G3PA 5DDVA 1VGTA 4M2AA 3SXDA 2Q4JA 4D0TA 5JQQA 4Y6UA 2BO8A 1ZDGA 2FYDB 2I5EA 4G3QA 4HO2A 4P00A 1TZFA 1ZJOA 4B3UA 3K8EA 1MP3A 1R7XA 1R82A 4G87A 3N9WA 2WE9A 4FREA 1VICA 2W0VA 1JYLA 3Q4SA 2BO6A 2VXLA 2PGYA 3JTJA 5CQLX 5I1FA 4HO0A 4KPXA 5C48A 1V83A 4D0ZA 1VPAA 2AM3A 3U2WA 1JV1A 5CMFX 5DDTA 3DUVA 4FRQA 1H7EA 2WGZA 4NAIA 1WVCA 4R7PA 4KNXA 1ZJ2A 2X60A 4CJCA 3GUEA 1ZJPA 5C3AA 3SXEA 3R3IA 2WAWA 1R7UA 5C1HA 1GQ9A 3V0MA 3SXGA 3V0OA 4DDZA 3SX7A 4Y64A 5C3BA 2YESA 4Y63A 2A8WA 5C4BA 2QGIA 4AYLA 2UX8A 1JVDA 4D11C 1G9RA 4FCUA 1SS9A 3I0EA 2X5ZA 4HO5A 3OH1A 4UEGA 5C4CA 3TZTA 1FR8A 4FRBA 2XWLA 1H4EA 5IFYA 2XWNA 4EEGA 1QWJA 2WEEA 1FRWA 2P6WA 1ZCUA 4KXOA 5J49A 3HL3A 5FYEA 3OH4A 4KRVA 2RITA 1WT1A 5C4FA 4Y7VA 1ZCYA 4AC3A 4B2WA 2PA4A 5AJOA 5C3DA 5L6SA 1INJA 1ON6A 1R80A 4HO6A 4B42A 2W0WA 3I0GA 2C0NA 3D8VA 3OH3A 2JCJA 3BRKX 3ZLKA 2RJ9A 3F1CA 3K8DA 1FR9A 4EEMA 4HO8A 2OI5A 2VSHA 1WSZA 1WT0A 2OEFA 3CGXA 3V0NA 1LL2A 1NF5B 3Q80A 1H5SC 3SPTA 5EJ1A 1V84A 3I0IX 4D48A 2AM5A 4MYBA 4FRMA 1H7QA 2YQCA 3ZF8A 2I5KA 1FGXA 1VGUA 1IINA 2E8BA 5CMJA 4DE7A 4K6RA 4Y7GA 4EE5A 2AGDA 3FWWA 4KQLA 3ZGGA 1ZJ3A 4KPZA 2D7IA 1QG8A 2VXMA 1O0RA 4O6MA 3SX8A 2BO4A 1G1LA 1HM0A 1VZTA 3CKVA 3R2WA 4FCEA 4G3SA 1ZI4A 1EYRA 4IRQA 1YP3A 4AYJA 1JV3A 1ZCTA 2NXVA 5HS2A 5CQMX 2V0HA 2DPWA 4HOCA 5CQPA 1S4OA 2CU2A 3D98A 1E5KA 5BXCA 5FTSA 2VS5A 1JVGA 2D0JA 4KNRA 1QGQA 1H5TB 1W55A 2J0AA 4HCQA 4EEOA 3DK5A 4MIXA 4KC4A 1LZ7A 1G8OA 1G97A 1H7TA 4MNDA 4ECMA 1LL0A 5AJPA 1NHEB 3V90A 5EJZA 4IRPA 3T7NA 4EE3A 4NAKA 3PKPA 1FO8A 2E3DA 4YS8A 2FY7A 3OGZA 4M4KA 4XWIA 2WVLA 3V0PA 2FFVA 1H7HA 3I0FA 1Z90A 2RJ5A 1HV9A 4EE4A 4FQWA 2OEGA 1H4DA 3USQA 4O6NA 1ZJ1A 3USRA 4AAWA 5FUHA 4D11A 3I0HA 4ZDQA 2VK9A 5CMGX 2RIXA 4Y6NA 1INIA 1G0RA 1H5SD 1VH1A 1ZDFA 4FROA 5C47A 1R7VA 3SXCA 1HM9A 2Y6PA 1PZTA 3SXAA 1XZ6A 2YC5A 5AJNA 3V8ZA 1MP4A 1KWSA 4EEAA 2WVMA 1MC3A 3IOIA 2RJ0A 1H5TA 1GWWA 1FZWA 4NALA 2XMEA 2ZU7A 1ZI5A 2VFZA 1GWVA 3CKQA 1ZIZA 1K4VA 2RJ7A 3KIAA 2FYBA 1QGSA 4M28A 4Y62A 3ZGFA 2Y4LA 1ZJ0A 2OI6A 3EE5A 1VM8A 3BCVA 2RJ1A 1GX0A 2BO7A 4B4GA 4HO9A 5C4EA 3U2XA 1LZJA 5CMIA 2V0KA 2RJ4A 1FO9A 1FXOA 1VGZA 5D92A 4FRHA 2VSIA 1OQMB 3PNNA 4B4BA 4EVWA 1YROB 1R81A 5IDTA 1TW5A 1G23A 1EZIA 4HO4A 4GBPA 2Y4KA 2YCMA 4B2XA 4CVHA 1LVWA 3I0CA 1H5SA 3IOJA 2O1GA 2ZU9A 4B4MA 2Z87A 2AE7A 4LW3A 5C1GA 3I0LA 4E1KA 4ARWA 5C1LA 3RMVA 3U0XA 2JCOA 1NWGB 1TVYA 2FYCB 1FOAA 3SXBA 5C4DA 1H3MA 3JUJA 3SX5A 1R7YA 3JUKA 1ON8A 1NMMB 4C2SA 4JD0A 1H7FA 