1NWGB

Beta-1,4-galactosyltransferase complex with alpha-lactalbumin and n-butanoyl-glucoamine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords Alpha-lactalbumin
publication title ALPHA-LACTALBUMIN (LA) STIMULATES MILK BETA-1,4-GALACTOSYLTRANSFERASE I (BETA 4GAL-T1) TO TRANSFER GLUCOSE FROM UDP-GLUCOSE TO N-ACETYLGLUCOSAMINE. CRYSTAL STRUCTURE OF BETA 4GAL-T1 X LA COMPLEX WITH UDP-GLC.
pubmed doi rcsb
source organism Mus musculus
total genus 91
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nwgB00
1FO8A 2YQHA 3R3IA 2RIYA 4AYJA 1VM8A 1LL0A 4R7PA 4Y6UA 2BO4A 3EE5A 2V0LA 1H5TA 4KT7A 4HOCA 1EYRA 3HL3A 2CU2A 5C4DA 4KC2A 1E5KA 2APCA 3I0EA 4DECA 3V0QA 2O1FA 4FRHA 3K8EA 4CJCA 1S4OA 3V8ZA 1V84A 4NALA 1GWVA 4Y64A 4ASYA 4D48A 4CJBA 2Z86A 2ZU7A 1R7UA 4HO6A 3TQDA 1NKHB 1FG5N 4ARWA 5HS2A 2PGYA 4DDZA 4KC1A 4EE5A 3O3PA 1NQIB 4M4KA 2XWMA 2VS4A 1H7LA 4EEGA 4FROA 2BO6A 3CU0A 1VZXA 5CMJA 4LW3A 2RJ0A 3OGZA 4FRQA 2ZU8A 5BXCA 3RSBA 3IOHA 2XWLA 3I0IX 2VS3A 3I0KA 4MNDA 2JCKA 1G2VA 2E3DA 5I1FA 2JCJA 1ZHJA 4L41C 4DE7A 2MZBA 4Y7TA 5C4EA 2XMEA 5AJOA 4B2XA 1ZJOA 1KWSA 4P00A 2AECA 3SXEA 3Q7UA 3IOIA 5EJ1A 1WT2A 1PZYB 1VZUA 3I0LA 5CQOA 1H7FA 1FGGA 1PZTA 1H5SC 4AYLA 4G3SA 4EE4A 2P6WA 1O7OA 1XHBA 3OKRA 4MYBA 1INIA 1H4EA 5CMHA 4M2AA 3R2WA 1VZTA 4KNXA 4B42A 4HG6A 2RITA 1VGZA 3NGWA 3V91A 1G95A 2OEGA 5IDTA 3GUEA 2XWNA 2DPWA 2YQJA 1LL2A 1LL3A 1R7YA 3RMWA 4Y62A 2A8UA 1R7VA 3ZLKA 2VD4A 4BQHA 2WAWA 3DK5A 5IDSA 1R82A 4JISA 2FFVA 3T7OA 4ZDQA 5CQNX 4M2BA 4Y6NA 1JV3A 4G3QA 3ZGFA 5FTVA 4IRPA 3SX7A 5C1HA 1ZCTA 4NAKA 1ZJ1A 3CKVA 2RJ9A 3ZGGA 4EE3A 5DDTA 1H7GA 5FU0A 1ZCVA 1WVCA 1LZJA 3BRKX 1R81A 2QH5A 1W55A 1FO9A 3U0XA 2Q4JA 4NANA 3OH1A 1WT1A 1OMXA 1S4NA 4JD0A 3K8DA 2FYDB 3KIAA 3N9WA 5CQMX 5C36A 2JCLA 1GA8A 3D5NA 5AJPA 3JTJA 4FQWA 2PGVA 4BMAA 3CKQA 1VH1A 2ICYA 2O1HA 2PX7A 1FOAA 1G0RA 2YQSA 1H4DA 4HO9A 5AJNA 2ICXA 1GX0A 3ZF8A 4G87A 5C48A 1H7QA 4FCUA 1NMMB 4FRMA 3V0OA 4EEMA 2AE7A 2I7BA 2VXMA 1OQMB 3PKPA 1HJLA 2UX8A 2Y7AA 3I0DA 3ST8A 1FR9A 2P73A 1QGQA 1ZDFA 1FWYA 4D11C 2JCOA 4CJ8A 1G1LA 1V82A 2X5SA 3E25A 1W77A 1FGXA 4Y7FA 3RMVA 1TW5A 5C3BA 1HM8A 4FRAA 4HO0A 1VPAA 3DJ4A 4EEAA 4FRLA 4G3PA 2FYCB 2GGQA 4NAIA 5CQLX 1OMZA 2VXLA 2YC3A 3JUKA 1TVYA 1QWJA 2RJ6A 1O7QA 1ZI1A 1WT3A 1ZI4A 1G8OA 2I5EA 2RIXA 3OAMA 4B4MA 5FUHA 1G93A 1O0RA 5J49A 2E8BA 5C4FA 2VS5A 4C2SA 4D0ZA 4Y7GA 4Y63A 3QVBA 4J18A 4Y7VA 2X65A 4B2WA 1NF5B 4FRPA 5L6VA 5FV9A 1G9RA 1VH3A 3FWWA 5IFYA 2QKXA 1ZCYA 2VSHA 3BCVA 1HM9A 3SX3A 3Q80A 1HM0A 4KQLA 2Z87A 3TZTA 2WVKA 1ZDGA 1HJJA 4KNRA 3IOJA 2FFUA 5CMFX 2FYAA 2WEEA 4HO8A 1I52A 4EVWA 3OH2A 3I0JA 2RJ8A 4D0TA 4HO2A 2RJ1A 2WGZA 2YESA 4B4GA 1LVWA 5C1LA 5CMIA 1VGUA 3D8VA 4ASJA 2OI7A 2QGIA 4B3UA 5C3AA 2AM3A 2FY7A 1FXJA 4KRVA 1GQ9A 2AH9A 3POLA 3V90A 2W0VA 4HO5A 2OI6A 4P02A 5L6SA 1EZIA 4UEGA 1YP4A 2V0JA 4IRQA 3ZLLA 1ZJ0A 5C4CA 3I0FA 3Q4SA 2XMHA 3OH4A 1H7HA 1JVDA 2Y4LA 4Y7UA 1G3LA 2FYBA 1NHEB 3U0YA 5FYEA 4KXOA 2RJ5A 1MP5A 1YROB 4XWIA 2OI5A 2V0IA 4CVHA 1JYLA 5C4BA 5FU8A 1INJA 1O23B 3DUVA 5DDVA 3SXGA 1ZCUA 3I0CA 2Y4JA 4D11A 4HO4A 1ZI3A 4HO3A 1HV9A 1MC3A 1H5SB 1FR8A 1WT0A 3I0GA 1FZWA 5CQPA 2WE9A 2AM5A 1JYKA 4KPZA 2YC5A 2GGOA 3CKJA 4FCEA 2BO8A 2BO7A 1LZ7A 1ZJ2A 3LW6A 3CKNA 2AGDA 1YP3A 2A8WA 2D7IA 3U2UA 2YQCA 1JVGA 3SX8A 5CMGX 4HCQA 4E1KA 4B4BA 1H5SD 3SPTA 1SS9A 4FRBA 1WSZA 1ZJPA 1VICA 3T7NA 1ON6A 2RJ7A 1GWWA 1VGTA 1H5SA 3USRA 1H3MA 2V0KA 3U2WA 1XZ6A 3D98A 4AAWA 1LZ0A 3FOQA 3OH3A 5C47A 5C3DA 1G23A 4AC3A 1IIMA 1QGSA 2Y6PA 1W57A 1H7TA 1Z90A 3CGXA 4EEOA 3U2TA 2X60A 4B5BA 