1NWGB

Beta-1,4-galactosyltransferase complex with alpha-lactalbumin and n-butanoyl-glucoamine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lactalbumin
publication title ALPHA-LACTALBUMIN (LA) STIMULATES MILK BETA-1,4-GALACTOSYLTRANSFERASE I (BETA 4GAL-T1) TO TRANSFER GLUCOSE FROM UDP-GLUCOSE TO N-ACETYLGLUCOSAMINE. CRYSTAL STRUCTURE OF BETA 4GAL-T1 X LA COMPLEX WITH UDP-GLC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase activator/transferase
total genus 91
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nwgB00
1Z90A 5C3AA 3R3IA 1V83A 3U2TA 1FXOA 1ZCUA 1ZJ0A 2OEGA 1H4CA 2RJ4A 3EE5A 3R2WA 4XWIA 1VICA 3CKOA 3N9WA 1HM9A 1ZJPA 4GBPA 1ZI3A 4BQHA 2WE9A 2ICXA 1ZJ2A 2YQHA 5DDTA 2PGVA 2VXMA 3Q4SA 1H5RB 1H7QA 4D0ZA 2PGYA 1OQMB 4FRMA 2AECA 3QVBA 1NKHB 2YCMA 5C36A 1GX4A 5C8RA 2QH5A 1NHEB 3V0QA 3V90A 1G0RA 4HO5A 2YESA 1IIMA 1V84A 4J18A 1HJJA 4M2BA 4BMAA 1ZCVA 4G3PA 2RJ8A 2X60A 3ZGFA 2VFZA 2FYDB 2O1FA 5FYEA 5HS2A 3V91A 4NANA 4B5BA 1R7VA 3OGZA 2AGDA 2BO4A 5CMIA 2AH9A 3K8EA 1WT2A 1GQCA 4EE3A 1JVDA 2FYBA 2UX8A 2VXLA 4Y7VA 2RIYA 1H5TB 3ZLLA 4B42A 3FWWA 4IRQA 5C1LA 1VGZA 1R7YA 4MYBA 1VH3A 5FTVA 1R82A 1SS9A 4Y64A 4FQWA 2I7BA 1VZTA 1O7OA 2QGIA 4L41C 3V0OA 2W0WA 2RITA 4HO6A 4NAIA 5CQMX 5C3BA 4K6RA 3SX8A 1ZJOA 3U2WA 3ZGGA 1H5SB 3E26A 3SXEA 4EEAA 2Y4KA 1H3MA 3USQA 5C48A 2JCKA 5C3DA 5IFYA 3SXCA 1FGXA 2ZU9A 4ASYA 3SPTA 4FROA 2V0LA 4B2WA 3T7NA 5CQPA 3I0FA 1ON6A 3I0KA 2FFUA 1IINA 1GWWA 3F1YA 1INIA 3E25A 5C4CA 4HO8A 3RMWA 1G8OA 3USRA 5FTSA 3U0XA 5AJOA 1GX0A 3BCVA 5CMHA 1LZ7A 5C1HA 4LW6A 3O3PA 4C2SA 1S4PA 2VD4A 1VGTA 1H7HA 3OAMA 1K4VA 4AYJA 3OH0A 2RJ9A 3PNNA 1G1LA 5J49A 1YROB 4D0TA 2CU2A 2WGZA 4FRBA 2OEFA 2RJ7A 1NWGB 2ICYA 4LW3A 4HCQA 3OKRA 2RJ0A 2VSIA 2P6WA 1S4OA 1I52A 3OH3A 2PX7A 3U2UA 5CQNX 1LL3A 2FY7A 1G97A 2QKXA 4FRAA 4E1KA 2AESA 5C47A 3V8YA 1FG5N 2Y6PA 2AM4A 1QG8A 1EYRA 4CJ8A 5C38A 2X5SA 2O1HA 1INJA 2I5KA 1MP5A 1XHBA 3SXBA 2AM5A 5L6SA 1O7QA 4FRLA 1FRWA 1R80A 1PZTA 4FCUA 2VSHA 1QGSA 4EEOA 2P73A 3T7MA 1G9RA 2YC3A 1LZJA 3CU0A 1ZDFA 1QWJA 4ARWA 5C4BA 4HOCA 4Y7TA 1H5RA 4FREA 2JCOA 4CVHA 2ZU7A 4Y6UA 1HM0A 4YS8A 2XMEA 4FRDA 2OI5A 4KPXA 1ON8A 4ZDQA 4UEGA 1LL0A 5IDTA 2NXVA 2Y4MA 4B4GA 1H7GA 2OI6A 4HG6A 5CMFX 1TW5A 4AC3A 1FO8A 1ZJ1A 1HV9A 3LW6A 1LZIA 3I0CA 4M28A 5AJNA 3PKQA 2GGQA 2X65A 5C4DA 4JD0A 3TZTA 3ZF8A 3Q7UA 3SXAA 1V82A 1VZUA 1E5KA 1JV1A 1LZ0A 4HO4A 3CKQA 3SX7A 3CKNA 1W57A 1XZ6A 3V0PA 1H4EA 3SX3A 1EZIA 1FGGA 2APCA 4KC4A 2RIZA 2OI7A 4FRHA 2PA4A 5L6VA 5FU8A 2D7IA 3OH4A 3Q80A 1OMXA 3OH1A 1HJLA 4HO3A 3JTJA 1WT3A 2D7RA 3DUVA 1H5SA 4ASJA 2Z86A 2XWNA 1ZDGA 2DPWA 2ZU8A 1H4DA 3KIAA 1NF5B 1OMZA 1ZI1A 2YQCA 2Y4JA 1YP3A 2GGOA 2RIXA 3D5NA 3SX5A 4Y7FA 1G23A 1S4NA 1YP2A 2X5ZA 2JCJA 3POLA 3K8DA 1ZIZA 2FYCB 4AAWA 3HL3A 2D0JA 1G95A 4EEMA 1R7UA 5C4FA 1WT0A 2WVKA 4DDZA 4HO0A 1VM8A 2WVMA 1FXJA 1GQ9A 2W0VA 3NGWA 4CJCA 3RSBA 1ZI4A 3I0JA 4G3QA 1GWVA 2MZBA 1VZXA 3DJ4A 4KT7A 4B4BA 5CMGX 4M4KA 2XWMA 5CMJA 1LL2A 3JUKA 1WSZA 2YQJA 3I0DA 3U2VA 3V0LA 1LVWA 2VS3A 4HO2A 3RMVA 4Y9XA 1TZFA 1TW1A 2XWLA 3V0MA 1O0RA 5CQLX 2YC5A 1ZHJA 3OC9A 3V8ZA 4KQLA 4EE5A 5BXCA 2Q4JA 1ZI5A 2Y7AA 1ZCYA 4FCEA 1R7TA 3CGXA 4IRPA 1VGWA 4P00A 1KWSA 3PKPA 3SXGA 1G2VA 1WVCA 4D11C 2V0KA 4B3UA 3T7OA 5C1GA 1JYLA 3BRKX 4EEGA 1FWYA 1JYKA 2RJ6A 2JCLA 3V0NA 4JISA 4M2AA 3I0IX 5EJZA 1NMMB 1GA8A 1G3LA 2WEEA 4EVWA 4FRQA 2A8WA 2V0HA 1VGUA 2AE7A 2E3DA 2RJ5A 3U0YA 1MP3A 1FR9A 4Y7UA 1FR8A 5IDSA 4D11A 3I0EA 5FV9A 4DECA 1YP4A 4MNDA 4KC2A 4Y7GA 1ZJ3A 2Z87A 2RJ1A 5JQQA 1H5SC 1R81A 2Y4LA 4P02A 1QGQA 