1NWGB

Beta-1,4-galactosyltransferase complex with alpha-lactalbumin and n-butanoyl-glucoamine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lactalbumin
publication title ALPHA-LACTALBUMIN (LA) STIMULATES MILK BETA-1,4-GALACTOSYLTRANSFERASE I (BETA 4GAL-T1) TO TRANSFER GLUCOSE FROM UDP-GLUCOSE TO N-ACETYLGLUCOSAMINE. CRYSTAL STRUCTURE OF BETA 4GAL-T1 X LA COMPLEX WITH UDP-GLC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase activator/transferase
total genus 91
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nwgB00
1MP5A 2XMHA 4Y6NA 3V0MA 2AECA 4EE3A 1FGXA 1FOAA 1VICA 1TZFA 2FY7A 2V0KA 2WE9A 1HM8A 4P00A 3DK5A 2OI6A 4JISA 1ON6A 2OI7A 4B5BA 1H5SC 4B4MA 1WT3A 1YROB 1TW5A 3V90A 1YP3A 2OEGA 5CMFX 4YS8A 4Y7UA 3I0JA 4KXOA 4HO6A 2P6WA 3PKQA 4C2SA 3T7OA 1YP4A 2OEFA 2D0JA 3IOJA 2OI5A 5CQLX 1FXJA 1H5RA 2WVKA 1H7QA 3D8VA 1ZCVA 4B3UA 4EEGA 2RIYA 3OAMA 3GUEA 3OGZA 1G8OA 1O7QA 2NXVA 1OMXA 2VXLA 1VGTA 2ZU8A 3RMWA 4MYBA 4NAIA 3CKOA 1GQCA 2O1HA 1NHEB 3F1CA 1ZDGA 4NANA 1H7FA 3DUVA 3ZLKA 1VGUA 5FYEA 1VM8A 1K4VA 2RJ0A 1GWWA 1LZJA 2AM5A 2Y7AA 1G9RA 5CQPA 1ZJ2A 5AJOA 4KPXA 4EE5A 1W77A 4KNXA 3SXAA 5C4EA 5C47A 4EE4A 4FRQA 1O23B 2O1FA 1H7GA 4Y7FA 1LZ7A 5HS2A 2WVLA 5FTSA 1VZUA 3ZGGA 5FUHA 2JCOA 5L6VA 3DJ4A 4Y7VA 4EEAA 3I0HA 3T7NA 2FFUA 2ICXA 2XWMA 3QVBA 1H4EA 1OQMB 3U0XA 5I1FA 4DE7A 2BO8A 1Z90A 2CU2A 2RJ6A 1TVYA 2YQSA 4KC2A 4IRPA 4CJBA 1H5SD 4Y6UA 4J18A 2YC3A 1H3MA 2FYCB 2FFVA 4D11C 4EEMA 1NKHB 3SX5A 1MC3A 4Y7GA 3ST8A 4KC4A 1WT0A 3U2UA 1XHBA 1H4DA 3OH1A 4FROA 3BRKX 3EE5A 3OKRA 5IFYA 3Q4SA 1S4OA 1QGSA 2RIXA 3K8DA 1GQ9A 5C1GA 1PZYB 4M4KA 2I5EA 4ARWA 2APCA 3CU0A 2I7BA 2Z87A 2W0VA 3I0CA 2WVMA 4MNDA 2YQCA 1ZIZA 4FRAA 4FRBA 2XMEA 2X60A 1W57A 1PZTA 4G3QA 2RITA 2XWNA 4HO0A 5DDTA 3U2WA 4B4BA 4Y63A 1MP3A 2AESA 4B4GA 1GX0A 1GX4A 4AYJA 2AM3A 4NALA 1ZCUA 3FOQA 4Y7TA 5DDVA 2VFZA 4FRLA 3U2VA 1O0RA 2V0IA 2V0LA 1GA8A 5J49A 5C4CA 1HV9A 2X5ZA 3SXCA 1WVCA 1G97A 3SXDA 3TQDA 2AE7A 1EYRA 4P02A 1TW1A 4NAKA 4ASJA 3I0FA 4ZDQA 3JUJA 1G1LA 1FR9A 1XZ6A 1ZJ3A 5EJZA 4M2BA 3ZGFA 2VS5A 4HCQA 3SXEA 2X65A 3CGXA 1H5TA 5C1HA 1H5SA 2JCJA 5C3AA 3USQA 3JTJA 1G3LA 1LZIA 2VSIA 3RMVA 5AJNA 5IDSA 4AYLA 1HM0A 3Q7UA 5EIYA 4GBPA 4E1KA 3Q80A 4FRDA 3SX3A 2X5SA 3PKPA 1ZJPA 4KPZA 1H5RB 2ZU9A 2RJ4A 3I0GA 4EEOA 1FG5N 2VXMA 3D98A 1H5TB 4Y62A 3USRA 1H5SB 1G0RA 1LZ0A 3V0NA 1WSZA 1G2VA 1G95A 4KNRA 1ZJ1A 3HL3A 2FYAA 3SX7A 1ZI1A 4DECA 1LVWA 4L41C 4R7PA 2Y4MA 2MZBA 2RJ7A 1JVGA 1G23A 4D48A 4HO4A 4HOCA 3I0IX 4UEGA 3OH3A 1V82A 1E5KA 4HO2A 1ZJOA 2V0HA 2E8BA 3U2XA 5C38A 