4Y9XA 4LW6A 4KC4A 3F1CA 5EJZA 1IINA 2RIZA 1MP4A 2O1GA 3V0NA 2WVMA 1NWGB 3V0PA 2WVLA 3SXCA 2YCMA 1H4CA 3SXDA 1R7TA 4GBPA 3V0LA 4M28A 3PKQA 1K4VA 2X5ZA 4K6RA 1VGWA 3JUJA 5C49A 4FRDA 3E26A 1V83A 3V8YA 1ZIZA 5C38A 1YP2A 2OEFA 1S4PA 1TZFA 2W0WA 2Y4MA 2V0HA 2PA4A 1LZIA 3CKOA 2P72A 1H5RB 4FREA 3USQA 4ECMA 1ZJ3A 4YS8A 2ZU9A 5C1GA 3F1YA 3V0MA 3SX5A 1H7EA 3T7MA 2D7RA 2I5KA 2VSIA 2AESA 5JQQA 2NXVA 1R7XA 3OC9A 1FXOA 1MP3A 1ZI5A 3OH0A 1H5TB 5EIYA 3U2VA 5C8RA 1GX4A 1GQCA 5FTSA 1JV1A 2AM4A 1R80A 4KPXA 2Y4KA 3PNNA 3SXAA 3SXBA 3U2XA 1QG8A 1H5RA 2VFZA 1TW1A 2D0JA 1FRWA 1G97A 2RJ4A 1ON8A 3I0HA
chains in the Genus database with same CATH superfamily
1FO8A 2YQHA 3R3IA 2RIYA 4AYJA 1VM8A 1LL0A 4R7PA 4Y6UA 2BO4A 3EE5A 2V0LA 1H5TA 4KT7A 4HOCA 1EYRA 3HL3A 2CU2A 5C4DA 4KC2A 1E5KA 2APCA 3I0EA 4DECA 2J0BA 2O1FA 3V0QA 4FRHA 3K8EA 4CJCA 1S4OA 3V8ZA 1V84A 4NALA 1GWVA 4Y64A 4ASYA 4D48A 4CJBA 2Z86A 2ZU7A 1R7UA 4HO6A 3TQDA 1NKHB 1FG5N 4ARWA 5HS2A 2PGYA 4DDZA 4KC1A 4EE5A 3O3PA 1NQIB 4M4KA 2XWMA 2VS4A 1H7LA 4EEGA 4FROA 2BO6A 3CU0A 1VZXA 5CMJA 4LW3A 2RJ0A 3OGZA 4FRQA 2ZU8A 5BXCA 3RSBA 3IOHA 2XWLA 3I0IX 2VS3A 3I0KA 4MNDA 5D92A 2JCKA 1G2VA 2E3DA 5I1FA 2JCJA 1ZHJA 4L41C 4DE7A 2MZBA 4Y7TA 5C4EA 2XMEA 5AJOA 4B2XA 1ZJOA 1KWSA 4P00A 2AECA 3SXEA 3Q7UA 3IOIA 5EJ1A 1WT2A 1PZYB 1VZUA 3I0LA 5CQOA 1H7FA 1FGGA 1PZTA 1H5SC 4AYLA 4G3SA 4EE4A 2P6WA 1O7OA 1XHBA 3OKRA 4MYBA 1INIA 1H4EA 5CMHA 4M2AA 3R2WA 1VZTA 4KNXA 4B42A 4HG6A 2RITA 1VGZA 3NGWA 3V91A 1G95A 4FIYA 2OEGA 5IDTA 3GUEA 2XWNA 2DPWA 2YQJA 1LL2A 1LL3A 1R7YA 3RMWA 4Y62A 2A8UA 1R7VA 3ZLKA 2VD4A 4BQHA 2WAWA 3DK5A 5IDSA 1R82A 4JISA 2FFVA 3T7OA 4ZDQA 5CQNX 4M2BA 4Y6NA 1JV3A 4G3QA 3ZGFA 5FTVA 4IRPA 3SX7A 5C1HA 1ZCTA 4NAKA 1ZJ1A 3CKVA 2RJ9A 3ZGGA 4EE3A 5DDTA 1H7GA 5FU0A 1ZCVA 1WVCA 1LZJA 3BRKX 1R81A 2QH5A 1W55A 1FO9A 3U0XA 2Q4JA 4NANA 3OH1A 1WT1A 1OMXA 1S4NA 4JD0A 3K8DA 2FYDB 3KIAA 3N9WA 5CQMX 5C36A 2JCLA 1GA8A 3D5NA 5AJPA 3JTJA 4FQWA 2PGVA 4BMAA 3CKQA 1VH1A 2ICYA 2O1HA 2PX7A 1FOAA 1G0RA 2YQSA 1H4DA 4HO9A 5AJNA 2ICXA 1GX0A 4FIXA 3ZF8A 4G87A 5C48A 1H7QA 4FCUA 1NMMB 4FRMA 3V0OA 4EEMA 2AE7A 2I7BA 2VXMA 1OQMB 3PKPA 1HJLA 2UX8A 2Y7AA 3I0DA 3ST8A 1FR9A 2P73A 1QGQA 1ZDFA 1FWYA 4D11C 2JCOA 4CJ8A 1G1LA 1V82A 2X5SA 3E25A 1W77A 1FGXA 4Y7FA 3RMVA 1TW5A 5C3BA 1HM8A 4FRAA 4HO0A 1VPAA 3DJ4A 4O6NA 4EEAA 4FRLA 4G3PA 2FYCB 2GGQA 4NAIA 5CQLX 1OMZA 2VXLA 2YC3A 3JUKA 1TVYA 1QWJA 4MIXA 2RJ6A 1O7QA 1ZI1A 1WT3A 1ZI4A 1G8OA 2I5EA 2RIXA 3OAMA 4B4MA 5FUHA 1G93A 1O0RA 5J49A 2E8BA 5C4FA 2VS5A 4C2SA 4D0ZA 4Y7GA 4Y63A 3QVBA 4J18A 4Y7VA 2X65A 4B2WA 1NF5B 4FRPA 5L6VA 5FV9A 1G9RA 1VH3A 3FWWA 5IFYA 2QKXA 1ZCYA 2VSHA 3BCVA 1HM9A 3SX3A 3Q80A 1HM0A 4KQLA 2Z87A 3TZTA 2WVKA 1ZDGA 1HJJA 4KNRA 3IOJA 2FFUA 5CMFX 2FYAA 2WEEA 4HO8A 1I52A 4EVWA 3OH2A 3I0JA 2RJ8A 4D0TA 4HO2A 2RJ1A 2WGZA 2YESA 4B4GA 1LVWA 5C1LA 5CMIA 1VGUA 3D8VA 4ASJA 2OI7A 2QGIA 4B3UA 5C3AA 2AM3A 2FY7A 1FXJA 4KRVA 1GQ9A 2AH9A 3POLA 3V90A 2W0VA 4HO5A 2OI6A 4P02A 5L6SA 1EZIA 4UEGA 1YP4A 2V0JA 4IRQA 3ZLLA 1ZJ0A 5C4CA 3I0FA 3Q4SA 2XMHA 3OH4A 1H7HA 1JVDA 2Y4LA 4Y7UA 1G3LA 2FYBA 2C0NA 1NHEB 3U0YA 5FYEA 4KXOA 2RJ5A 1MP5A 1YROB 4XWIA 2OI5A 2V0IA 4CVHA 1JYLA 5C4BA 5FU8A 1INJA 1O23B 3DUVA 5DDVA 3SXGA 1ZCUA 3I0CA 2Y4JA 4D11A 4HO4A 1ZI3A 4HO3A 1HV9A 1MC3A 1H5SB 1FR8A 1WT0A 3I0GA 1FZWA 5CQPA 2WE9A 2AM5A 4O6MA 1JYKA 4KPZA 2YC5A 2GGOA 3CKJA 4FCEA 2BO8A 2BO7A 1LZ7A 1ZJ2A 3LW6A 3CKNA 2AGDA 1YP3A 2A8WA 2D7IA 3U2UA 2YQCA 1JVGA 3SX8A 5CMGX 4HCQA 4E1KA 4B4BA 1H5SD 3SPTA 1SS9A 4FRBA 1WSZA 1ZJPA 1VICA 3T7NA 1ON6A 2RJ7A 