1VH1A 4Y63A 4B2XA 4KNRA 3I0HA 4KNXA 1R7XA 3DK5A 3GUEA 3D98A 3F1CA 4G87A 5I1FA 1MC3A 3CKJA 1H5TA 5EJ1A 1H7EA 2AM3A 2I5EA 4FRPA 4B4MA 4KC1A 2YQSA 4ECMA 4D48A 1W55A 1FO9A 1PZYB 3IOIA 4NALA 3U2XA 1FOAA 1W77A 1HM8A 4CJBA 3IOHA 4HO9A 2P72A 1FZWA 1WT1A 5CQOA 2A8UA 3CKVA 4Y6NA 1G93A 2XMHA 4DE7A 5C4EA 1TVYA 2VS5A 1MP4A 4KXOA 2E8BA 2BO6A 4NAKA 2O1GA 3FOQA 5EIYA 2WVLA 2FFVA 2BO8A 1JVGA 2V0JA 2FYAA 1NQIB 4G3SA 4KRVA 3I0LA 3SXDA 3ZLKA 4EE4A 1ZCTA 4R7PA 5C49A 1H7FA 2V0IA 4Y62A 3OH2A 3D8VA 1VPAA 3IOJA 1H7LA 3I0GA 4AYLA 3ST8A 3TQDA 2WAWA 1O23B 5FU0A 5AJPA 5FUHA 3JUJA 4KPZA 1JV3A 2BO7A 1H7TA 1H5SD 5DDVA 2VS4A
chains in the Genus database with same CATH superfamily
1Z90A 5C3AA 3R3IA 1V83A 3U2TA 1FXOA 1ZCUA 1ZJ0A 2OEGA 1H4CA 2RJ4A 3EE5A 3R2WA 4XWIA 1VICA 3CKOA 3N9WA 1HM9A 1ZJPA 4GBPA 1ZI3A 4BQHA 2WE9A 2ICXA 1ZJ2A 2YQHA 5DDTA 2PGVA 2VXMA 3Q4SA 1H5RB 1H7QA 4D0ZA 2PGYA 1OQMB 4FRMA 2AECA 3QVBA 4Q7CA 1NKHB 2YCMA 5C36A 1GX4A 5C8RA 2QH5A 1NHEB 3V0QA 3V90A 1G0RA 4HO5A 2YESA 1IIMA 1V84A 4J18A 1HJJA 4M2BA 4BMAA 1ZCVA 4G3PA 2RJ8A 2X60A 3ZGFA 2VFZA 2FYDB 2O1FA 5FYEA 5HS2A 3V91A 4NANA 4B5BA 1R7VA 3OGZA 2AGDA 2BO4A 5CMIA 2AH9A 3K8EA 1WT2A 1GQCA 4EE3A 1JVDA 2FYBA 2UX8A 2VXLA 4Y7VA 2RIYA 1H5TB 3ZLLA 4B42A 3FWWA 4IRQA 5C1LA 1VGZA 1R7YA 4MYBA 1VH3A 5FTVA 1R82A 1SS9A 4Y64A 4FQWA 2I7BA 1VZTA 1O7OA 2QGIA 4L41C 3V0OA 2W0WA 2RITA 4HO6A 4NAIA 5CQMX 5C3BA 4K6RA 3SX8A 1ZJOA 3U2WA 3ZGGA 1H5SB 3E26A 3SXEA 4EEAA 2Y4KA 1H3MA 3USQA 5C48A 2JCKA 5C3DA 5IFYA 3SXCA 1FGXA 2ZU9A 4ASYA 3SPTA 2C0NA 4FROA 2V0LA 4B2WA 3T7NA 5CQPA 3I0FA 1ON6A 3I0KA 2FFUA 1IINA 1GWWA 3F1YA 1INIA 3E25A 5C4CA 4HO8A 3RMWA 1G8OA 3USRA 5FTSA 3U0XA 5AJOA 1GX0A 3BCVA 5CMHA 1LZ7A 5C1HA 4LW6A 3O3PA 4C2SA 1S4PA 2VD4A 1VGTA 1H7HA 3OAMA 1K4VA 4O6NA 4AYJA 3OH0A 2RJ9A 3PNNA 1G1LA 5J49A 1YROB 4D0TA 2CU2A 2WGZA 4FRBA 2OEFA 2RJ7A 1NWGB 2ICYA 4LW3A 4HCQA 3OKRA 4O6MA 2RJ0A 2VSIA 2P6WA 1S4OA 1I52A 2J0AA 3OH3A 2PX7A 3U2UA 5CQNX 1LL3A 2FY7A 1G97A 2QKXA 4FRAA 4E1KA 2AESA 5C47A 3V8YA 1FG5N 2Y6PA 2AM4A 1QG8A 1EYRA 4CJ8A 5C38A 2X5SA 2O1HA 1INJA 2I5KA 1MP5A 1XHBA 3SXBA 2AM5A 5L6SA 1O7QA 4FRLA 1FRWA 1R80A 1PZTA 4FCUA 2VSHA 1QGSA 4EEOA 2P73A 3T7MA 1G9RA 2YC3A 1LZJA 3CU0A 1ZDFA 1QWJA 4ARWA 5C4BA 4HOCA 4Y7TA 1H5RA 4FREA 2JCOA 4CVHA 2ZU7A 4Y6UA 1HM0A 4YS8A 2XMEA 4FRDA 2OI5A 4KPXA 1ON8A 4ZDQA 4UEGA 1LL0A 5IDTA 2NXVA 2Y4MA 4B4GA 1H7GA 2OI6A 4HG6A 5CMFX 1TW5A 4AC3A 1FO8A 1ZJ1A 1HV9A 3LW6A 1LZIA 3I0CA 4M28A 5AJNA 3PKQA 2GGQA 2X65A 5C4DA 4JD0A 3TZTA 3ZF8A 3Q7UA 3SXAA 1V82A 1VZUA 1E5KA 1JV1A 1LZ0A 4HO4A 3CKQA 3SX7A 3CKNA 1W57A 1XZ6A 3V0PA 1H4EA 3SX3A 1EZIA 1FGGA 2APCA 4KC4A 2RIZA 2OI7A 4FRHA 2PA4A 5L6VA 5FU8A 2D7IA 3OH4A 3Q80A 1OMXA 3OH1A 1HJLA 4HO3A 3JTJA 1WT3A 2D7RA 3DUVA 1H5SA 4ASJA 2Z86A 2XWNA 1ZDGA 2DPWA 2ZU8A 1H4DA 3KIAA 1NF5B 1OMZA 1ZI1A 2YQCA 2Y4JA 1YP3A 2GGOA 2RIXA 3D5NA 3SX5A 4Y7FA 1G23A 1S4NA 1YP2A 2X5ZA 2JCJA 3POLA 3K8DA 1ZIZA 2FYCB 4AAWA 3HL3A 2D0JA 1G95A 4EEMA 1R7UA 5C4FA 1WT0A 2WVKA 4DDZA 4HO0A 1VM8A 2WVMA 1FXJA 1GQ9A 2W0VA 3NGWA 4CJCA 3RSBA 1ZI4A 3I0JA 4G3QA 1GWVA 2MZBA 1VZXA 3DJ4A 4KT7A 4B4BA 5CMGX 4M4KA 2XWMA 5CMJA 1LL2A 3JUKA 1WSZA 2YQJA 3I0DA 3U2VA 3V0LA 1LVWA 2VS3A 4HO2A 3RMVA 4Y9XA 1TZFA 1TW1A 2XWLA 3V0MA 1O0RA 5CQLX 2YC5A 1ZHJA 3OC9A 3V8ZA 4KQLA 4EE5A 5BXCA 2Q4JA 1ZI5A 2Y7AA 1ZCYA 4FCEA 1R7TA 3CGXA 4IRPA 1VGWA 4P00A 1KWSA 3PKPA 3SXGA 1G2VA 1WVCA 4D11C 2V0KA 4B3UA 3T7OA 5C1GA 1JYLA 3BRKX 4EEGA 1FWYA 1JYKA 2RJ6A 2JCLA 3V0NA 4JISA 4M2AA 3I0IX 5EJZA 1NMMB 1GA8A 1G3LA 2WEEA 4EVWA 4FRQA 2A8WA 2V0HA 1VGUA 2AE7A 