1I52A 1ZCVA 1G93A 1HJLA 1VH3A 2AM4A 2VD4A 4Y7TA 1H7GA 1HM8A 2P73A 3V91A 1LZ0A 3RSBA 1PZYB 1S4NA 4FRAA 2YQJA 2YQHA 2V0LA 1V82A 4CJBA 4KT7A 4FIXA 4FRPA 3FOQA 2OI7A 1YP2A 1HJJA 2V0JA 3POLA 4ASYA 3OKRA 1G2VA 3LW6A 3V0QA 1LZIA 2Y7AA 1WT2A 4KC2A 3V0LA 1G3LA 2RJ6A 2YQSA 1OMZA 2QKXA 4HO3A 3CKOA 3QVBA 2JCKA 1O7OA 4BQHA 3V8YA 2APCA 4HG6A 5IDSA 3T7MA 1H5SB 1H5RA 1VGWA 1ZI3A 1W57A 4P02A 2RIZA 3U0YA 2RJ8A 5FTVA 3U2VA 1OMXA 2AH9A 4FRLA 3E26A 3TQDA 2X65A 3I0KA 3IOHA 1H7LA 2A8UA 3DJ4A 3OAMA 2Y4MA 3E25A 4KC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKN A;  3I0J A;  4Y9X A;  4BMA A;  4DEC A;  2V0I A;  2GGO A;  2AES A;  2VS4 A;  2PGV A;  2QH5 A;  3OH0 A;  1H4C A;  3SX3 A;  1JYK A;  1ZI1 A;  3CKJ A;  1ZHJ A;  1GQC A;  2VS3 A;  3Q7U A;  4ASJ A;  1FXJ A;  4B5B A;  1IIM A;  3RMW A;  1YP4 A;  1GA8 A;  5C49 A;  1S4P A;  2O1F A;  4M2B A;  1LL3 A;  1R7T A;  2P72 A;  2XWM A;  3CU0 A;  5FV9 A;  4LW6 A;  2MZB A;  3F1Y A;  1VZU A;  2FYA A;  1NKH B;  2XMH A;  2D7R A;  4CJ8 A;  2Y4J A;  2Z86 A;  3ST8 A;  1GX4 A;  2AEC A;  5EIY A;  2RIY A;  1VZX A;  3D5N A;  5CMH A;  1FWY A;  1WT3 A;  2YC3 A;  2JCL A;  3I0D A;  1FGG A;  1H5R B;  1W77 A;  1NQI B;  4JIS A;  3O3P A;  3U2T A;  3T7O A;  2O1H A;  1XHB A;  5L6V A;  4L41 C;  2PX7 A;  2WVK A;  1FG5 N;  1G95 A;  2X5S A;  3PKQ A;  3OC9 A;  4NAN A;  1O7Q A;  3NGW A;  1MP5 A;  2ICX A;  4Y7U A;  4FRD A;  2ICY A;  2GGQ A;  3U2U A;  3OH2 A;  3ZLL A;  4J18 A;  2ZU8 A;  5CQN X;  1O23 B;  5FU8 A;  2FFU A;  4Y7F A;  5C36 A;  1TW1 A;  5C8R A;  5FU0 A;  5CQO A;  5C38 A;  2I7B A;  4G3P A;  5DDV A;  1VGT A;  4M2A A;  3SXD A;  2Q4J A;  4D0T A;  5JQQ A;  4Y6U A;  2BO8 A;  1ZDG A;  2FYD B;  2I5E A;  4G3Q A;  4HO2 A;  4P00 A;  1TZF A;  1ZJO A;  4B3U A;  3K8E A;  1MP3 A;  1R7X A;  1R82 A;  4G87 A;  3N9W A;  2WE9 A;  4FRE A;  1VIC A;  2W0V A;  1JYL A;  3Q4S A;  2BO6 A;  2VXL A;  2PGY A;  3JTJ A;  5CQL X;  5I1F A;  4HO0 A;  4KPX A;  5C48 A;  1V83 A;  4D0Z A;  1VPA A;  2AM3 A;  3U2W A;  1JV1 A;  5CMF X;  5DDT A;  3DUV A;  4FRQ A;  1H7E A;  2WGZ A;  4NAI A;  1WVC A;  4R7P A;  4KNX A;  1ZJ2 A;  2X60 A;  4CJC A;  3GUE A;  1ZJP A;  5C3A A;  3SXE A;  3R3I A;  2WAW A;  1R7U A;  5C1H A;  1GQ9 A;  3V0M A;  3SXG A;  3V0O A;  4DDZ A;  3SX7 A;  4Y64 A;  5C3B A;  2YES A;  4Y63 A;  2A8W A;  5C4B A;  2QGI A;  4AYL A;  2UX8 A;  1JVD A;  4D11 C;  1G9R A;  4FCU A;  1SS9 A;  3I0E A;  2X5Z A;  4HO5 A;  3OH1 A;  4UEG A;  