3SXGA 3E25A 5FU0A 3V0PA 4ASYA 3FWWA 4KRVA 4ECMA 4G3SA 3V8YA 2W0WA 1ZCYA 2RJ1A 4Y64A 4JD0A 3JUKA 3OH2A 2VS4A 3V8ZA 1R7VA 1JYKA 1V84A 4FQWA 2D7IA 4FCEA 5CMIA 3SX8A 1ZI4A 4G3PA 4B2XA 1H7HA 2I5KA 1O7OA 2AH9A 5CQNX 1EZIA 2QKXA 2Y4KA 4M28A 2Z86A 2QGIA 5FV9A 3ZLLA 4XWIA 1GWVA 2A8UA 4HO9A 1R80A 1YP2A 3V91A 5CQOA 3U2TA 3CKNA 1IINA 2A8WA 1WT2A 2FYBA 4B42A 2RJ5A 2FYDB 1H7LA 2YCMA 1NF5B 4CJCA 5C3BA 1HJLA 1VZXA 3SXBA 3N9WA 2PGVA 4LW6A 4D11A 1INJA 4Y9XA 2PX7A 5IDTA 2P72A 3I0LA 2WEEA 3NGWA 1ON8A 3OH4A 4KC1A 5CQMX 1ZHJA 2BO7A 2Y4LA 4M2AA 3V0OA 2BO4A 5C36A 3R2WA 5C3DA 3BCVA 3POLA 3SPTA 1QGQA 2PA4A 2PGYA 3I0DA 3O3PA 2QH5A 1VH1A 5C4FA 4HO8A 3V0LA 1JVDA 2GGOA 5C48A 2VD4A 1QG8A 3OH0A 4BMAA 3IOHA 3K8EA 1VGZA 4CVHA 1ZJ0A 1FXOA 1HJJA 5C49A 1S4NA 2YESA 1W55A 5JQQA 3ZF8A 2E3DA 4HO3A 2O1GA 2ICYA 1KWSA 2AM4A 3D5NA 3LW6A 4B2WA 5CMJA 4FREA 5FU8A 1NMMB 4KT7A 3F1YA 1FRWA 2RJ9A 2XWLA 3IOIA 3E26A 2AGDA 4KQLA 5C8RA 2WGZA 3PNNA 1R7UA 1JYLA 4FRMA 1NQIB 4BQHA 2YQJA 2VS3A 2GGQA 1FO8A 1VH3A 1FO9A 3I0EA 4AAWA 1VZTA 1R7XA 1ZCTA 4D0TA 1H7TA 1G93A 1H7EA 3CKJA 1I52A 4IRQA 1R82A 2RIZA 1HM9A 5C4DA 1LL2A 2Y4JA 1MP4A 1SS9A 1FR8A 1ZI5A 5CMHA 4HG6A 1S4PA 3R3IA 4FRPA 5L6SA 4AC3A 1QWJA 5C1LA 2BO6A 1IIMA 1NWGB 2Y6PA 4HO5A 1INIA 2RJ8A 1ZI3A 4FCUA 5AJPA 5CMGX 2WAWA 4G87A 2V0JA 1JV3A 3I0KA 1LL0A 2P73A 3RSBA 2YQHA 2DPWA 4LW3A 2JCKA 3CKQA 1FWYA 1JV1A 2JCLA 1R7YA 4EVWA 1H4CA 3OC9A 3V0QA 5BXCA 3KIAA 1WT1A 3U0YA 2Q4JA 3CKVA 1V83A 2D7RA 1R7TA 3TZTA 1VPAA 1VGWA 4K6RA 4D0ZA 1OMZA 1FZWA 3T7MA 1R81A 2VSHA 4DDZA 1LL3A 5EJ1A 4FRHA 5C4BA 2ZU7A 1ZDFA 4CJ8A 5FTVA 1FGGA 2YC5A 2UX8A
chains in the Genus database with same CATH superfamily
1MP5A 2XMHA 4Y6NA 3V0MA 2AECA 4EE3A 1FGXA 1FOAA 1VICA 1TZFA 2FY7A 2V0KA 2WE9A 4Q7CA 1HM8A 4P00A 3DK5A 2OI6A 4JISA 1ON6A 2OI7A 4B5BA 1H5SC 4B4MA 1WT3A 1YROB 1TW5A 3V90A 1YP3A 2OEGA 5CMFX 4O6MA 4YS8A 4Y7UA 3I0JA 4KXOA 4HO6A 2P6WA 3PKQA 4C2SA 3T7OA 1YP4A 2OEFA 2D0JA 3IOJA 2OI5A 5CQLX 1FXJA 1H5RA 2WVKA 1H7QA 3D8VA 1ZCVA 4B3UA 4EEGA 2RIYA 3OAMA 3GUEA 3OGZA 1G8OA 1O7QA 2NXVA 1OMXA 2VXLA 1VGTA 2ZU8A 3RMWA 4MYBA 4NAIA 3CKOA 1GQCA 2O1HA 1NHEB 3F1CA 1ZDGA 4NANA 1H7FA 3DUVA 3ZLKA 1VGUA 5FYEA 1VM8A 1K4VA 2RJ0A 1GWWA 1LZJA 2AM5A 2Y7AA 1G9RA 5CQPA 1ZJ2A 5AJOA 4KPXA 4EE5A 1W77A 4KNXA 3SXAA 5C4EA 5C47A 4EE4A 4FRQA 1O23B 2O1FA 1H7GA 4Y7FA 1LZ7A 5HS2A 2WVLA 5FTSA 1VZUA 3ZGGA 5FUHA 2JCOA 5L6VA 3DJ4A 4Y7VA 4EEAA 3I0HA 3T7NA 2FFUA 2ICXA 2XWMA 3QVBA 1H4EA 1OQMB 3U0XA 5I1FA 4DE7A 2BO8A 1Z90A 2CU2A 2RJ6A 1TVYA 2YQSA 4KC2A 4IRPA 4CJBA 1H5SD 4Y6UA 4J18A 2YC3A 1H3MA 