2E3DA 2RJ5A 3U0YA 1MP3A 1FR9A 4Y7UA 1FR8A 5IDSA 4D11A 3I0EA 5FV9A 4DECA 1YP4A 4MNDA 4KC2A 4Y7GA 1ZJ3A 4FIXA 2Z87A 2RJ1A 5JQQA 1H5SC 1R81A 2Y4LA 5D92A 4P02A 1QGQA 1VH1A 4Y63A 4B2XA 4KNRA 3I0HA 4KNXA 1R7XA 3DK5A 3GUEA 3D98A 3F1CA 4G87A 5D91A 5I1FA 1MC3A 3CKJA 1H5TA 5EJ1A 1H7EA 2AM3A 2I5EA 4FRPA 4B4MA 4KC1A 2YQSA 4ECMA 4D48A 1W55A 1FO9A 1PZYB 3IOIA 4NALA 3U2XA 1FOAA 1W77A 1HM8A 4CJBA 3IOHA 4HO9A 2P72A 1FZWA 1WT1A 5CQOA 2A8UA 3CKVA 2VK9A 4Y6NA 1G93A 2XMHA 4DE7A 5C4EA 1TVYA 2VS5A 1MP4A 4KXOA 2E8BA 2BO6A 4NAKA 2O1GA 3FOQA 5EIYA 4FIYA 2WVLA 2FFVA 2BO8A 1JVGA 2V0JA 2FYAA 1NQIB 4G3SA 4KRVA 3I0LA 3SXDA 3ZLKA 4EE4A 1ZCTA 4R7PA 5C49A 1H7FA 2V0IA 4Y62A 3OH2A 3D8VA 1VPAA 3IOJA 1H7LA 4MIXA 3I0GA 4AYLA 3ST8A 3TQDA 2WAWA 1O23B 5FU0A 5AJPA 5FUHA 3JUJA 4KPZA 2J0BA 1JV3A 2BO7A 1H7TA 1H5SD 5DDVA 2VS4A
chains in the Genus database with same CATH topology
1Z90A 5C3AA 3R3IA 1V83A 3U2TA 1FXOA 1ZCUA 1ZJ0A 2OEGA 1H4CA 2RJ4A 3EE5A 3R2WA 4XWIA 1VICA 3CKOA 3N9WA 1HM9A 1ZJPA 4GBPA 1ZI3A 4BQHA 2WE9A 2ICXA 1ZJ2A 2YQHA 5DDTA 2PGVA 2VXMA 3Q4SA 1H5RB 1H7QA 4D0ZA 2PGYA 1OQMB 4FRMA 2AECA 3QVBA 4Q7CA 1NKHB 2YCMA 5C36A 1GX4A 5C8RA 2QH5A 1NHEB 3V0QA 3V90A 1G0RA 4HO5A 2YESA 1IIMA 1V84A 4J18A 1HJJA 4M2BA 4BMAA 1ZCVA 4G3PA 2RJ8A 2X60A 3ZGFA 2VFZA 2FYDB 2O1FA 5FYEA 5HS2A 3V91A 4NANA 4B5BA 1R7VA 3OGZA 2AGDA 2BO4A 5CMIA 2AH9A 3K8EA 1WT2A 1GQCA 4EE3A 1JVDA 2FYBA 2UX8A 2VXLA 4Y7VA 2RIYA 1H5TB 3ZLLA 4B42A 3FWWA 4IRQA 5C1LA 1VGZA 1R7YA 4MYBA 1VH3A 5FTVA 1R82A 1SS9A 4Y64A 4FQWA 2I7BA 1VZTA 1O7OA 2QGIA 4L41C 3V0OA 2W0WA 2RITA 4HO6A 4NAIA 5CQMX 5C3BA 4K6RA 3SX8A 1ZJOA 3U2WA 3ZGGA 1H5SB 3E26A 3SXEA 4EEAA 2Y4KA 1H3MA 3USQA 5C48A 2JCKA 5C3DA 5IFYA 3SXCA 1FGXA 2ZU9A 4ASYA 3SPTA 2C0NA 4FROA 2V0LA 4B2WA 3T7NA 5CQPA 3I0FA 1ON6A 3I0KA 2FFUA 1IINA 1GWWA 3F1YA 1INIA 3E25A 5C4CA 4HO8A 3RMWA 1G8OA 3USRA 5FTSA 3U0XA 5AJOA 1GX0A 3BCVA 5CMHA 1LZ7A 5C1HA 4LW6A 3O3PA 4C2SA 1S4PA 2VD4A 1VGTA 1H7HA 3OAMA 1K4VA 4O6NA 4AYJA 3OH0A 2RJ9A 3PNNA 1G1LA 5J49A 1YROB 4D0TA 2CU2A 2WGZA 4FRBA 2OEFA 2RJ7A 1NWGB 2ICYA 4LW3A 4HCQA 3OKRA 4O6MA 2RJ0A 2VSIA 2P6WA 1S4OA 1I52A 2J0AA 3OH3A 2PX7A 3U2UA 5CQNX 1LL3A 2FY7A 1G97A 2QKXA 4FRAA 4E1KA 2AESA 5C47A 3V8YA 1FG5N 2Y6PA 2AM4A 1QG8A 1EYRA 4CJ8A 5C38A 2X5SA 2O1HA 1INJA 2I5KA 1MP5A 1XHBA 3SXBA 2AM5A 5L6SA 1O7QA 4FRLA 1FRWA 1R80A 1PZTA 4FCUA 2VSHA 1QGSA 4EEOA 2P73A 3T7MA 1G9RA 2YC3A 1LZJA 3CU0A 1ZDFA 1QWJA 4ARWA 5C4BA 4HOCA 4Y7TA 1H5RA 4FREA 2JCOA 4CVHA 2ZU7A 4Y6UA 1HM0A 4YS8A 2XMEA 4FRDA 2OI5A 4KPXA 1ON8A 4ZDQA 4UEGA 1LL0A 5IDTA 2NXVA 2Y4MA 4B4GA 1H7GA 2OI6A 4HG6A 5CMFX 1TW5A 4AC3A 1FO8A 1ZJ1A 1HV9A 3LW6A 1LZIA 3I0CA 4M28A 5AJNA 3PKQA 2GGQA 2X65A 5C4DA 4JD0A 3TZTA 3ZF8A 3Q7UA 3SXAA 1V82A 1VZUA 1E5KA 1JV1A 1LZ0A 4HO4A 3CKQA 3SX7A 3CKNA 1W57A 1XZ6A 3V0PA 1H4EA 3SX3A 1EZIA 1FGGA 2APCA 4KC4A 2RIZA 2OI7A 4FRHA 2PA4A 5L6VA 5FU8A 2D7IA 3OH4A 3Q80A 1OMXA 3OH1A 1HJLA 4HO3A 3JTJA 1WT3A 2D7RA 3DUVA 1H5SA 4ASJA 2Z86A 2XWNA 1ZDGA 2DPWA 2ZU8A 1H4DA 3KIAA 1NF5B 1OMZA 1ZI1A 2YQCA 2Y4JA 1YP3A 2GGOA 2RIXA 3D5NA 3SX5A 4Y7FA 1G23A 1S4NA 1YP2A 2X5ZA 2JCJA 3POLA 3K8DA 1ZIZA 2FYCB 4AAWA 3HL3A 2D0JA 1G95A 4EEMA 1R7UA 5C4FA 1WT0A 2WVKA 4DDZA 4HO0A 1VM8A 2WVMA 1FXJA 1GQ9A 2W0VA 3NGWA 4CJCA 3RSBA 1ZI4A 3I0JA 4G3QA 1GWVA 2MZBA 1VZXA 3DJ4A 4KT7A 4B4BA 5CMGX 4M4KA 2XWMA 5CMJA 1LL2A 3JUKA 1WSZA 2YQJA 3I0DA 3U2VA 3V0LA 1LVWA 2VS3A 4HO2A 3RMVA 4Y9XA 1TZFA 1TW1A 2XWLA 3V0MA 1O0RA 5CQLX 2YC5A 1ZHJA 3OC9A 3V8ZA 4KQLA 4EE5A 5BXCA 2Q4JA 1ZI5A 2Y7AA 1ZCYA 4FCEA 1R7TA 3CGXA 4IRPA 1VGWA 4P00A 1KWSA 