5C4C A;  3TZT A;  1FR8 A;  4FRB A;  2XWL A;  1H4E A;  5IFY A;  2XWN A;  4EEG A;  1QWJ A;  2WEE A;  1FRW A;  2P6W A;  1ZCU A;  4KXO A;  5J49 A;  3HL3 A;  5FYE A;  3OH4 A;  4KRV A;  1WT1 A;  2RIT A;  5C4F A;  4Y7V A;  1ZCY A;  4AC3 A;  4B2W A;  2PA4 A;  5AJO A;  5C3D A;  5L6S A;  1INJ A;  1ON6 A;  1R80 A;  4HO6 A;  4B42 A;  2W0W A;  3I0G A;  3D8V A;  3OH3 A;  2JCJ A;  3BRK X;  3ZLK A;  2RJ9 A;  3F1C A;  3K8D A;  1FR9 A;  4EEM A;  4HO8 A;  2OI5 A;  2VSH A;  1WSZ A;  1WT0 A;  2OEF A;  3CGX A;  3V0N A;  1LL2 A;  1NF5 B;  3Q80 A;  1H5S C;  3SPT A;  5EJ1 A;  1V84 A;  3I0I X;  4D48 A;  2AM5 A;  4MYB A;  4FRM A;  1H7Q A;  2YQC A;  3ZF8 A;  2I5K A;  1FGX A;  1VGU A;  1IIN A;  2E8B A;  5CMJ A;  4DE7 A;  4K6R A;  4Y7G A;  4EE5 A;  2AGD A;  3FWW A;  4KQL A;  3ZGG A;  1ZJ3 A;  4KPZ A;  2D7I A;  1QG8 A;  2VXM A;  1O0R A;  3SX8 A;  2BO4 A;  1G1L A;  1HM0 A;  1VZT A;  3CKV A;  3R2W A;  4FCE A;  4G3S A;  1ZI4 A;  1EYR A;  4IRQ A;  1YP3 A;  4AYJ A;  1JV3 A;  1ZCT A;  2NXV A;  5HS2 A;  5CQM X;  2V0H A;  2DPW A;  4HOC A;  5CQP A;  1S4O A;  2CU2 A;  3D98 A;  1E5K A;  5BXC A;  5FTS A;  2VS5 A;  1JVG A;  2D0J A;  4KNR A;  1QGQ A;  1H5T B;  1W55 A;  4HCQ A;  4EEO A;  3DK5 A;  4KC4 A;  1LZ7 A;  1G8O A;  1G97 A;  1H7T A;  4MND A;  4ECM A;  1LL0 A;  5AJP A;  1NHE B;  3V90 A;  5EJZ A;  4IRP A;  3T7N A;  4EE3 A;  4NAK A;  3PKP A;  1FO8 A;  2E3D A;  4YS8 A;  2FY7 A;  3OGZ A;  4M4K A;  4XWI A;  2WVL A;  3V0P A;  2FFV A;  1H7H A;  3I0F A;  1Z90 A;  2RJ5 A;  1HV9 A;  4EE4 A;  4FQW A;  2OEG A;  1H4D A;  3USQ A;  1ZJ1 A;  3USR A;  4AAW A;  5FUH A;  4D11 A;  3I0H A;  4ZDQ A;  5CMG X;  2RIX A;  4Y6N A;  1INI A;  1G0R A;  1H5S D;  1VH1 A;  1ZDF A;  4FRO A;  5C47 A;  1R7V A;  3SXC A;  1HM9 A;  2Y6P A;  1PZT A;  3SXA A;  1XZ6 A;  2YC5 A;  5AJN A;  3V8Z A;  1MP4 A;  1KWS A;  4EEA A;  2WVM A;  1MC3 A;  3IOI A;  2RJ0 A;  1H5T A;  1GWW A;  1FZW A;  4NAL A;  2XME A;  2ZU7 A;  1ZI5 A;  2VFZ A;  1GWV A;  3CKQ A;  1ZIZ A;  1K4V A;  2RJ7 A;  3KIA A;  2FYB A;  1QGS A;  4M28 A;  4Y62 A;  3ZGF A;  2Y4L A;  1ZJ0 A;  2OI6 A;  3EE5 A;  1VM8 A;  3BCV A;  2RJ1 A;  1GX0 A;  2BO7 A;  4B4G A;  4HO9 A;  5C4E A;  3U2X A;  1LZJ A;  5CMI A;  2V0K A;  2RJ4 A;  1FO9 A;  1FXO A;  1VGZ A;  4FRH A;  2VSI A;  1OQM B;  3PNN A;  4B4B A;  4EVW A;  1YRO B;  1R81 A;  5IDT A;  1TW5 A;  1G23 A;  1EZI A;  4HO4 A;  4GBP A;  2Y4K A;  2YCM A;  4B2X A;  4CVH A;  1LVW A;  3I0C A;  1H5S