2AESA

Crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,2-man-alpha1,3-man-beta-or
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
272
Chain Sequence
LPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Oligosaccharide Preferences of beta1,4-Galactosyltransferase-I: Crystal Structures of Met340His Mutant of Human beta1,4-Galactosyltransferase-I with a Pentasaccharide and Trisaccharides of the N-Glycan Moiety
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 272
sequence length 272
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2005-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2aesA00
1ZJ2A 4CJBA 1ON8A 5CQLX 1V84A 5C3DA 4Y7FA 3U2UA 1MP3A 2A8UA 1S4PA 4KRVA 3R2WA 2ZU7A 4JD0A 5HS2A 3SXAA 4FRBA 1H3MA 4HOCA 2JCLA 2P73A 1G97A 1KWSA 3V91A 2ICYA 3GUEA 5FV9A 4M2AA 3TQDA 2QH5A 2RIYA 1VGUA 4AAWA 2Q4JA 1MP5A 1GX4A 2RJ9A 5FTVA 2XWLA 3V0PA 1XHBA 5FTSA 1H5TA 2WAWA 4LW6A 1FR8A 3E25A 5CMGX 4P00A 1ZI5A 5IDSA 3OH0A 2BO6A 3RSBA 4DECA 2P72A 1GWVA 2X65A 4M28A 1ZJPA 1H7FA 1H7HA 1V82A 2FFUA 4R7PA 2QGIA 2AM4A 4C2SA 1LZ0A 1ZI3A 4JISA 1R7YA 1Z90A 2A8WA 2MZBA 3F1YA 4Y7VA 1SS9A 1FZWA 1R7UA 1VGTA 4FCEA 4KXOA 1GWWA 4Y6UA 3JUJA 1W57A 1G23A 5AJOA 2RJ0A 2FY7A 1ON6A 1ZHJA 2VXMA 2RIZA 4FCUA 2WGZA 4KC4A 1HM9A 2PGVA 1QGQA 2FYCB 3LW6A 5CQMX 3OH2A 3BRKX 1GQ9A 3Q4SA 4ASJA 4EEGA 1VZXA 2AE7A 1G3LA 3I0DA 4HO6A 4KC1A 1JYLA 3V0MA 4CJCA 4Y7UA 3DUVA 3I0CA 4B2XA 2O1GA 4KPXA 1H5RB 5CQOA 1FXOA 3IOHA 4EEAA 3D8VA 2YC5A 2YCMA 3V8ZA 1ZJ0A 4EE3A 2APCA 2GGOA 2I7BA 2Y4MA 3Q80A 2WVLA 2WE9A 1VPAA 1MC3A 1ZCVA 4B3UA 1NKHB 5CQPA 1LVWA 1GQCA 4B4MA 3EE5A 4HCQA 1LL0A 4XWIA 1TW5A 4UEGA 1S4OA 4M2BA 3T7NA 3V0LA 2JCKA 4B4GA 1LL3A 1ZJ3A 2OI6A 3JUKA 3FWWA 4ARWA 3TZTA 1INIA 2V0JA 2YQHA 2X5SA 2VS5A 3U2XA 4FRMA 2O1HA 1ZDGA 4B5BA 2I5EA 2V0IA 4CVHA 2Y4KA 1G9RA 5IDTA 1H4EA 3U2VA 3CKVA 1WSZA 1NQIB 2UX8A 4AYLA 3V0NA 4M4KA 2AESA 1R81A 2YESA 5BXCA 1H7GA 3OAMA 2ZU9A 3I0HA 2Z86A 4D0ZA 3T7OA 1I52A 2YQJA 3RMWA 2AGDA 3RMVA 4AC3A 3O3PA 1GA8A 4YS8A 3OH3A 5FU8A 4AYJA 1OMZA 2DPWA 5AJPA 1NHEB 4MNDA 4EVWA 2E8BA 5FUHA 1H7TA 1OQMB 1FO9A 5C47A 3V8YA 2XWMA 1EZIA 2RIXA 3U2WA 4FRPA 1JVGA 3T7MA 1LZJA 4FRHA 4ASYA 1H7LA 1G1LA 3PNNA 3U0XA 4KNXA 4FRLA 2BO4A 4K6RA 2E3DA 3OGZA 4FREA 1O7QA 1NF5B 3CU0A 4EEOA 5C8RA 1XZ6A 3FOQA 1H5SD 5J49A 1S4NA 4BMAA 4FRQA 3QVBA 1FRWA 1VGZA 4Y7GA 1E5KA 1OMXA 5C4EA 4NANA 4HO3A 2AM3A 3SXDA 1FG5N 2RJ1A 2Y7AA 2I5KA 2YQSA 2PA4A 4HO8A 2X60A 3K8EA 3CKNA 2W0WA 1NWGB 1NMMB 4LW3A 2WEEA 1QWJA 1WT3A 1TZFA 2BO8A 2BO7A 4HO0A 1HJJA 4HO5A 3SXCA 5I1FA 5DDVA 5C1GA 2ZU8A 2W0VA 2Y6PA 2XMEA 1G95A 2XMHA 3U2TA 5C48A 3SX5A 1O7OA 4HO9A 4KC2A 3SX7A 1R82A 4ZDQA 2AH9A 1G2VA 3NGWA 1LZ7A 2RJ5A 4HG6A 1PZTA 1H5RA 3CGXA 1H7EA 4P02A 4D48A 4D11A 1HJLA 3BCVA 1R7VA 2XWNA 4KPZA 4J18A 2ICXA 1HV9A 5DDTA 1HM8A 2D7IA 3SX3A 5CMJA 4FQWA 4FROA 1VICA 4DE7A 4B4BA 3OH1A 2X5ZA 1TW1A 3R3IA 1WT0A 4IRPA 5EJZA 3ZLKA 4G3PA 4BQHA 5C3BA 1WT2A 4Y63A 2VSIA 3V0OA 1FOAA 5AJNA 2JCOA 2PX7A 4D11C 5C36A 2RJ8A 3ZGFA 1YROB 2OI5A 5CMFX 5C1LA 1FR9A 1PZYB 1VM8A 3CKJA 1IINA 1EYRA 4IRQA 1VZUA 4KT7A 2AECA 1O0RA 5C3AA 1H5TB 1H4DA 2GGQA 4Y62A 5CMIA 3USRA 5JQQA 4KQLA 4ECMA 2WVMA 3OC9A 3I0GA 3IOIA 4KNRA 3V0QA 3V90A 1ZI4A 4FRDA 3K8DA 1G0RA 3SXGA 1QGSA 4CJ8A 1V83A 4HO2A 5CQNX 2WVKA 2RJ7A 3DK5A 5C4DA 3U0YA 5C49A 2Y4JA 4FRAA 2AM5A 1G8OA 2OEFA 3I0JA 4G87A 3ZLLA 1H5SB 2P6WA 1GX0A 1VGWA 4EE4A 5FU0A 2VXLA 4EE5A 3OH4A 1ZI1A 3KIAA 2RJ6A 1JV3A 2JCJA 5CMHA 3SX8A 1LZIA 1FXJA 2V0HA 3E26A 1ZDFA 1ZJ1A 2FYBA 3CKQA 1IIMA 1R7XA 3OKRA 1R7TA 1YP2A 4Y7TA 1W77A 