3PKPA 3SXGA 1G2VA 1WVCA 4D11C 2V0KA 4B3UA 3T7OA 5C1GA 1JYLA 3BRKX 4EEGA 1FWYA 1JYKA 2RJ6A 2JCLA 3V0NA 4JISA 4M2AA 3I0IX 5EJZA 1NMMB 1GA8A 1G3LA 2WEEA 4EVWA 4FRQA 2A8WA 2V0HA 1VGUA 2AE7A 2E3DA 2RJ5A 3U0YA 1MP3A 1FR9A 4Y7UA 1FR8A 5IDSA 4D11A 3I0EA 5FV9A 4DECA 1YP4A 4MNDA 4KC2A 4Y7GA 1ZJ3A 4FIXA 2Z87A 2RJ1A 5JQQA 1H5SC 1R81A 2Y4LA 5D92A 4P02A 1QGQA 1VH1A 4Y63A 4B2XA 4KNRA 3I0HA 4KNXA 1R7XA 3DK5A 3GUEA 3D98A 3F1CA 4G87A 5D91A 5I1FA 1MC3A 3CKJA 1H5TA 5EJ1A 1H7EA 2AM3A 2I5EA 4FRPA 4B4MA 4KC1A 2YQSA 4ECMA 4D48A 1W55A 1FO9A 1PZYB 3IOIA 4NALA 3U2XA 1FOAA 1W77A 1HM8A 4CJBA 3IOHA 4HO9A 2P72A 1FZWA 1WT1A 5CQOA 2A8UA 3CKVA 2VK9A 4Y6NA 1G93A 2XMHA 4DE7A 5C4EA 1TVYA 2VS5A 1MP4A 4KXOA 2E8BA 2BO6A 4NAKA 2O1GA 3FOQA 5EIYA 4FIYA 2WVLA 2FFVA 2BO8A 1JVGA 2V0JA 2FYAA 1NQIB 4G3SA 4KRVA 3I0LA 3SXDA 3ZLKA 4EE4A 1ZCTA 4R7PA 5C49A 1H7FA 2V0IA 4Y62A 3OH2A 3D8VA 1VPAA 3IOJA 1H7LA 4MIXA 3I0GA 4AYLA 3ST8A 3TQDA 2WAWA 1O23B 5FU0A 5AJPA 5FUHA 3JUJA 4KPZA 2J0BA 1JV3A 2BO7A 1H7TA 1H5SD 5DDVA 2VS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z90 A;  5C3A A;  3R3I A;  1V83 A;  3U2T A;  1FXO A;  1ZCU A;  1ZJ0 A;  2OEG A;  1H4C A;  2RJ4 A;  3EE5 A;  3R2W A;  4XWI A;  1VIC A;  3CKO A;  3N9W A;  1HM9 A;  1ZJP A;  4GBP A;  1ZI3 A;  4BQH A;  2WE9 A;  2ICX A;  1ZJ2 A;  2YQH A;  5DDT A;  2PGV A;  2VXM A;  3Q4S A;  1H5R B;  1H7Q A;  4D0Z A;  2PGY A;  1OQM B;  4FRM A;  2AEC A;  3QVB A;  1NKH B;  2YCM A;  5C36 A;  1GX4 A;  5C8R A;  2QH5 A;  1NHE B;  3V0Q A;  3V90 A;  1G0R A;  4HO5 A;  2YES A;  1IIM A;  1V84 A;  4J18 A;  1HJJ A;  4M2B A;  4BMA A;  1ZCV A;  4G3P A;  2RJ8 A;  2X60 A;  3ZGF A;  2VFZ A;  2FYD B;  2O1F A;  5FYE A;  5HS2 A;  3V91 A;  4NAN A;  4B5B A;  1R7V A;  3OGZ A;  2AGD A;  2BO4 A;  5CMI A;  2AH9 A;  3K8E A;  1WT2 A;  1GQC A;  4EE3 A;  1JVD A;  2FYB A;  2UX8 A;  2VXL A;  4Y7V A;  2RIY A;  1H5T B;  3ZLL A;  4B42 A;  3FWW A;  4IRQ A;  5C1L A;  1VGZ A;  1R7Y A;  4MYB A;  1VH3 A;  5FTV A;  1R82 A;  1SS9 A;  4Y64 A;  4FQW A;  2I7B A;  1VZT A;  1O7O A;  2QGI A;  4L41 C;  3V0O A;  2W0W A;  2RIT A;  4HO6 A;  4NAI A;  5CQM X;  5C3B A;  4K6R A;  3SX8 A;  1ZJO A;  3U2W A;  3ZGG A;  1H5S B;  3E26 A;  3SXE A;  4EEA A;  2Y4K A;  1H3M A;  3USQ A;  5C48 A;  2JCK A;  5C3D A;  5IFY A;  3SXC A;  1FGX A;  2ZU9 A;  4ASY A;  3SPT A;  4FRO A;  2V0L A;  4B2W A;  3T7N A;  5CQP A;  3I0F A;  1ON6 A;  3I0K A;  2FFU A;  1IIN A;  1GWW A;  3F1Y A;  1INI A;  3E25 A;  5C4C A;  4HO8 A;  3RMW A;  1G8O A;  3USR A;  5FTS A;  3U0X A;  5AJO A;  1GX0 A;  3BCV A;  5CMH A;  1LZ7 A;  5C1H A;  4LW6 A;  3O3P A;  4C2S A;  1S4P A;  2VD4 A;  1VGT A;  1H7H A;  3OAM A;  1K4V A;  4AYJ A;  3OH0 A;  2RJ9 A;  3PNN A;  1G1L A;  5J49 A;  1YRO B;  4D0T A;  2CU2 A;  2WGZ A;  4FRB A;  2OEF A;  2RJ7 A;  1NWG B;  2ICY A;  4LW3 A;  4HCQ A;  3OKR A;  2RJ0 A;  2VSI A;  2P6W A;  1S4O A;  1I52 A;  3OH3 A;  2PX7 A;  3U2U A;  5CQN X;  1LL3 A;  2FY7 A;  1G97 A;  2QKX A;  4FRA A;  4E1K A;  2AES A;  5C47 A;  3V8Y A;  1FG5 N;  2Y6P A;  2AM4 A;  1QG8 A;  1EYR A;  4CJ8 A;  5C38 A;  2X5S A;  2O1H A;  1INJ A;  2I5K A;  1MP5 A;  1XHB A;  3SXB A;  2AM5 A;  5L6S A;  1O7Q A;  4FRL A;  1FRW A;  1R80 A;  1PZT A;  4FCU A;  2VSH A;  1QGS A;  4EEO A;  2P73 A;  3T7M A;  1G9R A;  2YC3 A;  1LZJ A;  3CU0 A;  1ZDF A;  1QWJ A;  4ARW A;  5C4B A;  4HOC A;  4Y7T A;  1H5R A;  4FRE A;  2JCO A;  4CVH A;  2ZU7 A;  4Y6U A;  1HM0 A;  4YS8 A;  2XME A;  4FRD A;  2OI5 A;  4KPX A;  1ON8 A;  4ZDQ A;  4UEG A;  1LL0 A;  5IDT A;  2NXV A;  2Y4M