2FYCB 2FFVA 4D11C 4EEMA 1NKHB 3SX5A 1MC3A 4Y7GA 3ST8A 4KC4A 1WT0A 3U2UA 1XHBA 1H4DA 3OH1A 4FROA 3BRKX 3EE5A 3OKRA 5IFYA 3Q4SA 1S4OA 1QGSA 2RIXA 3K8DA 1GQ9A 5C1GA 1PZYB 4M4KA 2I5EA 4ARWA 2APCA 3CU0A 2I7BA 2Z87A 2W0VA 3I0CA 2WVMA 4MNDA 2YQCA 1ZIZA 4FRAA 4FRBA 2XMEA 2X60A 1W57A 1PZTA 4G3QA 2RITA 2XWNA 4HO0A 2J0AA 5DDTA 3U2WA 4B4BA 4Y63A 1MP3A 2AESA 4B4GA 1GX0A 1GX4A 4AYJA 2AM3A 4NALA 1ZCUA 3FOQA 4O6NA 4Y7TA 2VFZA 5DDVA 4FRLA 3U2VA 1O0RA 2V0IA 2V0LA 1GA8A 5J49A 5C4CA 1HV9A 2X5ZA 3SXCA 1WVCA 1G97A 3SXDA 3TQDA 2AE7A 1EYRA 4P02A 1TW1A 4NAKA 4ASJA 3I0FA 4ZDQA 3JUJA 1G1LA 1FR9A 1XZ6A 1ZJ3A 5EJZA 4M2BA 3ZGFA 2VS5A 4HCQA 3SXEA 2X65A 3CGXA 4MIXA 1H5TA 5C1HA 1H5SA 2JCJA 5C3AA 2C0NA 3USQA 3JTJA 1G3LA 1LZIA 2VSIA 3RMVA 5AJNA 5IDSA 4AYLA 1HM0A 3Q7UA 5EIYA 4GBPA 4E1KA 3Q80A 4FRDA 3SX3A 2X5SA 3PKPA 1ZJPA 4KPZA 1H5RB 2ZU9A 2RJ4A 3I0GA 4EEOA 1FG5N 2VXMA 3D98A 1H5TB 4Y62A 3USRA 1H5SB 1G0RA 1LZ0A 3V0NA 1WSZA 1G2VA 1G95A 4KNRA 1ZJ1A 3HL3A 2FYAA 3SX7A 1ZI1A 4DECA 1LVWA 4L41C 4R7PA 2Y4MA 2MZBA 2RJ7A 1JVGA 1G23A 4D48A 4HO4A 4HOCA 3I0IX 4UEGA 3OH3A 1V82A 1E5KA 4HO2A 1ZJOA 2V0HA 2E8BA 3U2XA 5C38A 3SXGA 3E25A 5FU0A 3V0PA 4ASYA 3FWWA 4KRVA 4ECMA 4G3SA 2J0BA 3V8YA 2W0WA 1ZCYA 2RJ1A 4Y64A 4JD0A 3JUKA 3OH2A 2VS4A 3V8ZA 1R7VA 1JYKA 1V84A 4FQWA 2D7IA 4FCEA 5CMIA 3SX8A 1ZI4A 4G3PA 4B2XA 1H7HA 2I5KA 1O7OA 2AH9A 5CQNX 1EZIA 2QKXA 2Y4KA 4M28A 2Z86A 2QGIA 5FV9A 3ZLLA 4FIYA 4XWIA 1GWVA 2A8UA 4HO9A 1R80A 1YP2A 3V91A 5CQOA 3U2TA 3CKNA 1IINA 2A8WA 1WT2A 2FYBA 4B42A 2RJ5A 2FYDB 1H7LA 2YCMA 1NF5B 5D91A 4CJCA 5C3BA 1HJLA 1VZXA 3SXBA 3N9WA 2PGVA 4LW6A 4D11A 1INJA 4Y9XA 2PX7A 5IDTA 2P72A 3I0LA 2WEEA 3NGWA 1ON8A 3OH4A 4KC1A 5CQMX 1ZHJA 2BO7A 2Y4LA 4M2AA 3V0OA 2BO4A 5C36A 3R2WA 5C3DA 3BCVA 3POLA 3SPTA 1QGQA 2PA4A 2PGYA 3I0DA 3O3PA 2QH5A 1VH1A 5C4FA 4HO8A 3V0LA 1JVDA 2GGOA 5C48A 2VD4A 1QG8A 3OH0A 4BMAA 3IOHA 3K8EA 1VGZA 4CVHA 1ZJ0A 1FXOA 1HJJA 5C49A 1S4NA 2YESA 1W55A 5JQQA 3ZF8A 2E3DA 4HO3A 2O1GA 2ICYA 1KWSA 2AM4A 3D5NA 3LW6A 4B2WA 5CMJA 4FREA 5FU8A 1NMMB 4KT7A 3F1YA 1FRWA 2RJ9A 2XWLA 3IOIA 3E26A 2AGDA 4KQLA 5C8RA 2WGZA 3PNNA 1R7UA 1JYLA 4FRMA 1NQIB 4BQHA 2YQJA 2VS3A 2GGQA 4FIXA 1FO8A 1VH3A 1FO9A 3I0EA 4AAWA 1VZTA 1R7XA 1ZCTA 4D0TA 1H7TA 1G93A 1H7EA 3CKJA 1I52A 4IRQA 1R82A 2RIZA 1HM9A 5C4DA 1LL2A 2Y4JA 1MP4A 1SS9A 1FR8A 1ZI5A 5CMHA 4HG6A 1S4PA 3R3IA 4FRPA 5D92A 5L6SA 4AC3A 1QWJA 5C1LA 2BO6A 1IIMA 1NWGB 2Y6PA 4HO5A 1INIA 2RJ8A 1ZI3A 4FCUA 5AJPA 5CMGX 2WAWA 4G87A 2V0JA 1JV3A 3I0KA 1LL0A 2P73A 3RSBA 2YQHA 2VK9A 2DPWA 4LW3A 2JCKA 3CKQA 1FWYA 1JV1A 2JCLA 1R7YA 4EVWA 1H4CA 3OC9A 3V0QA 5BXCA 3KIAA 1WT1A 3U0YA 2Q4JA 3CKVA 1V83A 2D7RA 1R7TA 3TZTA 1VPAA 1VGWA 4K6RA 4D0ZA 1OMZA 1FZWA 3T7MA 1R81A 2VSHA 4DDZA 1LL3A 5EJ1A 4FRHA 5C4BA 2ZU7A 1ZDFA 4CJ8A 5FTVA 1FGGA 2YC5A 2UX8A