A;  3IOJ A;  2O1G A;  2ZU9 A;  4B4M A;  2Z87 A;  2AE7 A;  4LW3 A;  5C1G A;  3I0L A;  4E1K A;  4ARW A;  5C1L A;  3RMV A;  3U0X A;  2JCO A;  1NWG B;  1TVY A;  2FYC B;  1FOA A;  3SXB A;  5C4D A;  1H3M A;  3JUJ A;  3SX5 A;  1R7Y A;  3JUK A;  1ON8 A;  1NMM B;  4C2S A;  4JD0 A;  1H7F A;  1I52 A;  1ZCV A;  1G93 A;  1HJL A;  1VH3 A;  2AM4 A;  2VD4 A;  4Y7T A;  1H7G A;  1HM8 A;  2P73 A;  3V91 A;  1LZ0 A;  3RSB A;  1PZY B;  1S4N A;  4FRA A;  2YQJ A;  2YQH A;  2V0L A;  1V82 A;  4CJB A;  4KT7 A;  4FRP A;  3FOQ A;  2OI7 A;  1YP2 A;  1HJJ A;  2V0J A;  3POL A;  4ASY A;  3OKR A;  1G2V A;  3LW6 A;  3V0Q A;  1LZI A;  2Y7A A;  1WT2 A;  4KC2 A;  3V0L A;  1G3L A;  2RJ6 A;  2YQS A;  1OMZ A;  2QKX A;  4HO3 A;  3CKO A;  3QVB A;  2JCK A;  1O7O A;  4BQH A;  3V8Y A;  2APC A;  4HG6 A;  5IDS A;  3T7M A;  1H5S B;  1H5R A;  1VGW A;  1ZI3 A;  1W57 A;  4P02 A;  2RIZ A;  3U0Y A;  2RJ8 A;  5FTV A;  3U2V A;  1OMX A;  2AH9 A;  4FRL A;  3E26 A;  3TQD A;  2X65 A;  3I0K A;  3IOH A;  1H7L A;  2A8U A;  3DJ4 A;  3OAM A;  2Y4M A;  3E25 A;  4KC1 A; 
#chains in the Genus database with same CATH topology
 3CKN A;  3I0J A;  4Y9X A;  4BMA A;  4DEC A;  2V0I A;  4Q7C A;  2GGO A;  2AES A;  2VS4 A;  2PGV A;  2QH5 A;  3OH0 A;  1H4C A;  3SX3 A;  1JYK A;  1ZI1 A;  3CKJ A;  1ZHJ A;  1GQC A;  2VS3 A;  3Q7U A;  4ASJ A;  1FXJ A;  4B5B A;  1IIM A;  3RMW A;  1YP4 A;  1GA8 A;  5C49 A;  1S4P A;  2O1F A;  4M2B A;  1LL3 A;  1R7T A;  2P72 A;  2XWM A;  3CU0 A;  5FV9 A;  4LW6 A;  2MZB A;  3F1Y A;  1VZU A;  4FIY A;  2FYA A;  1NKH B;  2XMH A;  2D7R A;  4CJ8 A;  2Y4J A;  2Z86 A;  3ST8 A;  1GX4 A;  2AEC A;  5EIY A;  2RIY A;  1VZX A;  3D5N A;  5CMH A;  1FWY A;  1WT3 A;  2YC3 A;  2JCL A;  3I0D A;  1FGG A;  1H5R B;  1W77 A;  1NQI B;  4JIS A;  3O3P A;  3U2T A;  3T7O A;  2O1H A;  1XHB A;  5L6V A;  4L41 C;  2PX7 A;  2WVK A;  1FG5 N;  1G95 A;  2X5S A;  3PKQ A;  3OC9 A;  2J0B A;  1O7Q A;  3NGW A;  4NAN A;  1MP5 A;  2ICX A;  4Y7U A;  4FRD A;  2ICY A;  2GGQ A;  3U2U A;  3OH2 A;  3ZLL A;  5D91 A;  4J18 A;  2ZU8 A;  5CQN X;  1O23 B;  5FU8 A;  2FFU A;  4Y7F A;  5C36 A;  1TW1 A;  5C8R A;  5FU0 A;  5CQO A;  5C38 A;  2I7B A;  4G3P A;  5DDV A;  1VGT A;  4M2A A;  3SXD A;  2Q4J A;  4D0T A;  5JQQ A;  4Y6U A;  2BO8 A;  1ZDG A;  2FYD B;  2I5E A;  4G3Q A;  4HO2 A;  4P00 A;  1TZF A;  1ZJO A;  4B3U A;  3K8E A;  1MP3 A;  1R7X A;  1R82 A;  4G87 A;  3N9W A;  2WE9 A;  4FRE A;  1VIC A;  2W0V A;  1JYL