A;  4B4G A;  1H7G A;  2OI6 A;  4HG6 A;  5CMF X;  1TW5 A;  4AC3 A;  1FO8 A;  1ZJ1 A;  1HV9 A;  3LW6 A;  1LZI A;  3I0C A;  4M28 A;  5AJN A;  3PKQ A;  2GGQ A;  2X65 A;  5C4D A;  4JD0 A;  3TZT A;  3ZF8 A;  3Q7U A;  3SXA A;  1V82 A;  1VZU A;  1E5K A;  1JV1 A;  1LZ0 A;  4HO4 A;  3CKQ A;  3SX7 A;  3CKN A;  1W57 A;  1XZ6 A;  3V0P A;  1H4E A;  3SX3 A;  1EZI A;  1FGG A;  2APC A;  4KC4 A;  2RIZ A;  2OI7 A;  4FRH A;  2PA4 A;  5L6V A;  5FU8 A;  2D7I A;  3OH4 A;  3Q80 A;  1OMX A;  3OH1 A;  1HJL A;  4HO3 A;  3JTJ A;  1WT3 A;  2D7R A;  3DUV A;  1H5S A;  4ASJ A;  2Z86 A;  2XWN A;  1ZDG A;  2DPW A;  2ZU8 A;  1H4D A;  3KIA A;  1NF5 B;  1OMZ A;  1ZI1 A;  2YQC A;  2Y4J A;  1YP3 A;  2GGO A;  2RIX A;  3D5N A;  3SX5 A;  4Y7F A;  1G23 A;  1S4N A;  1YP2 A;  2X5Z A;  2JCJ A;  3POL A;  3K8D A;  1ZIZ A;  2FYC B;  4AAW A;  3HL3 A;  2D0J A;  1G95 A;  4EEM A;  1R7U A;  5C4F A;  1WT0 A;  2WVK A;  4DDZ A;  4HO0 A;  1VM8 A;  2WVM A;  1FXJ A;  1GQ9 A;  2W0V A;  3NGW A;  4CJC A;  3RSB A;  1ZI4 A;  3I0J A;  4G3Q A;  1GWV A;  2MZB A;  1VZX A;  3DJ4 A;  4KT7 A;  4B4B A;  5CMG X;  4M4K A;  2XWM A;  5CMJ A;  1LL2 A;  3JUK A;  1WSZ A;  2YQJ A;  3I0D A;  3U2V A;  3V0L A;  1LVW A;  2VS3 A;  4HO2 A;  3RMV A;  4Y9X A;  1TZF A;  1TW1 A;  2XWL A;  3V0M A;  1O0R A;  5CQL X;  2YC5 A;  1ZHJ A;  3OC9 A;  3V8Z A;  4KQL A;  4EE5 A;  5BXC A;  2Q4J A;  1ZI5 A;  2Y7A A;  1ZCY A;  4FCE A;  1R7T A;  3CGX A;  4IRP A;  1VGW A;  4P00 A;  1KWS A;  3PKP A;  3SXG A;  1G2V A;  1WVC A;  4D11 C;  2V0K A;  4B3U A;  3T7O A;  5C1G A;  1JYL A;  3BRK X;  4EEG A;  1FWY A;  1JYK A;  2RJ6 A;  2JCL A;  3V0N A;  4JIS A;  4M2A A;  3I0I X;  5EJZ A;  1NMM B;  1GA8 A;  1G3L A;  2WEE A;  4EVW A;  4FRQ A;  2A8W A;  2V0H A;  1VGU A;  2AE7 A;  2E3D A;  2RJ5 A;  3U0Y A;  1MP3 A;  1FR9 A;  4Y7U A;  1FR8 A;  5IDS A;  4D11 A;  3I0E A;  5FV9 A;  4DEC A;  1YP4 A;  4MND A;  4KC2 A;  4Y7G A;  1ZJ3 A;  2Z87 A;  2RJ1 A;  5JQQ A;  1H5S C;  1R81 A;  2Y4L A;  4P02 A;  1QGQ A;  1VH1 A;  4Y63 A;  4B2X A;  4KNR A;  3I0H A;  4KNX A;  1R7X A;  3DK5 A;  3GUE A;  3D98 A;  3F1C A;  4G87 A;  5I1F A;  1MC3 A;  3CKJ A;  1H5T A;  5EJ1 A;  1H7E A;  2AM3 A;  2I5E A;  4FRP A;  4B4M A;  4KC1 A;  2YQS A;  4ECM A;  4D48 A;  1W55 A;  1FO9 A;  1PZY B;  3IOI A;  4NAL A;  3U2X A;  1FOA A;  1W77 A;  1HM8 A;  4CJB A;  3IOH A;  4HO9 A;  2P72 A;  1FZW A;  1WT1 A;  5CQO A;  2A8U A;  3CKV A;  4Y6N A;  1G93 A;  2XMH A;  4DE7 A;  5C4E A;  1TVY A;  2VS5 A;  1MP4 A;  4KXO A;  2E8B A;  2BO6 A;  4NAK A;  2O1G A;  3FOQ A;  5EIY A;  2WVL A;  2FFV A;  2BO8 A;  1JVG A;  2V0J A;  2FYA A;  1NQI B;  4G3S A;  4KRV A;  3I0L A;  3SXD A;  3ZLK A;  4EE4 A;  1ZCT A;  4R7P A;  5C49 A;  1H7F A;  2V0I A;  4Y62 A;  3OH2 A;  3D8V A;  1VPA A;  3IOJ A;  1H7L A;  3I0G A;  4AYL A;  3ST8 A;  3TQD A;  2WAW A;  1O23 B;  5FU0 A;  5AJP A;  5FUH A;  3JUJ A;  4KPZ A;  1JV3 A;  2BO7 A;  1H7T A;  1H5S D;  5DDV A;  2VS4 A; 
#chains in the Genus database with same CATH topology
 1Z90 A;  5C3A A;  3R3I A;  1V83 A;  3U2T A;  1FXO A;  1ZCU A;  1ZJ0 A;  2OEG A;  1H4C A;  2RJ4 A;  3EE5 A;  3R2W A;  4XWI A;  1VIC A;  3CKO A;  3N9W A;  1HM9 A;  1ZJP A;  4GBP A;  1ZI3 A;  4BQH A;  2WE9 A;  2ICX A;  1ZJ2 A;  2YQH A;  5DDT A;  2PGV A;  2VXM A;  3Q4S A;  1H5R B;  1H7Q A;  4D0Z A;  2PGY A;  1OQM B;  4FRM A;  2AEC A;  3QVB A;  4Q7C A;  1NKH B;  2YCM A;  5C36 A;  1GX4 A;  5C8R A;  2QH5 A;  1NHE B;  3V0Q A;  3V90 A;  1G0R A;  4HO5 A;  2YES A;  1IIM A;  1V84 A;  4J18 A;  1HJJ A;  4M2B A;  4BMA