chains in the Genus database with same CATH topology
1MP5A 2XMHA 4Y6NA 3V0MA 2AECA 4EE3A 1FGXA 1FOAA 1VICA 1TZFA 2FY7A 2V0KA 2WE9A 4Q7CA 1HM8A 4P00A 3DK5A 2OI6A 4JISA 1ON6A 2OI7A 4B5BA 1H5SC 4B4MA 1WT3A 1YROB 1TW5A 3V90A 1YP3A 2OEGA 5CMFX 4O6MA 4YS8A 4Y7UA 3I0JA 4KXOA 4HO6A 2P6WA 3PKQA 4C2SA 3T7OA 1YP4A 2OEFA 2D0JA 3IOJA 2OI5A 5CQLX 1FXJA 1H5RA 2WVKA 1H7QA 3D8VA 1ZCVA 4B3UA 4EEGA 2RIYA 3OAMA 3GUEA 3OGZA 1G8OA 1O7QA 2NXVA 1OMXA 2VXLA 1VGTA 2ZU8A 3RMWA 4MYBA 4NAIA 3CKOA 1GQCA 2O1HA 1NHEB 3F1CA 1ZDGA 4NANA 1H7FA 3DUVA 3ZLKA 1VGUA 5FYEA 1VM8A 1K4VA 2RJ0A 1GWWA 1LZJA 2AM5A 2Y7AA 1G9RA 5CQPA 1ZJ2A 5AJOA 4KPXA 4EE5A 1W77A 4KNXA 3SXAA 5C4EA 5C47A 4EE4A 4FRQA 1O23B 2O1FA 1H7GA 4Y7FA 1LZ7A 5HS2A 2WVLA 5FTSA 1VZUA 3ZGGA 5FUHA 2JCOA 5L6VA 3DJ4A 4Y7VA 4EEAA 3I0HA 3T7NA 2FFUA 2ICXA 2XWMA 3QVBA 1H4EA 1OQMB 3U0XA 5I1FA 4DE7A 2BO8A 1Z90A 2CU2A 2RJ6A 1TVYA 2YQSA 4KC2A 4IRPA 4CJBA 1H5SD 4Y6UA 4J18A 2YC3A 1H3MA 2FYCB 2FFVA 4D11C 4EEMA 1NKHB 3SX5A 1MC3A 4Y7GA 3ST8A 4KC4A 1WT0A 3U2UA 1XHBA 1H4DA 3OH1A 4FROA 3BRKX 3EE5A 3OKRA 5IFYA 3Q4SA 1S4OA 1QGSA 2RIXA 3K8DA 1GQ9A 5C1GA 1PZYB 4M4KA 2I5EA 4ARWA 2APCA 3CU0A 2I7BA 2Z87A 2W0VA 3I0CA 2WVMA 4MNDA 2YQCA 1ZIZA 4FRAA 4FRBA 2XMEA 2X60A 1W57A 1PZTA 4G3QA 2RITA 2XWNA 4HO0A 2J0AA 5DDTA 3U2WA 4B4BA 4Y63A 1MP3A 2AESA 4B4GA 1GX0A 1GX4A 4AYJA 2AM3A 4NALA 1ZCUA 3FOQA 4O6NA 4Y7TA 2VFZA 5DDVA 4FRLA 3U2VA 1O0RA 2V0IA 2V0LA 1GA8A 5J49A 5C4CA 1HV9A 2X5ZA 3SXCA 1WVCA 1G97A 3SXDA 3TQDA 2AE7A 1EYRA 4P02A 1TW1A 4NAKA 4ASJA 3I0FA 4ZDQA 3JUJA 1G1LA 1FR9A 1XZ6A 1ZJ3A 5EJZA 4M2BA 3ZGFA 2VS5A 4HCQA 3SXEA 2X65A 3CGXA 4MIXA 1H5TA 5C1HA 1H5SA 2JCJA 5C3AA 2C0NA 3USQA 3JTJA 1G3LA 1LZIA 2VSIA 3RMVA 5AJNA 5IDSA 4AYLA 1HM0A 3Q7UA 5EIYA 4GBPA 4E1KA 3Q80A 4FRDA 3SX3A 2X5SA 3PKPA 1ZJPA 4KPZA 1H5RB 2ZU9A 2RJ4A 3I0GA 4EEOA 1FG5N 2VXMA 3D98A 1H5TB 4Y62A 3USRA 1H5SB 1G0RA 1LZ0A 3V0NA 1WSZA 1G2VA 1G95A 4KNRA 1ZJ1A 3HL3A 2FYAA 3SX7A 1ZI1A 4DECA 1LVWA 4L41C 4R7PA 2Y4MA 2MZBA 2RJ7A 1JVGA 1G23A 4D48A 4HO4A 4HOCA 3I0IX 4UEGA 3OH3A 1V82A 1E5KA 4HO2A 1ZJOA 2V0HA 2E8BA 3U2XA 5C38A 3SXGA 3E25A 5FU0A 3V0PA 4ASYA 3FWWA 4KRVA 4ECMA 4G3SA 2J0BA 3V8YA 2W0WA 1ZCYA 2RJ1A 4Y64A 4JD0A 3JUKA 3OH2A 2VS4A 3V8ZA 1R7VA 1JYKA 1V84A 4FQWA 2D7IA 4FCEA 5CMIA 3SX8A 1ZI4A 4G3PA 4B2XA 1H7HA 2I5KA 1O7OA 2AH9A 5CQNX 1EZIA 2QKXA 2Y4KA 