A;  3Q4S A;  2BO6 A;  2VXL A;  2PGY A;  3JTJ A;  5CQL X;  5I1F A;  4HO0 A;  4KPX A;  5C48 A;  1V83 A;  4D0Z A;  1VPA A;  2AM3 A;  3U2W A;  1JV1 A;  5CMF X;  5DDT A;  3DUV A;  4FRQ A;  1H7E A;  2WGZ A;  4NAI A;  1WVC A;  4R7P A;  4KNX A;  1ZJ2 A;  2X60 A;  4CJC A;  3GUE A;  1ZJP A;  5C3A A;  3SXE A;  3R3I A;  2WAW A;  1R7U A;  5C1H A;  1GQ9 A;  3V0M A;  3SXG A;  3V0O A;  4DDZ A;  3SX7 A;  4Y64 A;  5C3B A;  2YES A;  4Y63 A;  2A8W A;  5C4B A;  2QGI A;  4AYL A;  2UX8 A;  1JVD A;  4D11 C;  1G9R A;  4FCU A;  1SS9 A;  3I0E A;  2X5Z A;  4HO5 A;  3OH1 A;  4UEG A;  5C4C A;  3TZT A;  1FR8 A;  4FRB A;  2XWL A;  1H4E A;  5IFY A;  2XWN A;  4EEG A;  1QWJ A;  2WEE A;  1FRW A;  2P6W A;  1ZCU A;  4KXO A;  5J49 A;  3HL3 A;  5FYE A;  3OH4 A;  4KRV A;  2RIT A;  1WT1 A;  5C4F A;  4Y7V A;  1ZCY A;  4AC3 A;  4B2W A;  2PA4 A;  5AJO A;  5C3D A;  5L6S A;  1INJ A;  1ON6 A;  1R80 A;  4HO6 A;  4B42 A;  2W0W A;  3I0G A;  2C0N A;  3D8V A;  3OH3 A;  2JCJ A;  3BRK X;  3ZLK A;  2RJ9 A;  3F1C A;  3K8D A;  1FR9 A;  4EEM A;  4HO8 A;  2OI5 A;  2VSH A;  1WSZ A;  1WT0 A;  2OEF A;  3CGX A;  3V0N A;  1LL2 A;  1NF5 B;  3Q80 A;  1H5S C;  3SPT A;  5EJ1 A;  1V84 A;  3I0I X;  4D48 A;  2AM5 A;  4MYB A;  4FRM A;  1H7Q A;  2YQC A;  3ZF8 A;  2I5K A;  1FGX A;  1VGU A;  1IIN A;  2E8B A;  5CMJ A;  4DE7 A;  4K6R A;  4Y7G A;  4EE5 A;  2AGD A;  3FWW A;  4KQL A;  3ZGG A;  1ZJ3 A;  4KPZ A;  2D7I A;  1QG8 A;  2VXM A;  1O0R A;  4O6M A;  3SX8 A;  2BO4 A;  1G1L A;  1HM0 A;  1VZT A;  3CKV A;  3R2W A;  4FCE A;  4G3S A;  1ZI4 A;  1EYR A;  4IRQ A;  1YP3 A;  4AYJ A;  1JV3 A;  1ZCT A;  2NXV A;  5HS2 A;  5CQM X;  2V0H A;  2DPW A;  4HOC A;  5CQP A;  1S4O A;  2CU2 A;  3D98 A;  1E5K A;  5BXC A;  5FTS A;  2VS5 A;  1JVG A;  2D0J A;  4KNR A;  1QGQ A;  1H5T B;  1W55 A;  2J0A A;  4HCQ A;  4EEO A;  3DK5 A;  4MIX A;  4KC4 A;  1LZ7 A;  1G8O A;  1G97 A;  1H7T A;  4MND A;  4ECM A;  1LL0 A;  5AJP A;  1NHE B;  3V90 A;  5EJZ A;  4IRP A;  3T7N A;  4EE3 A;  4NAK A;  3PKP A;  1FO8 A;  2E3D A;  4YS8 A;  2FY7 A;  3OGZ A;  4M4K A;  4XWI A;  2WVL A;  3V0P A;  2FFV A;  1H7H A;  3I0F A;  1Z90 A;  2RJ5 A;  1HV9 A;  4EE4 A;  4FQW A;  2OEG A;  1H4D A;  3USQ A;  4O6N A;  1ZJ1 A;  3USR A;  4AAW A;  5FUH A;  4D11 A;  3I0H A;  4ZDQ A;  2VK9 A;  5CMG X;  2RIX A;  4Y6N A;  1INI A;  1G0R A;  1H5S D;  1VH1 A;  1ZDF A;  4FRO A;  5C47 A;  1R7V A;  3SXC A;  1HM9 A;  2Y6P A;  1PZT A;  3SXA A;  1XZ6 A;  2YC5 A;  