A;  1ZCV A;  4G3P A;  2RJ8 A;  2X60 A;  3ZGF A;  2VFZ A;  2FYD B;  2O1F A;  5FYE A;  5HS2 A;  3V91 A;  4NAN A;  4B5B A;  1R7V A;  3OGZ A;  2AGD A;  2BO4 A;  5CMI A;  2AH9 A;  3K8E A;  1WT2 A;  1GQC A;  4EE3 A;  1JVD A;  2FYB A;  2UX8 A;  2VXL A;  4Y7V A;  2RIY A;  1H5T B;  3ZLL A;  4B42 A;  3FWW A;  4IRQ A;  5C1L A;  1VGZ A;  1R7Y A;  4MYB A;  1VH3 A;  5FTV A;  1R82 A;  1SS9 A;  4Y64 A;  4FQW A;  2I7B A;  1VZT A;  1O7O A;  2QGI A;  4L41 C;  3V0O A;  2W0W A;  2RIT A;  4HO6 A;  4NAI A;  5CQM X;  5C3B A;  4K6R A;  3SX8 A;  1ZJO A;  3U2W A;  3ZGG A;  1H5S B;  3E26 A;  3SXE A;  4EEA A;  2Y4K A;  1H3M A;  3USQ A;  5C48 A;  2JCK A;  5C3D A;  5IFY A;  3SXC A;  1FGX A;  2ZU9 A;  4ASY A;  3SPT A;  2C0N A;  4FRO A;  2V0L A;  4B2W A;  3T7N A;  5CQP A;  3I0F A;  1ON6 A;  3I0K A;  2FFU A;  1IIN A;  1GWW A;  3F1Y A;  1INI A;  3E25 A;  5C4C A;  4HO8 A;  3RMW A;  1G8O A;  3USR A;  5FTS A;  3U0X A;  5AJO A;  1GX0 A;  3BCV A;  5CMH A;  1LZ7 A;  5C1H A;  4LW6 A;  3O3P A;  4C2S A;  1S4P A;  2VD4 A;  1VGT A;  1H7H A;  3OAM A;  1K4V A;  4O6N A;  4AYJ A;  3OH0 A;  2RJ9 A;  3PNN A;  1G1L A;  5J49 A;  1YRO B;  4D0T A;  2CU2 A;  2WGZ A;  4FRB A;  2OEF A;  2RJ7 A;  1NWG B;  2ICY A;  4LW3 A;  4HCQ A;  3OKR A;  4O6M A;  2RJ0 A;  2VSI A;  2P6W A;  1S4O A;  1I52 A;  2J0A A;  3OH3 A;  2PX7 A;  3U2U A;  5CQN X;  1LL3 A;  2FY7 A;  1G97 A;  2QKX A;  4FRA A;  4E1K A;  2AES A;  5C47 A;  3V8Y A;  1FG5 N;  2Y6P A;  2AM4 A;  1QG8 A;  1EYR A;  4CJ8 A;  5C38 A;  2X5S A;  2O1H A;  1INJ A;  2I5K A;  1MP5 A;  1XHB A;  3SXB A;  2AM5 A;  5L6S A;  1O7Q A;  4FRL A;  1FRW A;  1R80 A;  1PZT A;  4FCU A;  2VSH A;  1QGS A;  4EEO A;  2P73 A;  3T7M A;  1G9R A;  2YC3 A;  1LZJ A;  3CU0 A;  1ZDF A;  1QWJ A;  4ARW A;  5C4B A;  4HOC A;  4Y7T A;  1H5R A;  4FRE A;  2JCO A;  4CVH A;  2ZU7 A;  4Y6U A;  1HM0 A;  4YS8 A;  2XME A;  4FRD A;  2OI5 A;  4KPX A;  1ON8 A;  4ZDQ A;  4UEG A;  1LL0 A;  5IDT A;  2NXV A;  2Y4M A;  4B4G A;  1H7G A;  2OI6 A;  4HG6 A;  5CMF X;  1TW5 A;  4AC3 A;  1FO8 A;  1ZJ1 A;  1HV9 A;  3LW6 A;  1LZI A;  3I0C A;  4M28 A;  5AJN A;  3PKQ A;  2GGQ A;  2X65 A;  5C4D A;  4JD0 A;  3TZT A;  3ZF8 A;  3Q7U A;  3SXA A;  1V82 A;  1VZU A;  1E5K A;  1JV1 A;  1LZ0 A;  4HO4 A;  3CKQ A;  3SX7 A;  3CKN A;  1W57 A;  1XZ6 A;  3V0P A;  1H4E A;  3SX3 A;  1EZI A;  1FGG A;  2APC A;  4KC4 A;  2RIZ A;  2OI7 A;  4FRH A;  2PA4 A;  5L6V A;  5FU8 A;  2D7I A;  3OH4 A;  3Q80 A;  1OMX A;  3OH1 A;  1HJL A;  4HO3 A;  3JTJ A;  1WT3 A;  2D7R A;  3DUV A;  1H5S A;  4ASJ A;  2Z86 A;  2XWN A;  1ZDG A;  2DPW A;  2ZU8 A;  1H4D A;  3KIA A;  1NF5 B;  1OMZ A;  1ZI1 A;  2YQC A;  2Y4J A;  1YP3 A;  2GGO A;  2RIX A;  3D5N A;  3SX5 A;  4Y7F A;  1G23 A;  1S4N A;  1YP2 A;  2X5Z A;  2JCJ A;  3POL A;  3K8D A;  1ZIZ A;  2FYC B;  4AAW A;  3HL3 A;  2D0J A;  1G95 A;  4EEM A;  1R7U A;  5C4F A;  1WT0 A;  2WVK A;  4DDZ A;  4HO0 A;  1VM8 A;  2WVM A;  1FXJ A;  1GQ9 A;  2W0V A;  3NGW A;  4CJC A;  3RSB A;  1ZI4 A;  3I0J A;  4G3Q A;  1GWV A;  2MZB A;  1VZX A;  3DJ4 A;  4KT7 A;  4B4B A;  5CMG X;  4M4K A;  2XWM A;  5CMJ A;  1LL2 A;  3JUK A;  1WSZ A;  2YQJ A;  3I0D A;  3U2V A;  3V0L A;  1LVW A;  2VS3 A;  4HO2 A;  3RMV A;  4Y9X A;  1TZF A;  1TW1 A;  2XWL A;  3V0M A;  1O0R A;  5CQL X;  2YC5 A;  1ZHJ A;  3OC9 A;  3V8Z A;  4KQL A;  4EE5 A;  5BXC A;  2Q4J A;  1ZI5 A;  2Y7A A;  1ZCY A;  4FCE A;  1R7T A;  3CGX A;  4IRP A;  1VGW A;  4P00 A;  1KWS A;  3PKP A;  3SXG A;  1G2V A;  1WVC A;  4D11 C;  2V0K A;  4B3U A;  3T7O A;  5C1G A;  1JYL