1WT1A 4MYBA 1ZIZA 2O1FA 3I0FA 1ZJOA 2CU2A 5IFYA 5FYEA 1O23B 1H5SA 1ZCUA 3POLA 4NALA 1FGXA 2FFVA 1H7QA 2VD4A 2FYAA 4E1KA 3USQA 1VH3A 1YP3A 3I0EA 1JV1A 4GBPA 3CKOA 1LL2A 1FGGA 5EIYA 4G3QA 3I0IX 2V0LA 5C4CA 3F1CA 4L41C 1FO8A 3ST8A 2YQCA 3PKQA 3SPTA 1JVDA 1ZCYA 1R80A 3SXBA 4D0TA 1INJA 3ZGGA 3SXEA 3ZF8A 4Y9XA 4G3SA 1H4CA 5C4BA 1FWYA 2YC3A 3I0KA 1H5SC 4B2WA 1K4VA 4HO4A 2VFZA 2V0KA 5L6VA 1G93A 3D5NA 5C1HA 4EEMA 3N9WA 2QKXA 2OI7A 2RITA 1WVCA 2Z87A 4Y6NA 5C38A 2FYDB 4DDZA 2NXVA 3PKPA 1YP4A 2OEGA 2RJ4A 2PGYA 4B42A 2D0JA 2VSHA 3I0LA 3HL3A 1QG8A 4NAKA 5L6SA 1MP4A 1HM0A 3D98A 1VZTA 2D7RA 2Y4LA 4NAIA 5EJ1A 1VH1A 2VS4A 5C4FA 1W55A 2VS3A 3IOJA 3JTJA 3Q7UA 1JYKA 4Y64A 3DJ4A 1TVYA 1ZCTA
chains in the Genus database with same CATH superfamily
4O6MA 1ZJ2A 4CJBA 1ON8A 5CQLX 1V84A 5C3DA 4Y7FA 3U2UA 1MP3A 2A8UA 1S4PA 4KRVA 3R2WA 2ZU7A 4JD0A 5HS2A 3SXAA 4O6NA 4FRBA 1H3MA 4HOCA 2JCLA 2P73A 1G97A 1KWSA 3V91A 2ICYA 3GUEA 5FV9A 4M2AA 3TQDA 2QH5A 2RIYA 1VGUA 4AAWA 2Q4JA 1MP5A 1GX4A 2RJ9A 5FTVA 2XWLA 3V0PA 1XHBA 5FTSA 1H5TA 2WAWA 4LW6A 1FR8A 3E25A 5CMGX 4P00A 1ZI5A 5IDSA 3OH0A 2BO6A 3RSBA 4DECA 2P72A 1GWVA 2X65A 4M28A 1ZJPA 1H7FA 1H7HA 1V82A 2FFUA 4R7PA 2QGIA 2AM4A 4C2SA 1LZ0A 1ZI3A 4JISA 1R7YA 1Z90A 2A8WA 2MZBA 3F1YA 4Y7VA 1SS9A 1FZWA 1R7UA 1VGTA 4FCEA 4KXOA 1GWWA 4Y6UA 3JUJA 1W57A 1G23A 5AJOA 2RJ0A 2FY7A 1ON6A 1ZHJA 2VXMA 2RIZA 4FCUA 2WGZA 4KC4A 1HM9A 2PGVA 1QGQA 2FYCB 3LW6A 5CQMX 3OH2A 3BRKX 1GQ9A 3Q4SA 4ASJA 4EEGA 1VZXA 2AE7A 1G3LA 3I0DA 4HO6A 4KC1A 1JYLA 3V0MA 4CJCA 4Y7UA 3DUVA 3I0CA 4B2XA 5D91A 2O1GA 4KPXA 1H5RB 5CQOA 2J0AA 1FXOA 3IOHA 4EEAA 3D8VA 2YC5A 2YCMA 3V8ZA 1ZJ0A 4EE3A 2APCA 2GGOA 2I7BA 2Y4MA 3Q80A 2WVLA 2WE9A 1VPAA 1MC3A 1ZCVA 4B3UA 1NKHB 5CQPA 1LVWA 1GQCA 4B4MA 3EE5A 4HCQA 1LL0A 4Q7CA 4XWIA 1TW5A 4UEGA 1S4OA 4M2BA 3T7NA 3V0LA 2JCKA 4B4GA 1LL3A 1ZJ3A 2OI6A 3JUKA 3FWWA 4ARWA 3TZTA 1INIA 2V0JA 2YQHA 2X5SA 2VS5A 3U2XA 4FRMA 2O1HA 1ZDGA 4B5BA 2I5EA 2V0IA 4CVHA 2Y4KA 1G9RA 5IDTA 1H4EA 3U2VA 3CKVA 1WSZA 1NQIB 2UX8A 4AYLA 3V0NA 4M4KA 2AESA 1R81A 2YESA 5BXCA 1H7GA 3OAMA 2ZU9A 3I0HA 2Z86A 4D0ZA 3T7OA 1I52A 2YQJA 3RMWA 2AGDA 3RMVA 4AC3A 3O3PA 1GA8A 4YS8A 3OH3A 5FU8A 4AYJA 1OMZA 2DPWA 5AJPA 1NHEB 4MNDA 4EVWA 2E8BA 5FUHA 1H7TA 1OQMB 1FO9A 5C47A 3V8YA 2XWMA 4MIXA 1EZIA 2RIXA 3U2WA 4FRPA 1JVGA 3T7MA 1LZJA 4FRHA 4ASYA 1H7LA 1G1LA 3PNNA 3U0XA 4KNXA 4FRLA 2BO4A 4K6RA 2E3DA 4FIXA 3OGZA 4FREA 1O7QA 1NF5B 3CU0A 4EEOA 5C8RA 1XZ6A 3FOQA 1H5SD 5J49A 1S4NA 4BMAA 4FRQA 3QVBA 1FRWA 1VGZA 4Y7GA 1E5KA 1OMXA 5C4EA 4NANA 4HO3A 2AM3A 3SXDA 1FG5N 2RJ1A 2Y7AA 2I5KA 2YQSA 2PA4A 4HO8A 5D92A 2VK9A 2X60A 3K8EA 3CKNA 2W0WA 1NWGB 1NMMB 4LW3A 2WEEA 1QWJA 1WT3A 1TZFA 2BO8A 2BO7A 4HO0A 1HJJA 4HO5A 3SXCA 5I1FA 5DDVA 5C1GA 2ZU8A 2W0VA 2Y6PA 2XMEA 1G95A 2XMHA 3U2TA 5C48A 3SX5A 1O7OA 4HO9A 4KC2A 3SX7A 1R82A 4ZDQA 2AH9A 1G2VA 3NGWA 1LZ7A 2RJ5A 4HG6A 1PZTA 1H5RA 3CGXA 1H7EA 4P02A 4D48A 4D11A 1HJLA 3BCVA 1R7VA 2XWNA 4KPZA 4J18A 2ICXA 1HV9A 5DDTA 1HM8A 2D7IA 3SX3A 5CMJA 4FQWA 4FROA 1VICA 4DE7A 4B4BA 3OH1A 2X5ZA 1TW1A 3R3IA 1WT0A 4IRPA 5EJZA 3ZLKA 4G3PA 4BQHA 5C3BA 1WT2A 4Y63A 2VSIA 3V0OA 1FOAA 5AJNA 2JCOA 2PX7A 4D11C 5C36A 2RJ8A 2J0BA 1YROB 2OI5A 3ZGFA 5CMFX 2C0NA 5C1LA 1FR9A 1PZYB 4FIYA 1VM8A 3CKJA 1IINA 1EYRA 4IRQA 1VZUA 4KT7A 2AECA 1O0RA 5C3AA 1H5TB 1H4DA 2GGQA 4Y62A 5CMIA 3USRA 5JQQA 4KQLA 4ECMA 2WVMA 3OC9A 3I0GA 3IOIA 4KNRA 3V0QA 3V90A 1ZI4A 4FRDA 3K8DA 1G0RA 3SXGA 1QGSA 4CJ8A 1V83A 4HO2A 5CQNX 2WVKA 2RJ7A 3DK5A 5C4DA 3U0YA 5C49A 2Y4JA 4FRAA 2AM5A 1G8OA 2OEFA 3I0JA 4G87A 3ZLLA 1H5SB 