1GWWA 1VGTA 1H5SA 5D91A 3USRA 1H3MA 2V0KA 3U2WA 1XZ6A 3D98A 4AAWA 1LZ0A 3FOQA 3OH3A 5C47A 5C3DA 1G23A 4AC3A 1IIMA 1QGSA 2Y6PA 1W57A 1H7TA 1Z90A 3CGXA 4EEOA 3U2TA 2X60A 4B5BA 4Y9XA 4LW6A 4KC4A 3F1CA 5EJZA 1IINA 2RIZA 1MP4A 2O1GA 3V0NA 2WVMA 1NWGB 3V0PA 4Q7CA 2WVLA 3SXCA 2YCMA 1H4CA 3SXDA 1R7TA 4GBPA 3V0LA 4M28A 3PKQA 1K4VA 2X5ZA 4K6RA 1VGWA 3JUJA 5C49A 4FRDA 3E26A 1V83A 3V8YA 1ZIZA 5C38A 1YP2A 2J0AA 2OEFA 1S4PA 1TZFA 2W0WA 2Y4MA 2V0HA 2PA4A 1LZIA 3CKOA 2P72A 1H5RB 4FREA 3USQA 4ECMA 1ZJ3A 4YS8A 2ZU9A 5C1GA 3F1YA 3V0MA 3SX5A 1H7EA 3T7MA 2D7RA 2I5KA 2VSIA 2AESA 5JQQA 2NXVA 1R7XA 3OC9A 1FXOA 1MP3A 1ZI5A 3OH0A 1H5TB 5EIYA 3U2VA 5C8RA 1GX4A 1GQCA 5FTSA 1JV1A 2AM4A 2VK9A 1R80A 4KPXA 2Y4KA 3PNNA 3SXAA 3SXBA 3U2XA 1QG8A 1H5RA 2VFZA 1TW1A 2D0JA 1FRWA 1G97A 2RJ4A 1ON8A 3I0HA
chains in the Genus database with same CATH topology
1FO8A 2YQHA 3R3IA 2RIYA 4AYJA 1VM8A 1LL0A 4R7PA 4Y6UA 2BO4A 3EE5A 2V0LA 1H5TA 4KT7A 4HOCA 1EYRA 3HL3A 2CU2A 5C4DA 4KC2A 1E5KA 2APCA 3I0EA 4DECA 2J0BA 2O1FA 3V0QA 4FRHA 3K8EA 4CJCA 1S4OA 3V8ZA 1V84A 4NALA 1GWVA 4Y64A 4ASYA 4D48A 4CJBA 2Z86A 2ZU7A 1R7UA 4HO6A 3TQDA 1NKHB 1FG5N 4ARWA 5HS2A 2PGYA 4DDZA 4KC1A 4EE5A 3O3PA 1NQIB 4M4KA 2XWMA 2VS4A 1H7LA 4EEGA 4FROA 2BO6A 3CU0A 1VZXA 5CMJA 4LW3A 2RJ0A 3OGZA 4FRQA 2ZU8A 5BXCA 3RSBA 3IOHA 2XWLA 3I0IX 2VS3A 3I0KA 4MNDA 5D92A 2JCKA 1G2VA 2E3DA 5I1FA 2JCJA 1ZHJA 4L41C 4DE7A 2MZBA 4Y7TA 5C4EA 2XMEA 5AJOA 4B2XA 1ZJOA 1KWSA 4P00A 2AECA 3SXEA 3Q7UA 3IOIA 5EJ1A 1WT2A 1PZYB 1VZUA 3I0LA 5CQOA 1H7FA 1FGGA 1PZTA 1H5SC 4AYLA 4G3SA 4EE4A 2P6WA 1O7OA 1XHBA 3OKRA 4MYBA 1INIA 1H4EA 5CMHA 4M2AA 3R2WA 1VZTA 4KNXA 4B42A 4HG6A 2RITA 1VGZA 3NGWA 3V91A 1G95A 4FIYA 2OEGA 5IDTA 3GUEA 2XWNA 2DPWA 2YQJA 1LL2A 1LL3A 1R7YA 3RMWA 4Y62A 2A8UA 1R7VA 3ZLKA 2VD4A 4BQHA 2WAWA 3DK5A 5IDSA 1R82A 4JISA 2FFVA 3T7OA 4ZDQA 5CQNX 4M2BA 4Y6NA 1JV3A 4G3QA 3ZGFA 5FTVA 4IRPA 3SX7A 5C1HA 1ZCTA 4NAKA 1ZJ1A 3CKVA 2RJ9A 3ZGGA 4EE3A 5DDTA 1H7GA 5FU0A 1ZCVA 1WVCA 1LZJA 3BRKX 1R81A 2QH5A 1W55A 1FO9A 3U0XA 2Q4JA 4NANA 3OH1A 1WT1A 1OMXA 1S4NA 4JD0A 3K8DA 2FYDB 3KIAA 3N9WA 5CQMX 5C36A 2JCLA 1GA8A 3D5NA 5AJPA 3JTJA 4FQWA 2PGVA 4BMAA 3CKQA 1VH1A 2ICYA 2O1HA 2PX7A 1FOAA 1G0RA 2YQSA 1H4DA 4HO9A 5AJNA 2ICXA 1GX0A 4FIXA 3ZF8A 4G87A 5C48A 1H7QA 4FCUA 1NMMB 4FRMA 3V0OA 4EEMA 2AE7A 2I7BA 2VXMA 1OQMB 3PKPA 1HJLA 2UX8A 2Y7AA 3I0DA 3ST8A 1FR9A 2P73A 1QGQA 1ZDFA 1FWYA 4D11C 2JCOA 4CJ8A 1G1LA 1V82A 2X5SA 3E25A 1W77A 1FGXA 4Y7FA 3RMVA 1TW5A 5C3BA 1HM8A 4FRAA 4HO0A 1VPAA 3DJ4A 4O6NA 4EEAA 4FRLA 4G3PA 2FYCB 2GGQA 4NAIA 5CQLX 1OMZA 2VXLA 2YC3A 3JUKA 1TVYA 1QWJA 4MIXA 2RJ6A 1O7QA 1ZI1A 1WT3A 1ZI4A 1G8OA 2I5EA 2RIXA 3OAMA 4B4MA 5FUHA 1G93A 1O0RA 5J49A 2E8BA 5C4FA 2VS5A 4C2SA 4D0ZA 4Y7GA 4Y63A 3QVBA 4J18A 4Y7VA 2X65A 4B2WA 1NF5B 4FRPA 5L6VA 5FV9A 1G9RA 1VH3A 3FWWA 5IFYA 2QKXA 1ZCYA 2VSHA 3BCVA 1HM9A 3SX3A 3Q80A 1HM0A 4KQLA 2Z87A 3TZTA 2WVKA 1ZDGA 1HJJA 4KNRA 3IOJA 2FFUA 5CMFX 2FYAA 2WEEA 4HO8A 1I52A 4EVWA 3OH2A 3I0JA 2RJ8A 4D0TA 4HO2A 2RJ1A 2WGZA 2YESA 4B4GA 1LVWA 5C1LA 5CMIA 1VGUA 3D8VA 4ASJA 2OI7A 2QGIA 4B3UA 5C3AA 2AM3A 2FY7A 1FXJA 4KRVA 1GQ9A 2AH9A 3POLA 3V90A 2W0VA 4HO5A 2OI6A 4P02A 5L6SA 1EZIA 4UEGA 1YP4A 2V0JA 4IRQA 3ZLLA 1ZJ0A 5C4CA 3I0FA 3Q4SA 2XMHA 3OH4A 1H7HA 1JVDA 2Y4LA 4Y7UA 1G3LA 2FYBA 2C0NA 1NHEB 3U0YA 5FYEA 4KXOA 2RJ5A 1MP5A 1YROB 4XWIA 2OI5A 2V0IA 4CVHA 1JYLA 5C4BA 5FU8A 1INJA 1O23B 3DUVA 5DDVA 3SXGA 1ZCUA 3I0CA 2Y4JA 4D11A 4HO4A 1ZI3A 4HO3A 1HV9A 1MC3A 1H5SB 1FR8A 1WT0A 3I0GA 1FZWA 5CQPA 2WE9A 2AM5A 4O6MA 1JYKA 4KPZA 