5AJN A;  3V8Z A;  1MP4 A;  1KWS A;  4EEA A;  2WVM A;  1MC3 A;  3IOI A;  2RJ0 A;  1H5T A;  1GWW A;  1FZW A;  4NAL A;  2XME A;  2ZU7 A;  1ZI5 A;  2VFZ A;  1GWV A;  3CKQ A;  1ZIZ A;  1K4V A;  2RJ7 A;  3KIA A;  2FYB A;  1QGS A;  4M28 A;  4Y62 A;  3ZGF A;  2Y4L A;  1ZJ0 A;  2OI6 A;  3EE5 A;  1VM8 A;  3BCV A;  2RJ1 A;  1GX0 A;  2BO7 A;  4B4G A;  4HO9 A;  5C4E A;  3U2X A;  1LZJ A;  5CMI A;  2V0K A;  2RJ4 A;  1FO9 A;  1FXO A;  1VGZ A;  5D92 A;  4FRH A;  2VSI A;  1OQM B;  3PNN A;  4B4B A;  4EVW A;  1YRO B;  1R81 A;  5IDT A;  1TW5 A;  1G23 A;  1EZI A;  4HO4 A;  4GBP A;  2Y4K A;  2YCM A;  4B2X A;  4CVH A;  1LVW A;  3I0C A;  1H5S A;  3IOJ A;  2O1G A;  2ZU9 A;  4B4M A;  2Z87 A;  2AE7 A;  4LW3 A;  5C1G A;  3I0L A;  4E1K A;  4ARW A;  5C1L A;  3RMV A;  3U0X A;  2JCO A;  1NWG B;  1TVY A;  2FYC B;  1FOA A;  3SXB A;  5C4D A;  1H3M A;  3JUJ A;  3SX5 A;  1R7Y A;  3JUK A;  1ON8 A;  1NMM B;  4C2S A;  4JD0 A;  1H7F A;  1I52 A;  1ZCV A;  1G93 A;  1HJL A;  1VH3 A;  2AM4 A;  2VD4 A;  4Y7T A;  1H7G A;  1HM8 A;  2P73 A;  3V91 A;  1LZ0 A;  3RSB A;  1PZY B;  1S4N A;  4FRA A;  2YQJ A;  2YQH A;  2V0L A;  1V82 A;  4CJB A;  4KT7 A;  4FIX A;  4FRP A;  3FOQ A;  2OI7 A;  1YP2 A;  1HJJ A;  2V0J A;  3POL A;  4ASY A;  3OKR A;  1G2V A;  3LW6 A;  3V0Q A;  1LZI A;  2Y7A A;  1WT2 A;  4KC2 A;  3V0L A;  1G3L A;  2RJ6 A;  2YQS A;  1OMZ A;  2QKX A;  4HO3 A;  3CKO A;  3QVB A;  2JCK A;  1O7O A;  4BQH A;  3V8Y A;  2APC A;  4HG6 A;  5IDS A;  3T7M A;  1H5S B;  1H5R A;  1VGW A;  1ZI3 A;  1W57 A;  4P02 A;  2RIZ A;  3U0Y A;  2RJ8 A;  5FTV A;  3U2V A;  1OMX A;  2AH9 A;  4FRL A;  3E26 A;  3TQD A;  2X65 A;  3I0K A;  3IOH A;  1H7L A;  2A8U A;  3DJ4 A;  3OAM A;  2Y4M A;  3E25 A;  4KC1 A; 
#chains in the Genus database with same CATH homology
 3CKN A;  3I0J A;  4Y9X A;  4BMA A;  4DEC A;  2V0I A;  4Q7C A;  2GGO A;  2AES A;  2VS4 A;  2PGV A;  2QH5 A;  3OH0 A;  1H4C A;  3SX3 A;  1JYK A;  1ZI1 A;  3CKJ A;  1ZHJ A;  1GQC A;  2VS3 A;  3Q7U A;  4ASJ A;  1FXJ A;  4B5B A;  1IIM A;  3RMW A;  1YP4 A;  1GA8 A;  5C49 A;  1S4P A;  2O1F A;  4M2B A;  1LL3 A;  1R7T A;  2P72 A;  2XWM A;  3CU0 A;  5FV9 A;  4LW6 A;  2MZB A;  3F1Y A;  1VZU A;  4FIY A;  2FYA A;  1NKH B;  2XMH A;  2D7R A;  4CJ8 A;  2Y4J A;  2Z86 A;  3ST8 A;  1GX4 A;  2AEC A;  5EIY A;  2RIY A;  1VZX A;  3D5N A;  5CMH A;  1FWY A;  1WT3 A;  2YC3 A;  2JCL A;  3I0D A;  1FGG A;  1H5R B;  1W77 A;  1NQI B;  4JIS A;  3O3P A;  