2P6WA 1GX0A 1VGWA 4EE4A 5FU0A 2VXLA 4EE5A 3OH4A 1ZI1A 3KIAA 2RJ6A 1JV3A 2JCJA 5CMHA 3SX8A 1LZIA 1FXJA 2V0HA 3E26A 1ZDFA 1ZJ1A 2FYBA 3CKQA 1IIMA 1R7XA 3OKRA 1R7TA 1YP2A 4Y7TA 1W77A 1WT1A 4MYBA 1ZIZA 2O1FA 3I0FA 1ZJOA 2CU2A 5IFYA 5FYEA 1O23B 1H5SA 1ZCUA 3POLA 4NALA 1FGXA 2FFVA 1H7QA 2VD4A 2FYAA 4E1KA 3USQA 1VH3A 1YP3A 3I0EA 1JV1A 4GBPA 3CKOA 1LL2A 1FGGA 5EIYA 4G3QA 3I0IX 2V0LA 5C4CA 3F1CA 4L41C 1FO8A 3ST8A 2YQCA 3PKQA 3SPTA 1JVDA 1ZCYA 1R80A 3SXBA 4D0TA 1INJA 3ZGGA 3SXEA 3ZF8A 4Y9XA 4G3SA 1H4CA 5C4BA 1FWYA 2YC3A 3I0KA 1H5SC 4B2WA 1K4VA 4HO4A 2VFZA 2V0KA 5L6VA 1G93A 3D5NA 5C1HA 4EEMA 3N9WA 2QKXA 2OI7A 2RITA 1WVCA 2Z87A 4Y6NA 5C38A 2FYDB 4DDZA 2NXVA 3PKPA 1YP4A 2OEGA 2RJ4A 2PGYA 4B42A 2D0JA 2VSHA 3I0LA 3HL3A 1QG8A 4NAKA 5L6SA 1MP4A 1HM0A 3D98A 1VZTA 2D7RA 2Y4LA 4NAIA 5EJ1A 1VH1A 2VS4A 5C4FA 1W55A 2VS3A 3IOJA 3JTJA 3Q7UA 1JYKA 4Y64A 3DJ4A 1TVYA 1ZCTA
chains in the Genus database with same CATH topology
4O6MA 1ZJ2A 4CJBA 1ON8A 5CQLX 1V84A 5C3DA 4Y7FA 3U2UA 1MP3A 2A8UA 1S4PA 4KRVA 3R2WA 2ZU7A 4JD0A 5HS2A 3SXAA 4O6NA 4FRBA 1H3MA 4HOCA 2JCLA 2P73A 1G97A 1KWSA 3V91A 2ICYA 3GUEA 5FV9A 4M2AA 3TQDA 2QH5A 2RIYA 1VGUA 4AAWA 2Q4JA 1MP5A 1GX4A 2RJ9A 5FTVA 2XWLA 3V0PA 1XHBA 5FTSA 1H5TA 2WAWA 4LW6A 1FR8A 3E25A 5CMGX 4P00A 1ZI5A 5IDSA 3OH0A 2BO6A 3RSBA 4DECA 2P72A 1GWVA 2X65A 4M28A 1ZJPA 1H7FA 1H7HA 1V82A 2FFUA 4R7PA 2QGIA 2AM4A 4C2SA 1LZ0A 1ZI3A 4JISA 1R7YA 1Z90A 2A8WA 2MZBA 3F1YA 4Y7VA 1SS9A 1FZWA 1R7UA 1VGTA 4FCEA 4KXOA 1GWWA 4Y6UA 3JUJA 1W57A 1G23A 5AJOA 2RJ0A 2FY7A 1ON6A 1ZHJA 2VXMA 2RIZA 4FCUA 2WGZA 4KC4A 1HM9A 2PGVA 1QGQA 2FYCB 3LW6A 5CQMX 3OH2A 3BRKX 1GQ9A 3Q4SA 4ASJA 4EEGA 1VZXA 2AE7A 1G3LA 3I0DA 4HO6A 4KC1A 1JYLA 3V0MA 4CJCA 4Y7UA 3DUVA 3I0CA 4B2XA 5D91A 2O1GA 4KPXA 1H5RB 5CQOA 2J0AA 1FXOA 3IOHA 4EEAA 3D8VA 2YC5A 2YCMA 3V8ZA 1ZJ0A 4EE3A 2APCA 2GGOA 2I7BA 2Y4MA 3Q80A 2WVLA 2WE9A 1VPAA 1MC3A 1ZCVA 4B3UA 1NKHB 5CQPA 1LVWA 1GQCA 4B4MA 3EE5A 4HCQA 1LL0A 4Q7CA 4XWIA 1TW5A 4UEGA 1S4OA 4M2BA 3T7NA 3V0LA 2JCKA 4B4GA 1LL3A 1ZJ3A 2OI6A 3JUKA 3FWWA 4ARWA 3TZTA 1INIA 2V0JA 2YQHA 2X5SA 2VS5A 3U2XA 4FRMA 2O1HA 1ZDGA 4B5BA 2I5EA 2V0IA 4CVHA 2Y4KA 1G9RA 5IDTA 1H4EA 3U2VA 3CKVA 1WSZA 1NQIB 2UX8A 4AYLA 3V0NA 4M4KA 2AESA 1R81A 2YESA 5BXCA 1H7GA 3OAMA 2ZU9A 3I0HA 2Z86A 4D0ZA 3T7OA 1I52A 2YQJA 3RMWA 2AGDA 3RMVA 4AC3A 3O3PA 1GA8A 4YS8A 3OH3A 5FU8A 4AYJA 1OMZA 2DPWA 5AJPA 1NHEB 4MNDA 4EVWA 2E8BA 5FUHA 1H7TA 1OQMB 1FO9A 5C47A 3V8YA 2XWMA 4MIXA 1EZIA 2RIXA 3U2WA 4FRPA 1JVGA 3T7MA 1LZJA 4FRHA 4ASYA 1H7LA 1G1LA 3PNNA 3U0XA 4KNXA 4FRLA 2BO4A 4K6RA 2E3DA 4FIXA 3OGZA 4FREA 1O7QA 1NF5B 3CU0A 4EEOA 5C8RA 1XZ6A 3FOQA 1H5SD 5J49A 1S4NA 4BMAA 4FRQA 3QVBA 1FRWA 1VGZA 4Y7GA 1E5KA 1OMXA 5C4EA 4NANA 4HO3A 2AM3A 3SXDA 1FG5N 2RJ1A 2Y7AA 2I5KA 2YQSA 2PA4A 4HO8A 5D92A 2VK9A 2X60A 3K8EA 3CKNA 2W0WA 1NWGB 1NMMB 4LW3A 2WEEA 1QWJA 1WT3A 1TZFA 2BO8A 2BO7A 4HO0A 1HJJA 4HO5A 3SXCA 5I1FA 5DDVA 5C1GA 2ZU8A 2W0VA 2Y6PA 2XMEA 1G95A 2XMHA 3U2TA 5C48A 3SX5A 1O7OA 4HO9A 4KC2A 3SX7A 1R82A 4ZDQA 2AH9A 1G2VA 3NGWA 1LZ7A 2RJ5A 4HG6A 1PZTA 1H5RA 3CGXA 1H7EA 4P02A 4D48A 4D11A 1HJLA 3BCVA 1R7VA 2XWNA 4KPZA 4J18A 2ICXA 1HV9A 5DDTA 1HM8A 2D7IA 3SX3A 5CMJA 4FQWA 4FROA 1VICA 4DE7A 4B4BA 3OH1A 2X5ZA 1TW1A 3R3IA 1WT0A 4IRPA 5EJZA 3ZLKA 4G3PA 4BQHA 5C3BA 1WT2A 4Y63A 2VSIA 3V0OA 1FOAA 5AJNA 2JCOA 2PX7A 4D11C 5C36A 2RJ8A 2J0BA 1YROB 2OI5A 3ZGFA 5CMFX 2C0NA 5C1LA 1FR9A 1PZYB 4FIYA 1VM8A 3CKJA 1IINA 1EYRA 4IRQA 1VZUA 4KT7A 2AECA 1O0RA 5C3AA 1H5TB 1H4DA 2GGQA 4Y62A 5CMIA 3USRA 5JQQA 4KQLA 4ECMA 2WVMA 3OC9A 3I0GA 