2YC5A 2GGOA 3CKJA 4FCEA 2BO8A 2BO7A 1LZ7A 1ZJ2A 3LW6A 3CKNA 2AGDA 1YP3A 2A8WA 2D7IA 3U2UA 2YQCA 1JVGA 3SX8A 5CMGX 4HCQA 4E1KA 4B4BA 1H5SD 3SPTA 1SS9A 4FRBA 1WSZA 1ZJPA 1VICA 3T7NA 1ON6A 2RJ7A 1GWWA 1VGTA 1H5SA 5D91A 3USRA 1H3MA 2V0KA 3U2WA 1XZ6A 3D98A 4AAWA 1LZ0A 3FOQA 3OH3A 5C47A 5C3DA 1G23A 4AC3A 1IIMA 1QGSA 2Y6PA 1W57A 1H7TA 1Z90A 3CGXA 4EEOA 3U2TA 2X60A 4B5BA 4Y9XA 4LW6A 4KC4A 3F1CA 5EJZA 1IINA 2RIZA 1MP4A 2O1GA 3V0NA 2WVMA 1NWGB 3V0PA 4Q7CA 2WVLA 3SXCA 2YCMA 1H4CA 3SXDA 1R7TA 4GBPA 3V0LA 4M28A 3PKQA 1K4VA 2X5ZA 4K6RA 1VGWA 3JUJA 5C49A 4FRDA 3E26A 1V83A 3V8YA 1ZIZA 5C38A 1YP2A 2J0AA 2OEFA 1S4PA 1TZFA 2W0WA 2Y4MA 2V0HA 2PA4A 1LZIA 3CKOA 2P72A 1H5RB 4FREA 3USQA 4ECMA 1ZJ3A 4YS8A 2ZU9A 5C1GA 3F1YA 3V0MA 3SX5A 1H7EA 3T7MA 2D7RA 2I5KA 2VSIA 2AESA 5JQQA 2NXVA 1R7XA 3OC9A 1FXOA 1MP3A 1ZI5A 3OH0A 1H5TB 5EIYA 3U2VA 5C8RA 1GX4A 1GQCA 5FTSA 1JV1A 2AM4A 2VK9A 1R80A 4KPXA 2Y4KA 3PNNA 3SXAA 3SXBA 3U2XA 1QG8A 1H5RA 2VFZA 1TW1A 2D0JA 1FRWA 1G97A 2RJ4A 1ON8A 3I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO8 A;  2YQH A;  3R3I A;  2RIY A;  4AYJ A;  1VM8 A;  1LL0 A;  4R7P A;  4Y6U A;  2BO4 A;  3EE5 A;  2V0L A;  1H5T A;  4KT7 A;  4HOC A;  1EYR A;  3HL3 A;  2CU2 A;  5C4D A;  4KC2 A;  1E5K A;  2APC A;  3I0E A;  4DEC A;  3V0Q A;  2O1F A;  4FRH A;  3K8E A;  4CJC A;  1S4O A;  3V8Z A;  1V84 A;  4NAL A;  1GWV A;  4Y64 A;  4ASY A;  4D48 A;  4CJB A;  2Z86 A;  2ZU7 A;  1R7U A;  4HO6 A;  3TQD A;  1NKH B;  1FG5 N;  4ARW A;  5HS2 A;  2PGY A;  4DDZ A;  4KC1 A;  4EE5 A;  3O3P A;  1NQI B;  4M4K A;  2XWM A;  2VS4 A;  1H7L A;  4EEG A;  4FRO A;  2BO6 A;  3CU0 A;  1VZX A;  5CMJ A;  4LW3 A;  2RJ0 A;  3OGZ A;  4FRQ A;  2ZU8 A;  5BXC A;  3RSB A;  3IOH A;  2XWL A;  3I0I X;  2VS3 A;  3I0K A;  4MND A;  2JCK A;  1G2V A;  2E3D A;  5I1F A;  2JCJ A;  1ZHJ A;  4L41 C;  4DE7 A;  2MZB A;  4Y7T A;  5C4E A;  2XME A;  5AJO A;  4B2X A;  1ZJO A;  1KWS A;  4P00 A;  2AEC A;  3SXE A;  3Q7U A;  3IOI A;  5EJ1 A;  1WT2 A;  1PZY B;  1VZU A;  3I0L A;  5CQO A;  1H7F A;  1FGG A;  1PZT A;  1H5S C;  4AYL A;  4G3S A;  4EE4 A;  2P6W A;  1O7O A;  1XHB A;  3OKR A;  4MYB A;  1INI A;  1H4E A;  5CMH A;  4M2A A;  3R2W A;  1VZT A;  4KNX A;  4B42 A;  4HG6 A;  2RIT A;  1VGZ A;  3NGW A;  3V91 A;  1G95 A;  2OEG A;  5IDT A;  3GUE A;  2XWN A;  2DPW A;  2YQJ A;  1LL2 A;  1LL3 A;  1R7Y A;  3RMW A;  4Y62 A;  2A8U A;  1R7V A;  3ZLK A;  2VD4 A;  4BQH A;  2WAW A;  3DK5 A;  5IDS A;  1R82 A;  4JIS A;  2FFV A;  3T7O A;  4ZDQ A;  5CQN X;  4M2B A;  4Y6N A;  1JV3 A;  4G3Q A;  3ZGF A;  5FTV A;  4IRP A;  3SX7 A;  5C1H A;  1ZCT A;  4NAK A;  1ZJ1 A;  3CKV A;  2RJ9 A;  3ZGG A;  4EE3 A;  5DDT A;  1H7G A;  5FU0 A;  1ZCV A;  1WVC A;  1LZJ A;  3BRK X;  1R81 A;  2QH5 A;  1W55 A;  1FO9 A;  3U0X A;  2Q4J A;  4NAN A;  3OH1 A;  1WT1 A;  1OMX A;  1S4N A;  4JD0 A;  3K8D A;  2FYD B;  3KIA A;  3N9W A;  5CQM X;  5C36 A;  2JCL A;  1GA8 A;  3D5N A;  5AJP A;  3JTJ A;  4FQW A;  2PGV A;  4BMA A;  3CKQ A;  1VH1 A;  2ICY A;  2O1H A;  2PX7 A;  1FOA A;  1G0R A;  2YQS A;  1H4D A;  4HO9 A;  5AJN A;  2ICX A;  1GX0 A;  3ZF8 A;  4G87 A;  5C48 A;  1H7Q A;  4FCU A;  1NMM B;  4FRM A;  3V0O A;  4EEM A;  2AE7 A;  2I7B A;  2VXM A;  1OQM B;  3PKP A;  1HJL A;  2UX8 A;  2Y7A A;  3I0D A;  3ST8 A;  1FR9 A;  2P73 A;  1QGQ A;  1ZDF A;  1FWY A;  4D11 C;  2JCO A;  4CJ8 A;  1G1L A;  1V82 A;  2X5S A;  3E25 A;  1W77 A;  1FGX A;  4Y7F A;  3RMV A;  1TW5 A;  5C3B A;  1HM8 A;  4FRA A;  4HO0 A;  1VPA A;  3DJ4 A;  4EEA A;  4FRL A;  4G3P A;  2FYC B;  