4M28A 2Z86A 2QGIA 5FV9A 3ZLLA 4FIYA 4XWIA 1GWVA 2A8UA 4HO9A 1R80A 1YP2A 3V91A 5CQOA 3U2TA 3CKNA 1IINA 2A8WA 1WT2A 2FYBA 4B42A 2RJ5A 2FYDB 1H7LA 2YCMA 1NF5B 5D91A 4CJCA 5C3BA 1HJLA 1VZXA 3SXBA 3N9WA 2PGVA 4LW6A 4D11A 1INJA 4Y9XA 2PX7A 5IDTA 2P72A 3I0LA 2WEEA 3NGWA 1ON8A 3OH4A 4KC1A 5CQMX 1ZHJA 2BO7A 2Y4LA 4M2AA 3V0OA 2BO4A 5C36A 3R2WA 5C3DA 3BCVA 3POLA 3SPTA 1QGQA 2PA4A 2PGYA 3I0DA 3O3PA 2QH5A 1VH1A 5C4FA 4HO8A 3V0LA 1JVDA 2GGOA 5C48A 2VD4A 1QG8A 3OH0A 4BMAA 3IOHA 3K8EA 1VGZA 4CVHA 1ZJ0A 1FXOA 1HJJA 5C49A 1S4NA 2YESA 1W55A 5JQQA 3ZF8A 2E3DA 4HO3A 2O1GA 2ICYA 1KWSA 2AM4A 3D5NA 3LW6A 4B2WA 5CMJA 4FREA 5FU8A 1NMMB 4KT7A 3F1YA 1FRWA 2RJ9A 2XWLA 3IOIA 3E26A 2AGDA 4KQLA 5C8RA 2WGZA 3PNNA 1R7UA 1JYLA 4FRMA 1NQIB 4BQHA 2YQJA 2VS3A 2GGQA 4FIXA 1FO8A 1VH3A 1FO9A 3I0EA 4AAWA 1VZTA 1R7XA 1ZCTA 4D0TA 1H7TA 1G93A 1H7EA 3CKJA 1I52A 4IRQA 1R82A 2RIZA 1HM9A 5C4DA 1LL2A 2Y4JA 1MP4A 1SS9A 1FR8A 1ZI5A 5CMHA 4HG6A 1S4PA 3R3IA 4FRPA 5D92A 5L6SA 4AC3A 1QWJA 5C1LA 2BO6A 1IIMA 1NWGB 2Y6PA 4HO5A 1INIA 2RJ8A 1ZI3A 4FCUA 5AJPA 5CMGX 2WAWA 4G87A 2V0JA 1JV3A 3I0KA 1LL0A 2P73A 3RSBA 2YQHA 2VK9A 2DPWA 4LW3A 2JCKA 3CKQA 1FWYA 1JV1A 2JCLA 1R7YA 4EVWA 1H4CA 3OC9A 3V0QA 5BXCA 3KIAA 1WT1A 3U0YA 2Q4JA 3CKVA 1V83A 2D7RA 1R7TA 3TZTA 1VPAA 1VGWA 4K6RA 4D0ZA 1OMZA 1FZWA 3T7MA 1R81A 2VSHA 4DDZA 1LL3A 5EJ1A 4FRHA 5C4BA 2ZU7A 1ZDFA 4CJ8A 5FTVA 1FGGA 2YC5A 2UX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MP5 A;  2XMH A;  4Y6N A;  3V0M A;  2AEC A;  4EE3 A;  1FGX A;  1FOA A;  1VIC A;  1TZF A;  2FY7 A;  2V0K A;  2WE9 A;  1HM8 A;  4P00 A;  3DK5 A;  2OI6 A;  4JIS A;  1ON6 A;  2OI7 A;  4B5B A;  1H5S C;  4B4M A;  1WT3 A;  1YRO B;  1TW5 A;  3V90 A;  1YP3 A;  2OEG A;  5CMF X;  4YS8 A;  4Y7U A;  3I0J A;  4KXO A;  4HO6 A;  2P6W A;  3PKQ A;  4C2S A;  3T7O A;  1YP4 A;  2OEF A;  2D0J A;  3IOJ A;  2OI5 A;  5CQL X;  1FXJ A;  1H5R A;  2WVK A;  1H7Q A;  3D8V A;  1ZCV A;  4B3U A;  4EEG A;  2RIY A;  3OAM A;  3GUE A;  3OGZ A;  1G8O A;  1O7Q A;  2NXV A;  1OMX A;  2VXL A;  1VGT A;  2ZU8 A;  3RMW A;  4MYB A;  4NAI A;  3CKO A;  1GQC A;  2O1H A;  1NHE B;  3F1C A;  1ZDG A;  4NAN A;  1H7F A;  3DUV A;  3ZLK A;  1VGU A;  5FYE A;  1VM8 A;  1K4V A;  2RJ0 A;  1GWW A;  1LZJ A;  2AM5 A;  2Y7A A;  1G9R A;  5CQP A;  1ZJ2 A;  5AJO A;  4KPX A;  4EE5 A;  1W77 A;  4KNX A;  3SXA A;  5C4E A;  5C47 A;  4EE4 A;  4FRQ A;  1O23 B;  2O1F A;  1H7G A;  4Y7F A;  1LZ7 A;  5HS2 A;  2WVL A;  5FTS A;  1VZU A;  3ZGG A;  5FUH A;  2JCO A;  5L6V A;  3DJ4 A;  4Y7V A;  4EEA A;  3I0H A;  3T7N A;  