3U2T A;  3T7O A;  2O1H A;  1XHB A;  5L6V A;  4L41 C;  2PX7 A;  2WVK A;  1FG5 N;  1G95 A;  2X5S A;  3PKQ A;  3OC9 A;  2J0B A;  1O7Q A;  3NGW A;  4NAN A;  1MP5 A;  2ICX A;  4Y7U A;  4FRD A;  2ICY A;  2GGQ A;  3U2U A;  3OH2 A;  3ZLL A;  5D91 A;  4J18 A;  2ZU8 A;  5CQN X;  1O23 B;  5FU8 A;  2FFU A;  4Y7F A;  5C36 A;  1TW1 A;  5C8R A;  5FU0 A;  5CQO A;  5C38 A;  2I7B A;  4G3P A;  5DDV A;  1VGT A;  4M2A A;  3SXD A;  2Q4J A;  4D0T A;  5JQQ A;  4Y6U A;  2BO8 A;  1ZDG A;  2FYD B;  2I5E A;  4G3Q A;  4HO2 A;  4P00 A;  1TZF A;  1ZJO A;  4B3U A;  3K8E A;  1MP3 A;  1R7X A;  1R82 A;  4G87 A;  3N9W A;  2WE9 A;  4FRE A;  1VIC A;  2W0V A;  1JYL A;  3Q4S A;  2BO6 A;  2VXL A;  2PGY A;  3JTJ A;  5CQL X;  5I1F A;  4HO0 A;  4KPX A;  5C48 A;  1V83 A;  4D0Z A;  1VPA A;  2AM3 A;  3U2W A;  1JV1 A;  5CMF X;  5DDT A;  3DUV A;  4FRQ A;  1H7E A;  2WGZ A;  4NAI A;  1WVC A;  4R7P A;  4KNX A;  1ZJ2 A;  2X60 A;  4CJC A;  3GUE A;  1ZJP A;  5C3A A;  3SXE A;  3R3I A;  2WAW A;  1R7U A;  5C1H A;  1GQ9 A;  3V0M A;  3SXG A;  3V0O A;  4DDZ A;  3SX7 A;  4Y64 A;  5C3B A;  2YES A;  4Y63 A;  2A8W A;  5C4B A;  2QGI A;  4AYL A;  2UX8 A;  1JVD A;  4D11 C;  1G9R A;  4FCU A;  1SS9 A;  3I0E A;  2X5Z A;  4HO5 A;  3OH1 A;  4UEG A;  5C4C A;  3TZT A;  1FR8 A;  4FRB A;  2XWL A;  1H4E A;  5IFY A;  2XWN A;  4EEG A;  1QWJ A;  2WEE A;  1FRW A;  2P6W A;  1ZCU A;  4KXO A;  5J49 A;  3HL3 A;  5FYE A;  3OH4 A;  4KRV A;  2RIT A;  1WT1 A;  5C4F A;  4Y7V A;  1ZCY A;  4AC3 A;  4B2W A;  2PA4 A;  5AJO A;  5C3D A;  5L6S A;  1INJ A;  1ON6 A;  1R80 A;  4HO6 A;  4B42 A;  2W0W A;  3I0G A;  2C0N A;  3D8V A;  3OH3 A;  2JCJ A;  3BRK X;  3ZLK A;  2RJ9 A;  3F1C A;  3K8D A;  1FR9 A;  4EEM A;  4HO8 A;  2OI5 A;  2VSH A;  1WSZ A;  1WT0 A;  2OEF A;  3CGX A;  3V0N A;  1LL2 A;  1NF5 B;  3Q80 A;  1H5S C;  3SPT A;  5EJ1 A;  1V84 A;  3I0I X;  4D48 A;  2AM5 A;  4MYB A;  4FRM A;  1H7Q A;  2YQC A;  3ZF8 A;  2I5K A;  1FGX A;  1VGU A;  1IIN A;  2E8B A;  5CMJ A;  4DE7 A;  4K6R A;  4Y7G A;  4EE5 A;  2AGD A;  3FWW A;  4KQL A;  3ZGG A;  1ZJ3 A;  4KPZ A;  2D7I A;  1QG8 A;  2VXM A;  1O0R A;  4O6M A;  3SX8 A;  2BO4 A;  1G1L A;  1HM0 A;  1VZT A;  3CKV A;  3R2W A;  4FCE A;  4G3S A;  1ZI4 A;  1EYR A;  4IRQ A;  1YP3 A;  4AYJ A;  1JV3 A;  1ZCT A;  2NXV A;  5HS2 A;  5CQM X;  2V0H A;  2DPW A;  4HOC A;  5CQP A;  1S4O A;  2CU2 A;  3D98 A;  1E5K A;  5BXC A;  5FTS A;  2VS5 A;  1JVG A;  2D0J A;  4KNR A;  1QGQ A;  1H5T