A;  3BRK X;  4EEG A;  1FWY A;  1JYK A;  2RJ6 A;  2JCL A;  3V0N A;  4JIS A;  4M2A A;  3I0I X;  5EJZ A;  1NMM B;  1GA8 A;  1G3L A;  2WEE A;  4EVW A;  4FRQ A;  2A8W A;  2V0H A;  1VGU A;  2AE7 A;  2E3D A;  2RJ5 A;  3U0Y A;  1MP3 A;  1FR9 A;  4Y7U A;  1FR8 A;  5IDS A;  4D11 A;  3I0E A;  5FV9 A;  4DEC A;  1YP4 A;  4MND A;  4KC2 A;  4Y7G A;  1ZJ3 A;  4FIX A;  2Z87 A;  2RJ1 A;  5JQQ A;  1H5S C;  1R81 A;  2Y4L A;  5D92 A;  4P02 A;  1QGQ A;  1VH1 A;  4Y63 A;  4B2X A;  4KNR A;  3I0H A;  4KNX A;  1R7X A;  3DK5 A;  3GUE A;  3D98 A;  3F1C A;  4G87 A;  5D91 A;  5I1F A;  1MC3 A;  3CKJ A;  1H5T A;  5EJ1 A;  1H7E A;  2AM3 A;  2I5E A;  4FRP A;  4B4M A;  4KC1 A;  2YQS A;  4ECM A;  4D48 A;  1W55 A;  1FO9 A;  1PZY B;  3IOI A;  4NAL A;  3U2X A;  1FOA A;  1W77 A;  1HM8 A;  4CJB A;  3IOH A;  4HO9 A;  2P72 A;  1FZW A;  1WT1 A;  5CQO A;  2A8U A;  3CKV A;  2VK9 A;  4Y6N A;  1G93 A;  2XMH A;  4DE7 A;  5C4E A;  1TVY A;  2VS5 A;  1MP4 A;  4KXO A;  2E8B A;  2BO6 A;  4NAK A;  2O1G A;  3FOQ A;  5EIY A;  4FIY A;  2WVL A;  2FFV A;  2BO8 A;  1JVG A;  2V0J A;  2FYA A;  1NQI B;  4G3S A;  4KRV A;  3I0L A;  3SXD A;  3ZLK A;  4EE4 A;  1ZCT A;  4R7P A;  5C49 A;  1H7F A;  2V0I A;  4Y62 A;  3OH2 A;  3D8V A;  1VPA A;  3IOJ A;  1H7L A;  4MIX A;  3I0G A;  4AYL A;  3ST8 A;  3TQD A;  2WAW A;  1O23 B;  5FU0 A;  5AJP A;  5FUH A;  3JUJ A;  4KPZ A;  2J0B A;  1JV3 A;  2BO7 A;  1H7T A;  1H5S D;  5DDV A;  2VS4 A; 
#chains in the Genus database with same CATH homology
 1Z90 A;  5C3A A;  3R3I A;  1V83 A;  3U2T A;  1FXO A;  1ZCU A;  1ZJ0 A;  2OEG A;  1H4C A;  2RJ4 A;  3EE5 A;  3R2W A;  4XWI A;  1VIC A;  3CKO A;  3N9W A;  1HM9 A;  1ZJP A;  4GBP A;  1ZI3 A;  4BQH A;  2WE9 A;  2ICX A;  1ZJ2 A;  2YQH A;  5DDT A;  2PGV A;  2VXM A;  3Q4S A;  1H5R B;  1H7Q A;  4D0Z A;  2PGY A;  1OQM B;  4FRM A;  2AEC A;  3QVB A;  4Q7C A;  1NKH B;  2YCM A;  5C36 A;  1GX4 A;  5C8R A;  2QH5 A;  1NHE B;  3V0Q A;  3V90 A;  1G0R A;  4HO5 A;  2YES A;  1IIM A;  1V84 A;  4J18 A;  1HJJ A;  4M2B A;  4BMA A;  1ZCV A;  4G3P A;  2RJ8 A;  2X60 A;  3ZGF A;  2VFZ A;  2FYD B;  2O1F A;  5FYE A;  5HS2 A;  3V91 A;  4NAN A;  4B5B A;  1R7V A;  3OGZ A;  2AGD A;  2BO4 A;  5CMI A;  2AH9 A;  3K8E A;  1WT2 A;  1GQC A;  4EE3 A;  1JVD A;  2FYB A;  2UX8 A;  2VXL A;  4Y7V A;  2RIY A;  1H5T B;  3ZLL A;  4B42 A;  3FWW A;  4IRQ A;  5C1L A;  1VGZ A;  1R7Y A;  4MYB A;  1VH3 A;  5FTV A;  1R82 A;  1SS9 A;  4Y64 A;  4FQW A;  2I7B A;  1VZT A;  1O7O A;  2QGI A;  4L41 C;  3V0O A;  2W0W A;  2RIT A;  4HO6 A;  4NAI A;  5CQM X;  5C3B A;  4K6R A;  3SX8 A;  1ZJO A;  3U2W A;  3ZGG A;  1H5S B;  3E26 A;  3SXE A;  4EEA A;  2Y4K A;  1H3M A;  3USQ A;  5C48 A;  2JCK A;  5C3D A;  5IFY A;  3SXC A;  1FGX A;  2ZU9 A;  4ASY A;  3SPT A;  2C0N A;  4FRO A;  2V0L A;  4B2W A;  3T7N A;  5CQP A;  3I0F A;  1ON6 A;  3I0K A;  2FFU A;  1IIN A;  1GWW A;  3F1Y A;  1INI A;  3E25 A;  5C4C A;  4HO8 A;  3RMW A;  1G8O A;  3USR A;  5FTS A;  3U0X A;  5AJO A;  1GX0 A;  3BCV A;  5CMH A;  1LZ7 A;  5C1H A;  4LW6 A;  3O3P A;  4C2S A;  1S4P A;  2VD4 A;  1VGT A;  1H7H A;  3OAM A;  1K4V A;  4O6N A;  4AYJ A;  3OH0 A;  2RJ9 A;  3PNN A;  1G1L A;  5J49 A;  1YRO B;  4D0T A;  2CU2 A;  2WGZ A;  4FRB A;  2OEF A;  2RJ7 A;  1NWG B;  2ICY A;  4LW3 A;  4HCQ A;  3OKR A;  4O6M A;  2RJ0 A;  2VSI A;  2P6W A;  1S4O A;  1I52 A;  2J0A A;  3OH3 A;  2PX7 A;  3U2U A;  5CQN X;  1LL3 A;  2FY7 A;  1G97 A;  2QKX A;  4FRA A;  4E1K A;  2AES A;  5C47 A;  3V8Y A;  1FG5 N;  2Y6P A;  2AM4 A;  1QG8 A;  1EYR A;  4CJ8 