2FFU A;  2ICX A;  2XWM A;  3QVB A;  1H4E A;  1OQM B;  3U0X A;  5I1F A;  4DE7 A;  2BO8 A;  1Z90 A;  2CU2 A;  2RJ6 A;  1TVY A;  2YQS A;  4KC2 A;  4IRP A;  4CJB A;  1H5S D;  4Y6U A;  4J18 A;  2YC3 A;  1H3M A;  2FYC B;  2FFV A;  4D11 C;  4EEM A;  1NKH B;  3SX5 A;  1MC3 A;  4Y7G A;  3ST8 A;  4KC4 A;  1WT0 A;  3U2U A;  1XHB A;  1H4D A;  3OH1 A;  4FRO A;  3BRK X;  3EE5 A;  3OKR A;  5IFY A;  3Q4S A;  1S4O A;  1QGS A;  2RIX A;  3K8D A;  1GQ9 A;  5C1G A;  1PZY B;  4M4K A;  2I5E A;  4ARW A;  2APC A;  3CU0 A;  2I7B A;  2Z87 A;  2W0V A;  3I0C A;  2WVM A;  4MND A;  2YQC A;  1ZIZ A;  4FRA A;  4FRB A;  2XME A;  2X60 A;  1W57 A;  1PZT A;  4G3Q A;  2RIT A;  2XWN A;  4HO0 A;  5DDT A;  3U2W A;  4B4B A;  4Y63 A;  1MP3 A;  2AES A;  4B4G A;  1GX0 A;  1GX4 A;  4AYJ A;  2AM3 A;  4NAL A;  1ZCU A;  3FOQ A;  4Y7T A;  5DDV A;  2VFZ A;  4FRL A;  3U2V A;  1O0R A;  2V0I A;  2V0L A;  1GA8 A;  5J49 A;  5C4C A;  1HV9 A;  2X5Z A;  3SXC A;  1WVC A;  1G97 A;  3SXD A;  3TQD A;  2AE7 A;  1EYR A;  4P02 A;  1TW1 A;  4NAK A;  4ASJ A;  3I0F A;  4ZDQ A;  3JUJ A;  1G1L A;  1FR9 A;  1XZ6 A;  1ZJ3 A;  5EJZ A;  4M2B A;  3ZGF A;  2VS5 A;  4HCQ A;  3SXE A;  2X65 A;  3CGX A;  1H5T A;  5C1H A;  1H5S A;  2JCJ A;  5C3A A;  3USQ A;  3JTJ A;  1G3L A;  1LZI A;  2VSI A;  3RMV A;  5AJN A;  5IDS A;  4AYL A;  1HM0 A;  3Q7U A;  5EIY A;  4GBP A;  4E1K A;  3Q80 A;  4FRD A;  3SX3 A;  2X5S A;  3PKP A;  1ZJP A;  4KPZ A;  1H5R B;  2ZU9 A;  2RJ4 A;  3I0G A;  4EEO A;  1FG5 N;  2VXM A;  3D98 A;  1H5T B;  4Y62 A;  3USR A;  1H5S B;  1G0R A;  1LZ0 A;  3V0N A;  1WSZ A;  1G2V A;  1G95 A;  4KNR A;  1ZJ1 A;  3HL3 A;  2FYA A;  3SX7 A;  1ZI1 A;  4DEC A;  1LVW A;  4L41 C;  4R7P A;  2Y4M A;  2MZB A;  2RJ7 A;  1JVG A;  1G23 A;  4D48 A;  4HO4 A;  4HOC A;  3I0I X;  4UEG A;  3OH3 A;  1V82 A;  1E5K A;  4HO2 A;  1ZJO A;  2V0H A;  2E8B A;  3U2X A;  5C38 A;  3SXG A;  3E25 A;  5FU0 A;  3V0P A;  4ASY A;  3FWW A;  4KRV A;  4ECM A;  4G3S A;  3V8Y A;  2W0W A;  1ZCY A;  2RJ1 A;  4Y64 A;  4JD0 A;  3JUK A;  3OH2 A;  2VS4 A;  3V8Z A;  1R7V A;  1JYK A;  1V84 A;  4FQW A;  2D7I A;  4FCE A;  5CMI A;  3SX8 A;  1ZI4 A;  4G3P A;  4B2X A;  1H7H A;  2I5K A;  1O7O A;  2AH9 A;  5CQN X;  1EZI A;  2QKX A;  2Y4K A;  4M28 A;  2Z86 A;  2QGI A;  5FV9 A;  3ZLL A;  4XWI A;  1GWV A;  2A8U A;  4HO9 A;  1R80 A;  1YP2 A;  3V91 A;  5CQO A;  3U2T A;  3CKN A;  1IIN A;  2A8W A;  1WT2 A;  2FYB A;  4B42 A;  2RJ5 A;  2FYD B;  1H7L A;  2YCM A;  1NF5 B;  4CJC A;  5C3B A;  1HJL A;  1VZX A;  3SXB A;  3N9W A;  2PGV A;  4LW6 A;  