2GGQ A;  4NAI A;  5CQL X;  1OMZ A;  2VXL A;  2YC3 A;  3JUK A;  1TVY A;  1QWJ A;  2RJ6 A;  1O7Q A;  1ZI1 A;  1WT3 A;  1ZI4 A;  1G8O A;  2I5E A;  2RIX A;  3OAM A;  4B4M A;  5FUH A;  1G93 A;  1O0R A;  5J49 A;  2E8B A;  5C4F A;  2VS5 A;  4C2S A;  4D0Z A;  4Y7G A;  4Y63 A;  3QVB A;  4J18 A;  4Y7V A;  2X65 A;  4B2W A;  1NF5 B;  4FRP A;  5L6V A;  5FV9 A;  1G9R A;  1VH3 A;  3FWW A;  5IFY A;  2QKX A;  1ZCY A;  2VSH A;  3BCV A;  1HM9 A;  3SX3 A;  3Q80 A;  1HM0 A;  4KQL A;  2Z87 A;  3TZT A;  2WVK A;  1ZDG A;  1HJJ A;  4KNR A;  3IOJ A;  2FFU A;  5CMF X;  2FYA A;  2WEE A;  4HO8 A;  1I52 A;  4EVW A;  3OH2 A;  3I0J A;  2RJ8 A;  4D0T A;  4HO2 A;  2RJ1 A;  2WGZ A;  2YES A;  4B4G A;  1LVW A;  5C1L A;  5CMI A;  1VGU A;  3D8V A;  4ASJ A;  2OI7 A;  2QGI A;  4B3U A;  5C3A A;  2AM3 A;  2FY7 A;  1FXJ A;  4KRV A;  1GQ9 A;  2AH9 A;  3POL A;  3V90 A;  2W0V A;  4HO5 A;  2OI6 A;  4P02 A;  5L6S A;  1EZI A;  4UEG A;  1YP4 A;  2V0J A;  4IRQ A;  3ZLL A;  1ZJ0 A;  5C4C A;  3I0F A;  3Q4S A;  2XMH A;  3OH4 A;  1H7H A;  1JVD A;  2Y4L A;  4Y7U A;  1G3L A;  2FYB A;  1NHE B;  3U0Y A;  5FYE A;  4KXO A;  2RJ5 A;  1MP5 A;  1YRO B;  4XWI A;  2OI5 A;  2V0I A;  4CVH A;  1JYL A;  5C4B A;  5FU8 A;  1INJ A;  1O23 B;  3DUV A;  5DDV A;  3SXG A;  1ZCU A;  3I0C A;  2Y4J A;  4D11 A;  4HO4 A;  1ZI3 A;  4HO3 A;  1HV9 A;  1MC3 A;  1H5S B;  1FR8 A;  1WT0 A;  3I0G A;  1FZW A;  5CQP A;  2WE9 A;  2AM5 A;  1JYK A;  4KPZ A;  2YC5 A;  2GGO A;  3CKJ A;  4FCE A;  2BO8 A;  2BO7 A;  1LZ7 A;  1ZJ2 A;  3LW6 A;  3CKN A;  2AGD A;  1YP3 A;  2A8W A;  2D7I A;  3U2U A;  2YQC A;  1JVG A;  3SX8 A;  5CMG X;  4HCQ A;  4E1K A;  4B4B A;  1H5S D;  3SPT A;  1SS9 A;  4FRB A;  1WSZ A;  1ZJP A;  1VIC A;  3T7N A;  1ON6 A;  2RJ7 A;  1GWW A;  1VGT A;  1H5S A;  3USR A;  1H3M A;  2V0K A;  3U2W A;  1XZ6 A;  3D98 A;  4AAW A;  1LZ0 A;  3FOQ A;  3OH3 A;  5C47 A;  5C3D A;  1G23 A;  4AC3 A;  1IIM A;  1QGS A;  2Y6P A;  1W57 A;  1H7T A;  1Z90 A;  3CGX A;  4EEO A;  3U2T A;  2X60 A;  4B5B A;  4Y9X A;  4LW6 A;  4KC4 A;  3F1C A;  5EJZ A;  1IIN A;  2RIZ A;  1MP4 A;  2O1G A;  3V0N A;  2WVM A;  1NWG B;  3V0P A;  2WVL A;  3SXC A;  2YCM A;  1H4C A;  3SXD A;  1R7T A;  4GBP A;  3V0L A;  4M28 A;  3PKQ A;  1K4V A;  2X5Z A;  4K6R A;  1VGW A;  3JUJ A;  5C49 A;  4FRD A;  3E26 A;  1V83 A;  3V8Y A;  1ZIZ A;  5C38 A;  1YP2 A;  2OEF A;  1S4P A;  1TZF A;  2W0W A;  2Y4M A;  2V0H A;  2PA4 A;  1LZI A;  3CKO A;  2P72 A;  1H5R B;  4FRE A;  3USQ A;  4ECM A;  1ZJ3 A;  4YS8 A;  2ZU9 A;  5C1G A;  3F1Y A;  3V0M A;  3SX5 A;  1H7E A;  3T7M A;  2D7R A;  2I5K A;  2VSI A;  2AES A;  5JQQ A;  2NXV A;  1R7X A;  3OC9 A;  1FXO A;  1MP3 A;  1ZI5 A;  3OH0 A;  1H5T B;  5EIY A;  3U2V A;  5C8R A;  1GX4 A;  1GQC A;  5FTS A;  1JV1 A;  2AM4 A;  1R80 A;  4KPX A;  2Y4K A;  3PNN A;  3SXA A;  3SXB A;  3U2X A;  1QG8 A;  1H5R A;  2VFZ A;  1TW1 A;  2D0J A;  1FRW A;  1G97 A;  2RJ4 A;  1ON8 A;  3I0H A; 
#chains in the Genus database with same CATH topology
 1FO8 A;  2YQH A;  3R3I A;  2RIY A;  4AYJ A;  1VM8 A;  1LL0 A;  4R7P A;  4Y6U A;  2BO4 A;  3EE5 A;  2V0L A;  1H5T A;  4KT7 A;  4HOC A;  1EYR A;  3HL3 A;  2CU2 A;  5C4D A;  4KC2 A;  1E5K A;  2APC A;  3I0E A;  4DEC A;  2J0B A;  2O1F A;  3V0Q A;  4FRH A;  3K8E A;  4CJC A;  1S4O A;  3V8Z A;  1V84 A;  4NAL A;  1GWV A;  4Y64 A;  4ASY A;  4D48 A;  4CJB A;  2Z86 A;  2ZU7 A;  1R7U A;  4HO6 A;  3TQD A;  1NKH B;  1FG5 N;  4ARW A;  5HS2 A;  2PGY A;  4DDZ A;  4KC1 A;  4EE5 A;  3O3P A;  1NQI B;  4M4K A;  2XWM A;  2VS4 A;  1H7L