B;  1W55 A;  2J0A A;  4HCQ A;  4EEO A;  3DK5 A;  4MIX A;  4KC4 A;  1LZ7 A;  1G8O A;  1G97 A;  1H7T A;  4MND A;  4ECM A;  1LL0 A;  5AJP A;  1NHE B;  3V90 A;  5EJZ A;  4IRP A;  3T7N A;  4EE3 A;  4NAK A;  3PKP A;  1FO8 A;  2E3D A;  4YS8 A;  2FY7 A;  3OGZ A;  4M4K A;  4XWI A;  2WVL A;  3V0P A;  2FFV A;  1H7H A;  3I0F A;  1Z90 A;  2RJ5 A;  1HV9 A;  4EE4 A;  4FQW A;  2OEG A;  1H4D A;  3USQ A;  4O6N A;  1ZJ1 A;  3USR A;  4AAW A;  5FUH A;  4D11 A;  3I0H A;  4ZDQ A;  2VK9 A;  5CMG X;  2RIX A;  4Y6N A;  1INI A;  1G0R A;  1H5S D;  1VH1 A;  1ZDF A;  4FRO A;  5C47 A;  1R7V A;  3SXC A;  1HM9 A;  2Y6P A;  1PZT A;  3SXA A;  1XZ6 A;  2YC5 A;  5AJN A;  3V8Z A;  1MP4 A;  1KWS A;  4EEA A;  2WVM A;  1MC3 A;  3IOI A;  2RJ0 A;  1H5T A;  1GWW A;  1FZW A;  4NAL A;  2XME A;  2ZU7 A;  1ZI5 A;  2VFZ A;  1GWV A;  3CKQ A;  1ZIZ A;  1K4V A;  2RJ7 A;  3KIA A;  2FYB A;  1QGS A;  4M28 A;  4Y62 A;  3ZGF A;  2Y4L A;  1ZJ0 A;  2OI6 A;  3EE5 A;  1VM8 A;  3BCV A;  2RJ1 A;  1GX0 A;  2BO7 A;  4B4G A;  4HO9 A;  5C4E A;  3U2X A;  1LZJ A;  5CMI A;  2V0K A;  2RJ4 A;  1FO9 A;  1FXO A;  1VGZ A;  5D92 A;  4FRH A;  2VSI A;  1OQM B;  3PNN A;  4B4B A;  4EVW A;  1YRO B;  1R81 A;  5IDT A;  1TW5 A;  1G23 A;  1EZI A;  4HO4 A;  4GBP A;  2Y4K A;  2YCM A;  4B2X A;  4CVH A;  1LVW A;  3I0C A;  1H5S A;  3IOJ A;  2O1G A;  2ZU9 A;  4B4M A;  2Z87 A;  2AE7 A;  4LW3 A;  5C1G A;  3I0L A;  4E1K A;  4ARW A;  5C1L A;  3RMV A;  3U0X A;  2JCO A;  1NWG B;  1TVY A;  2FYC B;  1FOA A;  3SXB A;  5C4D A;  1H3M A;  3JUJ A;  3SX5 A;  1R7Y A;  3JUK A;  1ON8 A;  1NMM B;  4C2S A;  4JD0 A;  1H7F A;  1I52 A;  1ZCV A;  1G93 A;  1HJL A;  1VH3 A;  2AM4 A;  2VD4 A;  4Y7T A;  1H7G A;  1HM8 A;  2P73 A;  3V91 A;  1LZ0 A;  3RSB A;  1PZY B;  1S4N A;  4FRA A;  2YQJ A;  2YQH A;  2V0L A;  1V82 A;  4CJB A;  4KT7 A;  4FIX A;  4FRP A;  3FOQ A;  2OI7 A;  1YP2 A;  1HJJ A;  2V0J A;  3POL A;  4ASY A;  3OKR A;  1G2V A;  3LW6 A;  3V0Q A;  1LZI A;  2Y7A A;  1WT2 A;  4KC2 A;  3V0L A;  1G3L A;  2RJ6 A;  2YQS A;  1OMZ A;  2QKX A;  4HO3 A;  3CKO A;  3QVB A;  2JCK A;  1O7O A;  4BQH A;  3V8Y A;  2APC A;  4HG6 A;  5IDS A;  3T7M A;  1H5S B;  1H5R A;  1VGW A;  1ZI3 A;  1W57 A;  4P02 A;  2RIZ A;  3U0Y A;  2RJ8 A;  5FTV A;  3U2V A;  1OMX A;  2AH9 A;  4FRL A;  3E26 A;  3TQD A;  2X65 A;  3I0K A;  3IOH A;  1H7L A;  2A8U A;  3DJ4 A;  3OAM A;  2Y4M A;  3E25 A;  4KC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...