4D11 A;  1INJ A;  4Y9X A;  2PX7 A;  5IDT A;  2P72 A;  3I0L A;  2WEE A;  3NGW A;  1ON8 A;  3OH4 A;  4KC1 A;  5CQM X;  1ZHJ A;  2BO7 A;  2Y4L A;  4M2A A;  3V0O A;  2BO4 A;  5C36 A;  3R2W A;  5C3D A;  3BCV A;  3POL A;  3SPT A;  1QGQ A;  2PA4 A;  2PGY A;  3I0D A;  3O3P A;  2QH5 A;  1VH1 A;  5C4F A;  4HO8 A;  3V0L A;  1JVD A;  2GGO A;  5C48 A;  2VD4 A;  1QG8 A;  3OH0 A;  4BMA A;  3IOH A;  3K8E A;  1VGZ A;  4CVH A;  1ZJ0 A;  1FXO A;  1HJJ A;  5C49 A;  1S4N A;  2YES A;  1W55 A;  5JQQ A;  3ZF8 A;  2E3D A;  4HO3 A;  2O1G A;  2ICY A;  1KWS A;  2AM4 A;  3D5N A;  3LW6 A;  4B2W A;  5CMJ A;  4FRE A;  5FU8 A;  1NMM B;  4KT7 A;  3F1Y A;  1FRW A;  2RJ9 A;  2XWL A;  3IOI A;  3E26 A;  2AGD A;  4KQL A;  5C8R A;  2WGZ A;  3PNN A;  1R7U A;  1JYL A;  4FRM A;  1NQI B;  4BQH A;  2YQJ A;  2VS3 A;  2GGQ A;  1FO8 A;  1VH3 A;  1FO9 A;  3I0E A;  4AAW A;  1VZT A;  1R7X A;  1ZCT A;  4D0T A;  1H7T A;  1G93 A;  1H7E A;  3CKJ A;  1I52 A;  4IRQ A;  1R82 A;  2RIZ A;  1HM9 A;  5C4D A;  1LL2 A;  2Y4J A;  1MP4 A;  1SS9 A;  1FR8 A;  1ZI5 A;  5CMH A;  4HG6 A;  1S4P A;  3R3I A;  4FRP A;  5L6S A;  4AC3 A;  1QWJ A;  5C1L A;  2BO6 A;  1IIM A;  1NWG B;  2Y6P A;  4HO5 A;  1INI A;  2RJ8 A;  1ZI3 A;  4FCU A;  5AJP A;  5CMG X;  2WAW A;  4G87 A;  2V0J A;  1JV3 A;  3I0K A;  1LL0 A;  2P73 A;  3RSB A;  2YQH A;  2DPW A;  4LW3 A;  2JCK A;  3CKQ A;  1FWY A;  1JV1 A;  2JCL A;  1R7Y A;  4EVW A;  1H4C A;  3OC9 A;  3V0Q A;  5BXC A;  3KIA A;  1WT1 A;  3U0Y A;  2Q4J A;  3CKV A;  1V83 A;  2D7R A;  1R7T A;  3TZT A;  1VPA A;  1VGW A;  4K6R A;  4D0Z A;  1OMZ A;  1FZW A;  3T7M A;  1R81 A;  2VSH A;  4DDZ A;  1LL3 A;  5EJ1 A;  4FRH A;  5C4B A;  2ZU7 A;  1ZDF A;  4CJ8 A;  5FTV A;  1FGG A;  2YC5 A;  2UX8 A; 
#chains in the Genus database with same CATH topology
 1MP5 A;  2XMH A;  4Y6N A;  3V0M A;  2AEC A;  4EE3 A;  1FGX A;  1FOA A;  1VIC A;  1TZF A;  2FY7 A;  2V0K A;  2WE9 A;  4Q7C A;  1HM8 A;  4P00 A;  3DK5 A;  2OI6 A;  4JIS A;  1ON6 A;  2OI7 A;  4B5B A;  1H5S C;  4B4M A;  1WT3 A;  1YRO B;  1TW5 A;  3V90 A;  1YP3 A;  2OEG A;  5CMF X;  4O6M A;  4YS8 A;  4Y7U A;  3I0J A;  4KXO A;  4HO6 A;  2P6W A;  3PKQ A;  4C2S A;  3T7O A;  1YP4 A;  2OEF A;  2D0J A;  3IOJ A;  2OI5 A;  5CQL X;  1FXJ A;  1H5R A;  2WVK A;  1H7Q A;  3D8V A;  1ZCV A;  4B3U A;  4EEG A;  2RIY A;  3OAM A;  3GUE A;  3OGZ A;  1G8O A;  1O7Q A;  2NXV A;  1OMX A;  2VXL A;  1VGT A;  2ZU8 A;  3RMW A;  4MYB A;  4NAI A;  3CKO A;  1GQC A;  2O1H A;  1NHE B;  3F1C A;  1ZDG A;  4NAN A;  1H7F A;  3DUV A;  3ZLK A;  1VGU A;  5FYE