A;  5C38 A;  2X5S A;  2O1H A;  1INJ A;  2I5K A;  1MP5 A;  1XHB A;  3SXB A;  2AM5 A;  5L6S A;  1O7Q A;  4FRL A;  1FRW A;  1R80 A;  1PZT A;  4FCU A;  2VSH A;  1QGS A;  4EEO A;  2P73 A;  3T7M A;  1G9R A;  2YC3 A;  1LZJ A;  3CU0 A;  1ZDF A;  1QWJ A;  4ARW A;  5C4B A;  4HOC A;  4Y7T A;  1H5R A;  4FRE A;  2JCO A;  4CVH A;  2ZU7 A;  4Y6U A;  1HM0 A;  4YS8 A;  2XME A;  4FRD A;  2OI5 A;  4KPX A;  1ON8 A;  4ZDQ A;  4UEG A;  1LL0 A;  5IDT A;  2NXV A;  2Y4M A;  4B4G A;  1H7G A;  2OI6 A;  4HG6 A;  5CMF X;  1TW5 A;  4AC3 A;  1FO8 A;  1ZJ1 A;  1HV9 A;  3LW6 A;  1LZI A;  3I0C A;  4M28 A;  5AJN A;  3PKQ A;  2GGQ A;  2X65 A;  5C4D A;  4JD0 A;  3TZT A;  3ZF8 A;  3Q7U A;  3SXA A;  1V82 A;  1VZU A;  1E5K A;  1JV1 A;  1LZ0 A;  4HO4 A;  3CKQ A;  3SX7 A;  3CKN A;  1W57 A;  1XZ6 A;  3V0P A;  1H4E A;  3SX3 A;  1EZI A;  1FGG A;  2APC A;  4KC4 A;  2RIZ A;  2OI7 A;  4FRH A;  2PA4 A;  5L6V A;  5FU8 A;  2D7I A;  3OH4 A;  3Q80 A;  1OMX A;  3OH1 A;  1HJL A;  4HO3 A;  3JTJ A;  1WT3 A;  2D7R A;  3DUV A;  1H5S A;  4ASJ A;  2Z86 A;  2XWN A;  1ZDG A;  2DPW A;  2ZU8 A;  1H4D A;  3KIA A;  1NF5 B;  1OMZ A;  1ZI1 A;  2YQC A;  2Y4J A;  1YP3 A;  2GGO A;  2RIX A;  3D5N A;  3SX5 A;  4Y7F A;  1G23 A;  1S4N A;  1YP2 A;  2X5Z A;  2JCJ A;  3POL A;  3K8D A;  1ZIZ A;  2FYC B;  4AAW A;  3HL3 A;  2D0J A;  1G95 A;  4EEM A;  1R7U A;  5C4F A;  1WT0 A;  2WVK A;  4DDZ A;  4HO0 A;  1VM8 A;  2WVM A;  1FXJ A;  1GQ9 A;  2W0V A;  3NGW A;  4CJC A;  3RSB A;  1ZI4 A;  3I0J A;  4G3Q A;  1GWV A;  2MZB A;  1VZX A;  3DJ4 A;  4KT7 A;  4B4B A;  5CMG X;  4M4K A;  2XWM A;  5CMJ A;  1LL2 A;  3JUK A;  1WSZ A;  2YQJ A;  3I0D A;  3U2V A;  3V0L A;  1LVW A;  2VS3 A;  4HO2 A;  3RMV A;  4Y9X A;  1TZF A;  1TW1 A;  2XWL A;  3V0M A;  1O0R A;  5CQL X;  2YC5 A;  1ZHJ A;  3OC9 A;  3V8Z A;  4KQL A;  4EE5 A;  5BXC A;  2Q4J A;  1ZI5 A;  2Y7A A;  1ZCY A;  4FCE A;  1R7T A;  3CGX A;  4IRP A;  1VGW A;  4P00 A;  1KWS A;  3PKP A;  3SXG A;  1G2V A;  1WVC A;  4D11 C;  2V0K A;  4B3U A;  3T7O A;  5C1G A;  1JYL A;  3BRK X;  4EEG A;  1FWY A;  1JYK A;  2RJ6 A;  2JCL A;  3V0N A;  4JIS A;  4M2A A;  3I0I X;  5EJZ A;  1NMM B;  1GA8 A;  1G3L A;  2WEE A;  4EVW A;  4FRQ A;  2A8W A;  2V0H A;  1VGU A;  2AE7 A;  2E3D A;  2RJ5 A;  3U0Y A;  1MP3 A;  1FR9 A;  4Y7U A;  1FR8 A;  5IDS A;  4D11 A;  3I0E A;  5FV9 A;  4DEC A;  1YP4 A;  4MND A;  4KC2 A;  4Y7G A;  1ZJ3 A;  4FIX A;  2Z87 A;  2RJ1 A;  5JQQ A;  1H5S C;  1R81 A;  2Y4L A;  5D92 A;  4P02 A;  1QGQ A;  1VH1 A;  4Y63 A;  4B2X A;  4KNR A;  3I0H A;  4KNX A;  1R7X A;  3DK5 A;  3GUE A;  3D98 A;  3F1C A;  4G87 A;  5D91 A;  5I1F A;  1MC3 A;  3CKJ A;  1H5T A;  5EJ1 A;  1H7E A;  2AM3 A;  2I5E A;  4FRP A;  4B4M A;  4KC1 A;  2YQS A;  4ECM A;  4D48 A;  1W55 A;  1FO9 A;  1PZY B;  3IOI A;  4NAL A;  3U2X A;  1FOA A;  1W77 A;  1HM8 A;  4CJB A;  3IOH A;  4HO9 A;  2P72 A;  1FZW A;  1WT1 A;  5CQO A;  2A8U A;  3CKV A;  2VK9 A;  4Y6N A;  1G93 A;  2XMH A;  4DE7 A;  5C4E A;  1TVY A;  2VS5 A;  1MP4 A;  4KXO A;  2E8B A;  2BO6 A;  4NAK A;  2O1G A;  3FOQ A;  5EIY A;  4FIY A;  2WVL A;  2FFV A;  2BO8 A;  1JVG A;  2V0J A;  2FYA A;  1NQI B;  4G3S A;  4KRV A;  3I0L A;  3SXD A;  3ZLK A;  4EE4 A;  1ZCT A;  4R7P A;  5C49 A;  1H7F A;  2V0I A;  4Y62 A;  3OH2 A;  3D8V A;  1VPA A;  3IOJ A;  1H7L A;  4MIX A;  3I0G A;  4AYL A;  3ST8 A;  3TQD A;  2WAW A;  1O23 B;  5FU0 A;  5AJP A;  5FUH A;  3JUJ A;  4KPZ A;  2J0B A;  1JV3 A;  2BO7 A;  1H7T A;  1H5S D;  5DDV A;  2VS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...