3IOIA 4KNRA 3V0QA 3V90A 1ZI4A 4FRDA 3K8DA 1G0RA 3SXGA 1QGSA 4CJ8A 1V83A 4HO2A 5CQNX 2WVKA 2RJ7A 3DK5A 5C4DA 3U0YA 5C49A 2Y4JA 4FRAA 2AM5A 1G8OA 2OEFA 3I0JA 4G87A 3ZLLA 1H5SB 2P6WA 1GX0A 1VGWA 4EE4A 5FU0A 2VXLA 4EE5A 3OH4A 1ZI1A 3KIAA 2RJ6A 1JV3A 2JCJA 5CMHA 3SX8A 1LZIA 1FXJA 2V0HA 3E26A 1ZDFA 1ZJ1A 2FYBA 3CKQA 1IIMA 1R7XA 3OKRA 1R7TA 1YP2A 4Y7TA 1W77A 1WT1A 4MYBA 1ZIZA 2O1FA 3I0FA 1ZJOA 2CU2A 5IFYA 5FYEA 1O23B 1H5SA 1ZCUA 3POLA 4NALA 1FGXA 2FFVA 1H7QA 2VD4A 2FYAA 4E1KA 3USQA 1VH3A 1YP3A 3I0EA 1JV1A 4GBPA 3CKOA 1LL2A 1FGGA 5EIYA 4G3QA 3I0IX 2V0LA 5C4CA 3F1CA 4L41C 1FO8A 3ST8A 2YQCA 3PKQA 3SPTA 1JVDA 1ZCYA 1R80A 3SXBA 4D0TA 1INJA 3ZGGA 3SXEA 3ZF8A 4Y9XA 4G3SA 1H4CA 5C4BA 1FWYA 2YC3A 3I0KA 1H5SC 4B2WA 1K4VA 4HO4A 2VFZA 2V0KA 5L6VA 1G93A 3D5NA 5C1HA 4EEMA 3N9WA 2QKXA 2OI7A 2RITA 1WVCA 2Z87A 4Y6NA 5C38A 2FYDB 4DDZA 2NXVA 3PKPA 1YP4A 2OEGA 2RJ4A 2PGYA 4B42A 2D0JA 2VSHA 3I0LA 3HL3A 1QG8A 4NAKA 5L6SA 1MP4A 1HM0A 3D98A 1VZTA 2D7RA 2Y4LA 4NAIA 5EJ1A 1VH1A 2VS4A 5C4FA 1W55A 2VS3A 3IOJA 3JTJA 3Q7UA 1JYKA 4Y64A 3DJ4A 1TVYA 1ZCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJ2 A;  4CJB A;  1ON8 A;  5CQL X;  1V84 A;  5C3D A;  4Y7F A;  3U2U A;  1MP3 A;  2A8U A;  1S4P A;  4KRV A;  3R2W A;  2ZU7 A;  4JD0 A;  5HS2 A;  3SXA A;  4FRB A;  1H3M A;  4HOC A;  2JCL A;  2P73 A;  1G97 A;  1KWS A;  3V91 A;  2ICY A;  3GUE A;  5FV9 A;  4M2A A;  3TQD A;  2QH5 A;  2RIY A;  1VGU A;  4AAW A;  2Q4J A;  1MP5 A;  1GX4 A;  2RJ9 A;  5FTV A;  2XWL A;  3V0P A;  1XHB A;  5FTS A;  1H5T A;  2WAW A;  4LW6 A;  1FR8 A;  3E25 A;  5CMG X;  4P00 A;  1ZI5 A;  5IDS A;  3OH0 A;  2BO6 A;  3RSB A;  4DEC A;  2P72 A;  1GWV A;  2X65 A;  4M28 A;  1ZJP A;  1H7F A;  1H7H A;  1V82 A;  2FFU A;  4R7P A;  2QGI A;  2AM4 A;  4C2S A;  1LZ0 A;  1ZI3 A;  4JIS A;  1R7Y A;  1Z90 A;  2A8W A;  2MZB A;  3F1Y A;  4Y7V A;  1SS9 A;  1FZW A;  1R7U A;  1VGT A;  4FCE A;  4KXO A;  1GWW A;  4Y6U A;  3JUJ A;  1W57 A;  1G23 A;  5AJO A;  2RJ0 A;  2FY7 A;  1ON6 A;  1ZHJ A;  2VXM A;  2RIZ A;  4FCU A;  2WGZ A;  4KC4 A;  1HM9 A;  2PGV A;  1QGQ A;  2FYC B;  3LW6 A;  5CQM X;  3OH2 A;  3BRK X;  1GQ9 A;  3Q4S A;  4ASJ A;  4EEG A;  1VZX A;  2AE7 A;  1G3L A;  3I0D A;  4HO6 A;  4KC1 A;  1JYL A;  3V0M A;  4CJC A;  4Y7U A;  3DUV A;  3I0C A;  4B2X A;  2O1G A;  4KPX A;  1H5R B;  5CQO A;  1FXO A;  3IOH A;  4EEA A;  3D8V A;  2YC5 A;  2YCM A;  3V8Z A;  1ZJ0 A;  4EE3 A;  2APC A;  2GGO A;  2I7B A;  2Y4M A;  3Q80 A;  2WVL A;  2WE9 A;  1VPA A;  1MC3 A;  1ZCV A;  4B3U A;  1NKH B;  5CQP A;  1LVW A;  1GQC A;  4B4M A;  3EE5 A;  4HCQ A;  1LL0 A;  4XWI A;  1TW5 A;  4UEG A;  1S4O A;  4M2B A;  3T7N A;  3V0L A;  2JCK A;  4B4G A;  1LL3 A;  1ZJ3 A;  2OI6 A;  3JUK A;  3FWW A;  4ARW A;  3TZT A;  1INI A;  2V0J A;  2YQH A;  2X5S A;  2VS5 A;  3U2X A;  4FRM A;  2O1H A;  1ZDG A;  4B5B A;  2I5E A;  2V0I A;  4CVH A;  2Y4K A;  1G9R A;  5IDT A;  1H4E A;  3U2V A;  3CKV A;  1WSZ A;  1NQI B;  2UX8 A;  4AYL A;  3V0N A;  4M4K A;  2AES A;  1R81 A;  2YES A;  5BXC A;  1H7G A;  3OAM A;  2ZU9 A;  3I0H A;  2Z86 A;  4D0Z A;  3T7O A;  1I52 A;  2YQJ A;  3RMW A;  2AGD A;  3RMV A;  4AC3 A;  3O3P A;  1GA8 A;  4YS8 A;  3OH3 A;  5FU8 A;  4AYJ A;  1OMZ A;  2DPW A;  5AJP A;  1NHE B;  4MND A;  4EVW A;  2E8B A;  5FUH A;  1H7T A;  1OQM B;  1FO9 A;  5C47 A;  3V8Y A;  2XWM A;  1EZI A;  2RIX A;  3U2W A;  4FRP A;  1JVG A;  3T7M A;  1LZJ A;  4FRH A;  4ASY A;  1H7L A;  1G1L A;  3PNN A;  3U0X A;  4KNX A;  4FRL A;  2BO4 A;  4K6R A;  2E3D A;  3OGZ A;  4FRE A;  1O7Q A;  1NF5 B;  