A;  4EEG A;  4FRO A;  2BO6 A;  3CU0 A;  1VZX A;  5CMJ A;  4LW3 A;  2RJ0 A;  3OGZ A;  4FRQ A;  2ZU8 A;  5BXC A;  3RSB A;  3IOH A;  2XWL A;  3I0I X;  2VS3 A;  3I0K A;  4MND A;  5D92 A;  2JCK A;  1G2V A;  2E3D A;  5I1F A;  2JCJ A;  1ZHJ A;  4L41 C;  4DE7 A;  2MZB A;  4Y7T A;  5C4E A;  2XME A;  5AJO A;  4B2X A;  1ZJO A;  1KWS A;  4P00 A;  2AEC A;  3SXE A;  3Q7U A;  3IOI A;  5EJ1 A;  1WT2 A;  1PZY B;  1VZU A;  3I0L A;  5CQO A;  1H7F A;  1FGG A;  1PZT A;  1H5S C;  4AYL A;  4G3S A;  4EE4 A;  2P6W A;  1O7O A;  1XHB A;  3OKR A;  4MYB A;  1INI A;  1H4E A;  5CMH A;  4M2A A;  3R2W A;  1VZT A;  4KNX A;  4B42 A;  4HG6 A;  2RIT A;  1VGZ A;  3NGW A;  3V91 A;  1G95 A;  4FIY A;  2OEG A;  5IDT A;  3GUE A;  2XWN A;  2DPW A;  2YQJ A;  1LL2 A;  1LL3 A;  1R7Y A;  3RMW A;  4Y62 A;  2A8U A;  1R7V A;  3ZLK A;  2VD4 A;  4BQH A;  2WAW A;  3DK5 A;  5IDS A;  1R82 A;  4JIS A;  2FFV A;  3T7O A;  4ZDQ A;  5CQN X;  4M2B A;  4Y6N A;  1JV3 A;  4G3Q A;  3ZGF A;  5FTV A;  4IRP A;  3SX7 A;  5C1H A;  1ZCT A;  4NAK A;  1ZJ1 A;  3CKV A;  2RJ9 A;  3ZGG A;  4EE3 A;  5DDT A;  1H7G A;  5FU0 A;  1ZCV A;  1WVC A;  1LZJ A;  3BRK X;  1R81 A;  2QH5 A;  1W55 A;  1FO9 A;  3U0X A;  2Q4J A;  4NAN A;  3OH1 A;  1WT1 A;  1OMX A;  1S4N A;  4JD0 A;  3K8D A;  2FYD B;  3KIA A;  3N9W A;  5CQM X;  5C36 A;  2JCL A;  1GA8 A;  3D5N A;  5AJP A;  3JTJ A;  4FQW A;  2PGV A;  4BMA A;  3CKQ A;  1VH1 A;  2ICY A;  2O1H A;  2PX7 A;  1FOA A;  1G0R A;  2YQS A;  1H4D A;  4HO9 A;  5AJN A;  2ICX A;  1GX0 A;  4FIX A;  3ZF8 A;  4G87 A;  5C48 A;  1H7Q A;  4FCU A;  1NMM B;  4FRM A;  3V0O A;  4EEM A;  2AE7 A;  2I7B A;  2VXM A;  1OQM B;  3PKP A;  1HJL A;  2UX8 A;  2Y7A A;  3I0D A;  3ST8 A;  1FR9 A;  2P73 A;  1QGQ A;  1ZDF A;  1FWY A;  4D11 C;  2JCO A;  4CJ8 A;  1G1L A;  1V82 A;  2X5S A;  3E25 A;  1W77 A;  1FGX A;  4Y7F A;  3RMV A;  1TW5 A;  5C3B A;  1HM8 A;  4FRA A;  4HO0 A;  1VPA A;  3DJ4 A;  4O6N A;  4EEA A;  4FRL A;  4G3P A;  2FYC B;  2GGQ A;  4NAI A;  5CQL X;  1OMZ A;  2VXL A;  2YC3 A;  3JUK A;  1TVY A;  1QWJ A;  4MIX A;  2RJ6 A;  1O7Q A;  1ZI1 A;  1WT3 A;  1ZI4 A;  1G8O A;  2I5E A;  2RIX A;  3OAM A;  4B4M A;  5FUH A;  1G93 A;  1O0R A;  5J49 A;  2E8B A;  5C4F A;  2VS5 A;  4C2S A;  4D0Z A;  4Y7G A;  4Y63 A;  3QVB A;  4J18 A;  4Y7V A;  2X65 A;  4B2W A;  1NF5 B;  4FRP A;  5L6V A;  5FV9 A;  1G9R A;  1VH3 A;  3FWW A;  5IFY A;  2QKX A;  1ZCY A;  2VSH A;  3BCV A;  1HM9 A;  3SX3 A;  3Q80 A;  1HM0 A;  4KQL A;  2Z87 A;  3TZT A;  2WVK A;  1ZDG A;  1HJJ A;  4KNR A;  3IOJ A;  2FFU A;  5CMF X;  2FYA A;  2WEE A;  4HO8 A;  1I52 A;  4EVW A;  3OH2 A;  3I0J A;  2RJ8 A;  4D0T A;  4HO2 A;  2RJ1 A;  2WGZ A;  2YES A;  4B4G A;  1LVW A;  5C1L A;  5CMI A;  1VGU A;  3D8V A;  4ASJ A;  2OI7 A;  2QGI A;  4B3U A;  5C3A A;  2AM3 A;  2FY7 A;  1FXJ A;  4KRV A;  1GQ9 A;  2AH9 A;  3POL A;  3V90 A;  2W0V A;  4HO5 A;  2OI6 A;  4P02 A;  5L6S A;  1EZI A;  4UEG A;  1YP4 A;  2V0J A;  4IRQ A;  3ZLL A;  1ZJ0 A;  5C4C A;  3I0F A;  3Q4S A;  2XMH A;  3OH4 A;  1H7H A;  1JVD A;  2Y4L A;  4Y7U A;  1G3L A;  2FYB A;  2C0N A;  1NHE B;  3U0Y A;  5FYE A;  4KXO A;  2RJ5 A;  1MP5 A;  1YRO B;  4XWI A;  2OI5 A;  2V0I A;  4CVH A;  1JYL A;  5C4B A;  5FU8 A;  1INJ A;  1O23 B;  3DUV A;  5DDV A;  3SXG A;  1ZCU A;  3I0C A;  2Y4J A;  4D11 A;  4HO4 A;  1ZI3 A;  4HO3 A;  1HV9 A;  1MC3 A;  1H5S B;  1FR8 A;  1WT0 A;  3I0G A;  1FZW A;  5CQP A;  2WE9 A;  2AM5 A;  4O6M A;  1JYK A;  4KPZ A;  2YC5 A;  2GGO A;  3CKJ A;  4FCE A;  2BO8 A;  2BO7 A;  1LZ7 A;  1ZJ2 A;  