3CU0 A;  4EEO A;  5C8R A;  1XZ6 A;  3FOQ A;  1H5S D;  5J49 A;  1S4N A;  4BMA A;  4FRQ A;  3QVB A;  1FRW A;  1VGZ A;  4Y7G A;  1E5K A;  1OMX A;  5C4E A;  4NAN A;  4HO3 A;  2AM3 A;  3SXD A;  1FG5 N;  2RJ1 A;  2Y7A A;  2I5K A;  2YQS A;  2PA4 A;  4HO8 A;  2X60 A;  3K8E A;  3CKN A;  2W0W A;  1NWG B;  1NMM B;  4LW3 A;  2WEE A;  1QWJ A;  1WT3 A;  1TZF A;  2BO8 A;  2BO7 A;  4HO0 A;  1HJJ A;  4HO5 A;  3SXC A;  5I1F A;  5DDV A;  5C1G A;  2ZU8 A;  2W0V A;  2Y6P A;  2XME A;  1G95 A;  2XMH A;  3U2T A;  5C48 A;  3SX5 A;  1O7O A;  4HO9 A;  4KC2 A;  3SX7 A;  1R82 A;  4ZDQ A;  2AH9 A;  1G2V A;  3NGW A;  1LZ7 A;  2RJ5 A;  4HG6 A;  1PZT A;  1H5R A;  3CGX A;  1H7E A;  4P02 A;  4D48 A;  4D11 A;  1HJL A;  3BCV A;  1R7V A;  2XWN A;  4KPZ A;  4J18 A;  2ICX A;  1HV9 A;  5DDT A;  1HM8 A;  2D7I A;  3SX3 A;  5CMJ A;  4FQW A;  4FRO A;  1VIC A;  4DE7 A;  4B4B A;  3OH1 A;  2X5Z A;  1TW1 A;  3R3I A;  1WT0 A;  4IRP A;  5EJZ A;  3ZLK A;  4G3P A;  4BQH A;  5C3B A;  1WT2 A;  4Y63 A;  2VSI A;  3V0O A;  1FOA A;  5AJN A;  2JCO A;  2PX7 A;  4D11 C;  5C36 A;  2RJ8 A;  3ZGF A;  1YRO B;  2OI5 A;  5CMF X;  5C1L A;  1FR9 A;  1PZY B;  1VM8 A;  3CKJ A;  1IIN A;  1EYR A;  4IRQ A;  1VZU A;  4KT7 A;  2AEC A;  1O0R A;  5C3A A;  1H5T B;  1H4D A;  2GGQ A;  4Y62 A;  5CMI A;  3USR A;  5JQQ A;  4KQL A;  4ECM A;  2WVM A;  3OC9 A;  3I0G A;  3IOI A;  4KNR A;  3V0Q A;  3V90 A;  1ZI4 A;  4FRD A;  3K8D A;  1G0R A;  3SXG A;  1QGS A;  4CJ8 A;  1V83 A;  4HO2 A;  5CQN X;  2WVK A;  2RJ7 A;  3DK5 A;  5C4D A;  3U0Y A;  5C49 A;  2Y4J A;  4FRA A;  2AM5 A;  1G8O A;  2OEF A;  3I0J A;  4G87 A;  3ZLL A;  1H5S B;  2P6W A;  1GX0 A;  1VGW A;  4EE4 A;  5FU0 A;  2VXL A;  4EE5 A;  3OH4 A;  1ZI1 A;  3KIA A;  2RJ6 A;  1JV3 A;  2JCJ A;  5CMH A;  3SX8 A;  1LZI A;  1FXJ A;  2V0H A;  3E26 A;  1ZDF A;  1ZJ1 A;  2FYB A;  3CKQ A;  1IIM A;  1R7X A;  3OKR A;  1R7T A;  1YP2 A;  4Y7T A;  1W77 A;  1WT1 A;  4MYB A;  1ZIZ A;  2O1F A;  3I0F A;  1ZJO A;  2CU2 A;  5IFY A;  5FYE A;  1O23 B;  1H5S A;  1ZCU A;  3POL A;  4NAL A;  1FGX A;  2FFV A;  1H7Q A;  2VD4 A;  2FYA A;  4E1K A;  3USQ A;  1VH3 A;  1YP3 A;  3I0E A;  1JV1 A;  4GBP A;  3CKO A;  1LL2 A;  1FGG A;  5EIY A;  4G3Q A;  3I0I X;  2V0L A;  5C4C A;  3F1C A;  4L41 C;  1FO8 A;  3ST8 A;  2YQC A;  3PKQ A;  3SPT A;  1JVD A;  1ZCY A;  1R80 A;  3SXB A;  4D0T A;  1INJ A;  3ZGG A;  3SXE A;  3ZF8 A;  4Y9X A;  4G3S A;  1H4C A;  5C4B A;  1FWY A;  2YC3 A;  3I0K A;  1H5S C;  4B2W A;  1K4V A;  4HO4 A;  2VFZ A;  2V0K A;  5L6V A;  1G93 A;  3D5N A;  5C1H A;  4EEM A;  3N9W A;  2QKX A;  2OI7 A;  2RIT A;  1WVC A;  2Z87 A;  4Y6N A;  5C38 A;  2FYD B;  4DDZ A;  2NXV A;  3PKP A;  1YP4 A;  2OEG A;  2RJ4 A;  2PGY A;  4B42 A;  2D0J A;  2VSH A;  3I0L A;  3HL3 A;  1QG8 A;  4NAK A;  5L6S A;  1MP4 A;  1HM0 A;  3D98 A;  1VZT A;  2D7R A;  2Y4L A;  4NAI A;  5EJ1 A;  1VH1 A;  2VS4 A;  5C4F A;  1W55 A;  2VS3 A;  3IOJ A;  3JTJ A;  3Q7U A;  1JYK A;  4Y64 A;  3DJ4 A;  1TVY A;  1ZCT A; 
#chains in the Genus database with same CATH topology
 4O6M A;  1ZJ2 A;  4CJB A;  1ON8 A;  5CQL X;  1V84 A;  5C3D A;  4Y7F A;  3U2U A;  1MP3 A;  2A8U A;  1S4P A;  4KRV A;  3R2W A;  2ZU7 A;  4JD0 A;  5HS2 A;  3SXA A;  4O6N A;  4FRB A;  1H3M A;  4HOC A;  2JCL A;  2P73 A;  1G97 A;  1KWS A;  3V91 A;  2ICY A;  3GUE A;  5FV9 A;  4M2A A;  3TQD A;  2QH5 A;  2RIY A;  1VGU A;  4AAW A;  2Q4J A;  1MP5 A;  1GX4 A;  2RJ9 A;  5FTV A;  2XWL A;  3V0P A;  1XHB A;  5FTS A;  1H5T A;  2WAW A;  4LW6 A;  1FR8 A;  3E25 A;  5CMG X;  4P00 A;  1ZI5 A;  5IDS A;  3OH0 A;  2BO6 A;  3RSB A;  4DEC A;  2P72 A;  1GWV A;  2X65 A;  4M28 A;  1ZJP A;  1H7F A;  1H7H A;  1V82 A;  2FFU A;  4R7P A;  2QGI A;  2AM4 A;  4C2S A;  1LZ0 A;  1ZI3 A;  4JIS A;  1R7Y A;  1Z90 A;  2A8W A;  2MZB A;  3F1Y A;  4Y7V A;  1SS9 A;  1FZW A;  1R7U A;  1VGT A;  4FCE A;  4KXO A;  1GWW A;  4Y6U A;  3JUJ A;  1W57 A;  1G23 A;  5AJO A;  2RJ0 A;  2FY7 A;  1ON6 A;  1ZHJ A;  2VXM A;  2RIZ A;  4FCU A;  2WGZ A;  4KC4 A;  1HM9 A;  2PGV A;  1QGQ A;  2FYC B;  3LW6 A;  5CQM X;  3OH2 A;  3BRK X;  1GQ9 A;  3Q4S A;  4ASJ A;  4EEG A;  1VZX A;  2AE7 A;  1G3L A;  3I0D A;  4HO6 A;  4KC1 A;  1JYL A;  3V0M A;  4CJC A;  4Y7U A;  3DUV A;  3I0C A;  4B2X A;  5D91 A;  2O1G A;  4KPX A;  1H5R B;  5CQO A;  2J0A A;  1FXO A;  3IOH A;  4EEA A;  3D8V A;  2YC5 A;  2YCM A;  3V8Z A;  1ZJ0 A;  4EE3 A;  2APC A;  2GGO A;  2I7B A;  2Y4M A;  3Q80 A;  2WVL A;  2WE9 A;  1VPA A;  1MC3 A;  1ZCV A;  4B3U A;  1NKH B;  5CQP A;  1LVW A;  1GQC A;  4B4M A;  3EE5 A;  4HCQ A;  1LL0 A;  4Q7C A;  4XWI A;  1TW5 A;  4UEG A;  1S4O A;  4M2B A;  3T7N A;  3V0L A;  2JCK A;  4B4G A;  1LL3 A;  1ZJ3 A;  2OI6 A;  3JUK A;  3FWW A;  4ARW A;  3TZT A;  1INI A;  2V0J A;  2YQH A;  2X5S A;  2VS5 A;  3U2X A;  4FRM A;  2O1H A;  1ZDG A;  4B5B A;  2I5E A;  2V0I A;  4CVH A;  2Y4K A;  1G9R A;  5IDT A;  1H4E A;  3U2V A;  3CKV A;  1WSZ A;  1NQI B;  2UX8 A;  4AYL A;  3V0N A;  4M4K A;  2AES A;  1R81 A;  2YES A;  5BXC A;  1H7G A;  3OAM A;  2ZU9 A;  3I0H A;  2Z86 A;  4D0Z A;  3T7O A;  1I52 A;  2YQJ A;  3RMW A;  2AGD A;  3RMV A;  4AC3 A;  3O3P A;  1GA8 A;  4YS8 A;  3OH3 A;  5FU8 A;  4AYJ A;  1OMZ A;  2DPW A;  5AJP A;  1NHE B;  4MND A;  4EVW A;  2E8B A;  5FUH A;  1H7T A;  1OQM B;  1FO9 A;  5C47 A;  3V8Y A;  2XWM A;  4MIX A;  1EZI A;  2RIX A;  3U2W A;  4FRP A;  1JVG A;  3T7M A;  1LZJ A;  4FRH A;  4ASY A;  1H7L A;  1G1L A;  3PNN A;  3U0X A;  4KNX A;  4FRL A;  2BO4 A;  4K6R A;  2E3D A;  4FIX A;  3OGZ A;  4FRE A;  1O7Q A;  1NF5 B;  3CU0 A;  4EEO A;  5C8R A;  1XZ6 A;  3FOQ A;  1H5S D;  5J49 A;  1S4N A;  4BMA A;  4FRQ A;  3QVB A;  1FRW A;  1VGZ A;  4Y7G A;  1E5K A;  1OMX A;  5C4E A;  4NAN A;  4HO3 A;  2AM3 A;  3SXD A;  1FG5 N;  2RJ1 A;  2Y7A A;  2I5K A;  2YQS A;  2PA4 A;  4HO8 A;  5D92 A;  2VK9 A;  2X60 A;  3K8E A;  3CKN A;  2W0W A;  1NWG B;  1NMM B;  4LW3 A;  2WEE A;  1QWJ A;  1WT3 A;  1TZF A;  2BO8 A;  2BO7 A;  4HO0 A;  1HJJ A;  4HO5 A;  3SXC A;  5I1F A;  5DDV A;  5C1G A;  2ZU8 A;  2W0V A;  2Y6P A;  2XME A;  1G95 A;  2XMH A;  3U2T A;  5C48 A;  3SX5 A;  1O7O A;  4HO9 A;  4KC2 A;  3SX7 A;  1R82 A;  4ZDQ A;  2AH9 A;  1G2V A;  3NGW A;  1LZ7 A;  2RJ5 A;  4HG6 A;  1PZT A;  1H5R A;  3CGX A;  1H7E A;  4P02 A;  4D48 A;  4D11 A;  1HJL A;  3BCV A;  1R7V A;  2XWN A;  4KPZ A;  4J18 A;  2ICX A;  1HV9 A;  5DDT A;  1HM8 A;  2D7I A;  3SX3 A;  5CMJ A;  4FQW A;  4FRO A;  1VIC A;  4DE7 A;  4B4B A;  3OH1 A;  2X5Z A;  1TW1 A;  3R3I A;  1WT0 A;  4IRP A;  5EJZ A;  3ZLK A;  4G3P A;  4BQH A;  5C3B A;  1WT2 A;  4Y63 A;  2VSI A;  3V0O A;  1FOA A;  5AJN A;  2JCO A;  2PX7 A;  4D11 C;  5C36 A;  2RJ8 A;  2J0B A;  1YRO B;  2OI5 A;  3ZGF A;  5CMF X;  2C0N A;  5C1L A;  1FR9 A;  1PZY B;  4FIY A;  1VM8 A;  3CKJ A;  1IIN A;  1EYR A;  4IRQ A;  1VZU A;  4KT7 A;  2AEC A;  1O0R A;  5C3A A;  1H5T B;  1H4D A;  2GGQ A;  4Y62 A;  5CMI A;  3USR A;  5JQQ A;  4KQL A;  4ECM A;  2WVM A;  3OC9 A;  3I0G A;  3IOI A;  4KNR A;  3V0Q A;  3V90 A;  1ZI4 A;  4FRD A;  3K8D A;  1G0R A;  3SXG A;  1QGS A;  4CJ8 A;  1V83 A;  4HO2 A;  5CQN X;  2WVK A;  2RJ7 A;  