3LW6 A;  3CKN A;  2AGD A;  1YP3 A;  2A8W A;  2D7I A;  3U2U A;  2YQC A;  1JVG A;  3SX8 A;  5CMG X;  4HCQ A;  4E1K A;  4B4B A;  1H5S D;  3SPT A;  1SS9 A;  4FRB A;  1WSZ A;  1ZJP A;  1VIC A;  3T7N A;  1ON6 A;  2RJ7 A;  1GWW A;  1VGT A;  1H5S A;  5D91 A;  3USR A;  1H3M A;  2V0K A;  3U2W A;  1XZ6 A;  3D98 A;  4AAW A;  1LZ0 A;  3FOQ A;  3OH3 A;  5C47 A;  5C3D A;  1G23 A;  4AC3 A;  1IIM A;  1QGS A;  2Y6P A;  1W57 A;  1H7T A;  1Z90 A;  3CGX A;  4EEO A;  3U2T A;  2X60 A;  4B5B A;  4Y9X A;  4LW6 A;  4KC4 A;  3F1C A;  5EJZ A;  1IIN A;  2RIZ A;  1MP4 A;  2O1G A;  3V0N A;  2WVM A;  1NWG B;  3V0P A;  4Q7C A;  2WVL A;  3SXC A;  2YCM A;  1H4C A;  3SXD A;  1R7T A;  4GBP A;  3V0L A;  4M28 A;  3PKQ A;  1K4V A;  2X5Z A;  4K6R A;  1VGW A;  3JUJ A;  5C49 A;  4FRD A;  3E26 A;  1V83 A;  3V8Y A;  1ZIZ A;  5C38 A;  1YP2 A;  2J0A A;  2OEF A;  1S4P A;  1TZF A;  2W0W A;  2Y4M A;  2V0H A;  2PA4 A;  1LZI A;  3CKO A;  2P72 A;  1H5R B;  4FRE A;  3USQ A;  4ECM A;  1ZJ3 A;  4YS8 A;  2ZU9 A;  5C1G A;  3F1Y A;  3V0M A;  3SX5 A;  1H7E A;  3T7M A;  2D7R A;  2I5K A;  2VSI A;  2AES A;  5JQQ A;  2NXV A;  1R7X A;  3OC9 A;  1FXO A;  1MP3 A;  1ZI5 A;  3OH0 A;  1H5T B;  5EIY A;  3U2V A;  5C8R A;  1GX4 A;  1GQC A;  5FTS A;  1JV1 A;  2AM4 A;  2VK9 A;  1R80 A;  4KPX A;  2Y4K A;  3PNN A;  3SXA A;  3SXB A;  3U2X A;  1QG8 A;  1H5R A;  2VFZ A;  1TW1 A;  2D0J A;  1FRW A;  1G97 A;  2RJ4 A;  1ON8 A;  3I0H A; 
#chains in the Genus database with same CATH homology
 1FO8 A;  2YQH A;  3R3I A;  2RIY A;  4AYJ A;  1VM8 A;  1LL0 A;  4R7P A;  4Y6U A;  2BO4 A;  3EE5 A;  2V0L A;  1H5T A;  4KT7 A;  4HOC A;  1EYR A;  3HL3 A;  2CU2 A;  5C4D A;  4KC2 A;  1E5K A;  2APC A;  3I0E A;  4DEC A;  2J0B A;  2O1F A;  3V0Q A;  4FRH A;  3K8E A;  4CJC A;  1S4O A;  3V8Z A;  1V84 A;  4NAL A;  1GWV A;  4Y64 A;  4ASY A;  4D48 A;  4CJB A;  2Z86 A;  2ZU7 A;  1R7U A;  4HO6 A;  3TQD A;  1NKH B;  1FG5 N;  4ARW A;  5HS2 A;  2PGY A;  4DDZ A;  4KC1 A;  4EE5 A;  3O3P A;  1NQI B;  4M4K A;  2XWM A;  2VS4 A;  1H7L A;  4EEG A;  4FRO A;  2BO6 A;  3CU0 A;  1VZX A;  5CMJ A;  4LW3 A;  2RJ0 A;  3OGZ A;  4FRQ A;  2ZU8 A;  5BXC A;  3RSB A;  3IOH A;  2XWL A;  3I0I X;  2VS3 A;  3I0K A;  4MND A;  5D92 A;  2JCK A;  1G2V A;  2E3D A;  5I1F A;  2JCJ A;  1ZHJ A;  4L41 C;  4DE7 A;  2MZB A;  4Y7T A;  5C4E A;  2XME A;  5AJO A;  4B2X A;  1ZJO A;  1KWS A;  4P00 A;  2AEC A;  3SXE A;  3Q7U A;  3IOI A;  5EJ1 A;  1WT2 A;  1PZY B;  1VZU A;  3I0L A;  5CQO A;  1H7F A;  1FGG A;  1PZT A;  1H5S C;  4AYL A;  4G3S A;  4EE4 A;  2P6W A;  1O7O A;  1XHB A;  3OKR A;  4MYB A;  1INI A;  1H4E A;  5CMH A;  4M2A A;  3R2W A;  1VZT A;  4KNX A;  4B42 A;  4HG6 A;  2RIT A;  1VGZ A;  3NGW A;  3V91 A;  1G95 A;  4FIY A;  2OEG A;  5IDT A;  3GUE A;  2XWN A;  2DPW A;  2YQJ A;  1LL2 A;  1LL3 A;  1R7Y A;  3RMW A;  4Y62 A;  2A8U A;  1R7V A;  3ZLK A;  2VD4 A;  4BQH A;  2WAW A;  3DK5 A;  5IDS A;  1R82 A;  4JIS A;  2FFV A;  3T7O A;  4ZDQ A;  5CQN X;  4M2B A;  4Y6N A;  1JV3 A;  4G3Q A;  3ZGF A;  5FTV A;  4IRP A;  3SX7 A;  5C1H A;  1ZCT A;  4NAK A;  1ZJ1 A;  3CKV A;  2RJ9 A;  3ZGG A;  4EE3 A;  5DDT A;  1H7G A;  5FU0 A;  1ZCV A;  1WVC A;  1LZJ A;  3BRK X;  1R81 A;  2QH5 A;  1W55 A;  1FO9 A;  3U0X A;  2Q4J A;  4NAN A;  3OH1 A;  1WT1 A;  1OMX A;  1S4N A;  4JD0 A;  3K8D A;  2FYD B;  3KIA A;  3N9W A;  5CQM X;  5C36 A;  2JCL A;  1GA8 A;  3D5N A;  5AJP A;  3JTJ A;  4FQW A;  2PGV A;  4BMA A;  3CKQ A;  1VH1 A;  2ICY A;  2O1H A;  2PX7 A;  1FOA A;  1G0R A;  2YQS A;  1H4D A;  4HO9 A;  5AJN A;  2ICX A;  1GX0 A;  4FIX A;  3ZF8 A;  4G87 A;  5C48 A;  1H7Q A;  4FCU A;  1NMM B;  4FRM A;  3V0O A;  4EEM A;  2AE7 A;  2I7B A;  2VXM A;  1OQM B;  3PKP A;  1HJL A;  2UX8 A;  2Y7A A;  3I0D A;  3ST8 A;  1FR9 A;  2P73 A;  1QGQ A;  1ZDF A;  1FWY A;  4D11 C;  2JCO A;  4CJ8 A;  1G1L A;  1V82 A;  2X5S A;  3E25 A;  1W77 A;  1FGX A;  4Y7F A;  3RMV A;  1TW5 A;  5C3B A;  1HM8 A;  4FRA A;  4HO0 A;  1VPA A;  3DJ4 A;  4O6N A;  4EEA A;  4FRL A;  4G3P A;  2FYC B;  2GGQ A;  4NAI A;  5CQL X;  1OMZ A;  2VXL A;  2YC3 A;  3JUK A;  1TVY A;  1QWJ A;  4MIX A;  2RJ6 A;  1O7Q A;  1ZI1 A;  1WT3 A;  1ZI4 A;  1G8O A;  2I5E A;  2RIX A;  3OAM A;  4B4M A;  5FUH A;  1G93 A;  1O0R A;  5J49 A;  2E8B A;  5C4F A;  2VS5 A;  4C2S A;  4D0Z A;  4Y7G A;  4Y63 A;  3QVB A;  4J18 A;  4Y7V A;  2X65 A;  4B2W A;  1NF5 B;  4FRP A;  5L6V A;  5FV9 A;  1G9R A;  1VH3 A;  3FWW A;  5IFY A;  2QKX A;  1ZCY A;  2VSH A;  3BCV A;  1HM9 A;  3SX3 A;  3Q80 A;  1HM0 A;  4KQL A;  2Z87 A;  3TZT A;  2WVK A;  1ZDG A;  1HJJ A;  4KNR A;  3IOJ A;  2FFU A;  5CMF X;  2FYA A;  2WEE A;  4HO8 A;  1I52 A;  4EVW A;  3OH2 A;  3I0J A;  2RJ8 A;  4D0T A;  4HO2 A;  2RJ1 A;  2WGZ A;  2YES A;  4B4G A;  1LVW A;  5C1L A;  5CMI A;  1VGU A;  3D8V A;  4ASJ A;  2OI7 A;  2QGI A;  4B3U A;  5C3A A;  2AM3 A;  2FY7 A;  1FXJ A;  4KRV A;  1GQ9 A;  2AH9 A;  3POL A;  3V90 A;  2W0V A;  4HO5 A;  2OI6 A;  4P02 A;  5L6S A;  1EZI A;  4UEG A;  1YP4 A;  2V0J A;  4IRQ A;  3ZLL A;  1ZJ0 A;  5C4C A;  3I0F A;  3Q4S A;  2XMH A;  3OH4 A;  1H7H A;  1JVD A;  2Y4L A;  4Y7U A;  1G3L A;  2FYB A;  2C0N A;  1NHE B;  3U0Y A;  5FYE A;  4KXO A;  2RJ5 A;  1MP5 A;  1YRO B;  4XWI A;  2OI5 A;  2V0I A;  4CVH A;  1JYL A;  5C4B A;  5FU8 A;  1INJ A;  1O23 B;  3DUV A;  5DDV A;  3SXG A;  1ZCU A;  3I0C A;  2Y4J A;  4D11 A;  4HO4 A;  1ZI3 A;  4HO3 A;  1HV9 A;  1MC3 A;  1H5S B;  1FR8 A;  1WT0 A;  3I0G A;  1FZW A;  5CQP A;  2WE9 A;  2AM5 A;  4O6M A;  1JYK A;  4KPZ A;  2YC5 A;  2GGO A;  3CKJ A;  4FCE A;  2BO8 A;  2BO7 A;  1LZ7 A;  1ZJ2 A;  3LW6 A;  3CKN A;  2AGD A;  1YP3 A;  2A8W A;  2D7I A;  3U2U A;  2YQC A;  1JVG A;  3SX8 A;  5CMG X;  4HCQ A;  4E1K A;  4B4B A;  1H5S D;  3SPT A;  1SS9 A;  4FRB A;  1WSZ A;  1ZJP A;  1VIC A;  3T7N A;  1ON6 A;  2RJ7 A;  1GWW A;  1VGT A;  1H5S A;  5D91 A;  3USR A;  1H3M A;  2V0K A;  3U2W A;  1XZ6 A;  3D98 A;  4AAW A;  1LZ0 A;  3FOQ A;  3OH3 A;  5C47 A;  5C3D A;  1G23 A;  4AC3 A;  1IIM A;  1QGS A;  2Y6P A;  1W57 A;  1H7T A;  1Z90 A;  3CGX A;  4EEO A;  3U2T A;  2X60 A;  4B5B A;  4Y9X A;  4LW6 A;  4KC4 A;  3F1C A;  5EJZ A;  1IIN A;  2RIZ A;  1MP4 A;  2O1G A;  3V0N A;  2WVM A;  1NWG B;  3V0P A;  4Q7C A;  2WVL A;  3SXC A;  2YCM A;  1H4C A;  3SXD A;  1R7T A;  4GBP A;  3V0L A;  4M28 A;  3PKQ A;  1K4V A;  2X5Z A;  4K6R A;  1VGW A;  3JUJ A;  5C49 A;  4FRD A;  3E26 A;  1V83 A;  3V8Y A;  1ZIZ A;  5C38 A;  1YP2 A;  2J0A A;  2OEF A;  1S4P A;  1TZF A;  2W0W A;  2Y4M A;  2V0H A;  2PA4 A;  1LZI A;  3CKO A;  2P72 A;  1H5R B;  4FRE A;  3USQ A;  4ECM A;  1ZJ3 A;  4YS8 A;  2ZU9 A;  5C1G A;  3F1Y A;  3V0M A;  3SX5 A;  1H7E A;  3T7M A;  2D7R A;  2I5K A;  2VSI A;  2AES A;  5JQQ A;  2NXV A;  1R7X A;  3OC9 A;  1FXO A;  1MP3 A;  1ZI5 A;  3OH0 A;  1H5T B;  5EIY A;  3U2V A;  5C8R A;  1GX4 A;  1GQC A;  5FTS A;  1JV1 A;  2AM4 A;  2VK9 A;  1R80 A;  4KPX A;  2Y4K A;  3PNN A;  3SXA A;  3SXB A;  3U2X A;  1QG8 A;  1H5R A;  2VFZ A;  1TW1 A;  2D0J A;  1FRW A;  1G97 A;  2RJ4 A;  1ON8 A;  3I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...