3DK5 A;  5C4D A;  3U0Y A;  5C49 A;  2Y4J A;  4FRA A;  2AM5 A;  1G8O A;  2OEF A;  3I0J A;  4G87 A;  3ZLL A;  1H5S B;  2P6W A;  1GX0 A;  1VGW A;  4EE4 A;  5FU0 A;  2VXL A;  4EE5 A;  3OH4 A;  1ZI1 A;  3KIA A;  2RJ6 A;  1JV3 A;  2JCJ A;  5CMH A;  3SX8 A;  1LZI A;  1FXJ A;  2V0H A;  3E26 A;  1ZDF A;  1ZJ1 A;  2FYB A;  3CKQ A;  1IIM A;  1R7X A;  3OKR A;  1R7T A;  1YP2 A;  4Y7T A;  1W77 A;  1WT1 A;  4MYB A;  1ZIZ A;  2O1F A;  3I0F A;  1ZJO A;  2CU2 A;  5IFY A;  5FYE A;  1O23 B;  1H5S A;  1ZCU A;  3POL A;  4NAL A;  1FGX A;  2FFV A;  1H7Q A;  2VD4 A;  2FYA A;  4E1K A;  3USQ A;  1VH3 A;  1YP3 A;  3I0E A;  1JV1 A;  4GBP A;  3CKO A;  1LL2 A;  1FGG A;  5EIY A;  4G3Q A;  3I0I X;  2V0L A;  5C4C A;  3F1C A;  4L41 C;  1FO8 A;  3ST8 A;  2YQC A;  3PKQ A;  3SPT A;  1JVD A;  1ZCY A;  1R80 A;  3SXB A;  4D0T A;  1INJ A;  3ZGG A;  3SXE A;  3ZF8 A;  4Y9X A;  4G3S A;  1H4C A;  5C4B A;  1FWY A;  2YC3 A;  3I0K A;  1H5S C;  4B2W A;  1K4V A;  4HO4 A;  2VFZ A;  2V0K A;  5L6V A;  1G93 A;  3D5N A;  5C1H A;  4EEM A;  3N9W A;  2QKX A;  2OI7 A;  2RIT A;  1WVC A;  2Z87 A;  4Y6N A;  5C38 A;  2FYD B;  4DDZ A;  2NXV A;  3PKP A;  1YP4 A;  2OEG A;  2RJ4 A;  2PGY A;  4B42 A;  2D0J A;  2VSH A;  3I0L A;  3HL3 A;  1QG8 A;  4NAK A;  5L6S A;  1MP4 A;  1HM0 A;  3D98 A;  1VZT A;  2D7R A;  2Y4L A;  4NAI A;  5EJ1 A;  1VH1 A;  2VS4 A;  5C4F A;  1W55 A;  2VS3 A;  3IOJ A;  3JTJ A;  3Q7U A;  1JYK A;  4Y64 A;  3DJ4 A;  1TVY A;  1ZCT A; 
#chains in the Genus database with same CATH homology
 4O6M A;  1ZJ2 A;  4CJB A;  1ON8 A;  5CQL X;  1V84 A;  5C3D A;  4Y7F A;  3U2U A;  1MP3 A;  2A8U A;  1S4P A;  4KRV A;  3R2W A;  2ZU7 A;  4JD0 A;  5HS2 A;  3SXA A;  4O6N A;  4FRB A;  1H3M A;  4HOC A;  2JCL A;  2P73 A;  1G97 A;  1KWS A;  3V91 A;  2ICY A;  3GUE A;  5FV9 A;  4M2A A;  3TQD A;  2QH5 A;  2RIY A;  1VGU A;  4AAW A;  2Q4J A;  1MP5 A;  1GX4 A;  2RJ9 A;  5FTV A;  2XWL A;  3V0P A;  1XHB A;  5FTS A;  1H5T A;  2WAW A;  4LW6 A;  1FR8 A;  3E25 A;  5CMG X;  4P00 A;  1ZI5 A;  5IDS A;  3OH0 A;  2BO6 A;  3RSB A;  4DEC A;  2P72 A;  1GWV A;  2X65 A;  4M28 A;  1ZJP A;  1H7F A;  1H7H A;  1V82 A;  2FFU A;  4R7P A;  2QGI A;  2AM4 A;  4C2S A;  1LZ0 A;  1ZI3 A;  4JIS A;  1R7Y A;  1Z90 A;  2A8W A;  2MZB A;  3F1Y A;  4Y7V A;  1SS9 A;  1FZW A;  1R7U A;  1VGT A;  4FCE A;  4KXO A;  1GWW A;  4Y6U A;  3JUJ A;  1W57 A;  1G23 A;  5AJO A;  2RJ0 A;  2FY7 A;  1ON6 A;  1ZHJ A;  2VXM A;  2RIZ A;  4FCU A;  2WGZ A;  4KC4 A;  1HM9 A;  2PGV A;  1QGQ A;  2FYC B;  3LW6 A;  5CQM X;  3OH2 A;  3BRK X;  1GQ9 A;  3Q4S A;  4ASJ A;  4EEG A;  1VZX A;  2AE7 A;  1G3L A;  3I0D A;  4HO6 A;  4KC1 A;  1JYL A;  3V0M A;  4CJC A;  4Y7U A;  3DUV A;  3I0C A;  4B2X A;  5D91 A;  2O1G A;  4KPX A;  1H5R B;  5CQO A;  2J0A A;  1FXO A;  3IOH A;  4EEA A;  3D8V A;  2YC5 A;  2YCM A;  3V8Z A;  1ZJ0 A;  4EE3 A;  2APC A;  2GGO A;  2I7B A;  2Y4M A;  3Q80 A;  2WVL A;  2WE9 A;  1VPA A;  1MC3 A;  1ZCV A;  4B3U A;  1NKH B;  5CQP A;  1LVW A;  1GQC A;  4B4M A;  3EE5 A;  4HCQ A;  1LL0 A;  4Q7C A;  4XWI A;  1TW5 A;  4UEG A;  1S4O A;  4M2B A;  3T7N A;  3V0L A;  2JCK A;  4B4G A;  1LL3 A;  1ZJ3 A;  2OI6 A;  3JUK A;  3FWW A;  4ARW A;  3TZT A;  1INI A;  2V0J A;  2YQH A;  2X5S A;  2VS5 A;  3U2X A;  4FRM A;  2O1H A;  1ZDG A;  4B5B A;  2I5E A;  2V0I A;  4CVH A;  2Y4K A;  1G9R A;  5IDT A;  1H4E A;  3U2V A;  3CKV A;  1WSZ A;  1NQI B;  2UX8 A;  4AYL A;  3V0N A;  4M4K A;  2AES A;  1R81 A;  2YES A;  5BXC A;  1H7G A;  3OAM A;  2ZU9 A;  3I0H A;  2Z86 A;  4D0Z A;  3T7O A;  1I52 A;  2YQJ A;  3RMW A;  2AGD A;  3RMV A;  4AC3 A;  3O3P A;  1GA8 A;  4YS8 A;  3OH3 A;  5FU8 A;  4AYJ A;  1OMZ A;  2DPW A;  5AJP A;  1NHE B;  4MND A;  4EVW A;  2E8B A;  5FUH A;  1H7T A;  1OQM B;  1FO9 A;  5C47 A;  3V8Y A;  2XWM A;  4MIX A;  1EZI A;  2RIX A;  3U2W A;  4FRP A;  1JVG A;  3T7M A;  1LZJ A;  4FRH A;  4ASY A;  1H7L A;  1G1L A;  3PNN A;  3U0X A;  4KNX A;  4FRL A;  2BO4 A;  4K6R A;  2E3D A;  4FIX A;  3OGZ A;  4FRE A;  1O7Q A;  1NF5 B;  3CU0 A;  4EEO A;  5C8R A;  1XZ6 A;  3FOQ A;  1H5S D;  5J49 A;  1S4N A;  4BMA A;  4FRQ A;  3QVB A;  1FRW A;  1VGZ A;  4Y7G A;  1E5K A;  1OMX A;  5C4E A;  4NAN A;  4HO3 A;  2AM3 A;  3SXD A;  1FG5 N;  2RJ1 A;  2Y7A A;  2I5K A;  2YQS A;  2PA4 A;  4HO8 A;  5D92 A;  2VK9 A;  2X60 A;  3K8E A;  3CKN A;  2W0W A;  1NWG B;  1NMM B;  4LW3 A;  2WEE A;  1QWJ A;  1WT3 A;  1TZF A;  2BO8 A;  2BO7 A;  4HO0 A;  1HJJ A;  4HO5 A;  3SXC A;  5I1F A;  5DDV A;  5C1G A;  2ZU8 A;  2W0V A;  2Y6P A;  2XME A;  1G95 A;  2XMH A;  3U2T A;  5C48 A;  3SX5 A;  1O7O A;  4HO9 A;  4KC2 A;  3SX7 A;  1R82 A;  4ZDQ A;  2AH9 A;  1G2V A;  3NGW A;  1LZ7 A;  2RJ5 A;  4HG6 A;  1PZT A;  1H5R A;  3CGX A;  1H7E A;  4P02 A;  4D48 A;  4D11 A;  1HJL A;  3BCV A;  1R7V A;  2XWN A;  4KPZ A;  4J18 A;  2ICX A;  1HV9 A;  5DDT A;  1HM8 A;  2D7I A;  3SX3 A;  5CMJ A;  4FQW A;  4FRO A;  1VIC A;  4DE7 A;  4B4B A;  3OH1 A;  2X5Z A;  1TW1 A;  3R3I A;  1WT0 A;  4IRP A;  5EJZ A;  3ZLK A;  4G3P A;  4BQH A;  5C3B A;  1WT2 A;  4Y63 A;  2VSI A;  3V0O A;  1FOA A;  5AJN A;  2JCO A;  2PX7 A;  4D11 C;  5C36 A;  2RJ8 A;  2J0B A;  1YRO B;  2OI5 A;  3ZGF A;  5CMF X;  2C0N A;  5C1L A;  1FR9 A;  1PZY B;  4FIY A;  1VM8 A;  3CKJ A;  1IIN A;  1EYR A;  4IRQ A;  1VZU A;  4KT7 A;  2AEC A;  1O0R A;  5C3A A;  1H5T B;  1H4D A;  2GGQ A;  4Y62 A;  5CMI A;  3USR A;  5JQQ A;  4KQL A;  4ECM A;  2WVM A;  3OC9 A;  3I0G A;  3IOI A;  4KNR A;  3V0Q A;  3V90 A;  1ZI4 A;  4FRD A;  3K8D A;  1G0R A;  3SXG A;  1QGS A;  4CJ8 A;  1V83 A;  4HO2 A;  5CQN X;  2WVK A;  2RJ7 A;  3DK5 A;  5C4D A;  3U0Y A;  5C49 A;  2Y4J A;  4FRA A;  2AM5 A;  1G8O A;  2OEF A;  3I0J A;  4G87 A;  3ZLL A;  1H5S B;  2P6W A;  1GX0 A;  1VGW A;  4EE4 A;  5FU0 A;  2VXL A;  4EE5 A;  3OH4 A;  1ZI1 A;  3KIA A;  2RJ6 A;  1JV3 A;  2JCJ A;  5CMH A;  3SX8 A;  1LZI A;  1FXJ A;  2V0H A;  3E26 A;  1ZDF A;  1ZJ1 A;  2FYB A;  3CKQ A;  1IIM A;  1R7X A;  3OKR A;  1R7T A;  1YP2 A;  4Y7T A;  1W77 A;  1WT1 A;  4MYB A;  1ZIZ A;  2O1F A;  3I0F A;  1ZJO A;  2CU2 A;  5IFY A;  5FYE A;  1O23 B;  1H5S A;  1ZCU A;  3POL A;  4NAL A;  1FGX A;  2FFV A;  1H7Q A;  2VD4 A;  2FYA A;  4E1K A;  3USQ A;  1VH3 A;  1YP3 A;  3I0E A;  1JV1 A;  4GBP A;  3CKO A;  1LL2 A;  1FGG A;  5EIY A;  4G3Q A;  3I0I X;  2V0L A;  5C4C A;  3F1C A;  4L41 C;  1FO8 A;  3ST8 A;  2YQC A;  3PKQ A;  3SPT A;  1JVD A;  1ZCY A;  1R80 A;  3SXB A;  4D0T A;  1INJ A;  3ZGG A;  3SXE A;  3ZF8 A;  4Y9X A;  4G3S A;  1H4C A;  5C4B A;  1FWY A;  2YC3 A;  3I0K A;  1H5S C;  4B2W A;  1K4V A;  4HO4 A;  2VFZ A;  2V0K A;  5L6V A;  1G93 A;  3D5N A;  5C1H A;  4EEM A;  3N9W A;  2QKX A;  2OI7 A;  2RIT A;  1WVC A;  2Z87 A;  4Y6N A;  5C38 A;  2FYD B;  4DDZ A;  2NXV A;  3PKP A;  1YP4 A;  2OEG A;  2RJ4 A;  2PGY A;  4B42 A;  2D0J A;  2VSH A;  3I0L A;  3HL3 A;  1QG8 A;  4NAK A;  5L6S A;  1MP4 A;  1HM0 A;  3D98 A;  1VZT A;  2D7R A;  2Y4L A;  4NAI A;  5EJ1 A;  1VH1 A;  2VS4 A;  5C4F A;  1W55 A;  2VS3 A;  3IOJ A;  3JTJ A;  3Q7U A;  1JYK A;  4Y64 A;  3DJ4 A;  1TVY A;  1ZCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...