A;  1VM8 A;  1K4V A;  2RJ0 A;  1GWW A;  1LZJ A;  2AM5 A;  2Y7A A;  1G9R A;  5CQP A;  1ZJ2 A;  5AJO A;  4KPX A;  4EE5 A;  1W77 A;  4KNX A;  3SXA A;  5C4E A;  5C47 A;  4EE4 A;  4FRQ A;  1O23 B;  2O1F A;  1H7G A;  4Y7F A;  1LZ7 A;  5HS2 A;  2WVL A;  5FTS A;  1VZU A;  3ZGG A;  5FUH A;  2JCO A;  5L6V A;  3DJ4 A;  4Y7V A;  4EEA A;  3I0H A;  3T7N A;  2FFU A;  2ICX A;  2XWM A;  3QVB A;  1H4E A;  1OQM B;  3U0X A;  5I1F A;  4DE7 A;  2BO8 A;  1Z90 A;  2CU2 A;  2RJ6 A;  1TVY A;  2YQS A;  4KC2 A;  4IRP A;  4CJB A;  1H5S D;  4Y6U A;  4J18 A;  2YC3 A;  1H3M A;  2FYC B;  2FFV A;  4D11 C;  4EEM A;  1NKH B;  3SX5 A;  1MC3 A;  4Y7G A;  3ST8 A;  4KC4 A;  1WT0 A;  3U2U A;  1XHB A;  1H4D A;  3OH1 A;  4FRO A;  3BRK X;  3EE5 A;  3OKR A;  5IFY A;  3Q4S A;  1S4O A;  1QGS A;  2RIX A;  3K8D A;  1GQ9 A;  5C1G A;  1PZY B;  4M4K A;  2I5E A;  4ARW A;  2APC A;  3CU0 A;  2I7B A;  2Z87 A;  2W0V A;  3I0C A;  2WVM A;  4MND A;  2YQC A;  1ZIZ A;  4FRA A;  4FRB A;  2XME A;  2X60 A;  1W57 A;  1PZT A;  4G3Q A;  2RIT A;  2XWN A;  4HO0 A;  2J0A A;  5DDT A;  3U2W A;  4B4B A;  4Y63 A;  1MP3 A;  2AES A;  4B4G A;  1GX0 A;  1GX4 A;  4AYJ A;  2AM3 A;  4NAL A;  1ZCU A;  3FOQ A;  4O6N A;  4Y7T A;  2VFZ A;  5DDV A;  4FRL A;  3U2V A;  1O0R A;  2V0I A;  2V0L A;  1GA8 A;  5J49 A;  5C4C A;  1HV9 A;  2X5Z A;  3SXC A;  1WVC A;  1G97 A;  3SXD A;  3TQD A;  2AE7 A;  1EYR A;  4P02 A;  1TW1 A;  4NAK A;  4ASJ A;  3I0F A;  4ZDQ A;  3JUJ A;  1G1L A;  1FR9 A;  1XZ6 A;  1ZJ3 A;  5EJZ A;  4M2B A;  3ZGF A;  2VS5 A;  4HCQ A;  3SXE A;  2X65 A;  3CGX A;  4MIX A;  1H5T A;  5C1H A;  1H5S A;  2JCJ A;  5C3A A;  2C0N A;  3USQ A;  3JTJ A;  1G3L A;  1LZI A;  2VSI A;  3RMV A;  5AJN A;  5IDS A;  4AYL A;  1HM0 A;  3Q7U A;  5EIY A;  4GBP A;  4E1K A;  3Q80 A;  4FRD A;  3SX3 A;  2X5S A;  3PKP A;  1ZJP A;  4KPZ A;  1H5R B;  2ZU9 A;  2RJ4 A;  3I0G A;  4EEO A;  1FG5 N;  2VXM A;  3D98 A;  1H5T B;  4Y62 A;  3USR A;  1H5S B;  1G0R A;  1LZ0 A;  3V0N A;  1WSZ A;  1G2V A;  1G95 A;  4KNR A;  1ZJ1 A;  3HL3 A;  2FYA A;  3SX7 A;  1ZI1 A;  4DEC A;  1LVW A;  4L41 C;  4R7P A;  2Y4M A;  2MZB A;  2RJ7 A;  1JVG A;  1G23 A;  4D48 A;  4HO4 A;  4HOC A;  3I0I X;  4UEG A;  3OH3 A;  1V82 A;  1E5K A;  4HO2 A;  1ZJO A;  2V0H A;  2E8B A;  3U2X A;  5C38 A;  3SXG A;  3E25 A;  5FU0 A;  3V0P A;  4ASY A;  3FWW A;  4KRV A;  4ECM A;  4G3S A;  2J0B A;  3V8Y A;  2W0W A;  1ZCY A;  2RJ1 A;  4Y64 A;  4JD0 A;  3JUK A;  3OH2 A;  2VS4 A;  3V8Z A;  1R7V A;  1JYK A;  1V84 A;  4FQW A;  2D7I A;  4FCE A;  5CMI A;  3SX8 A;  1ZI4 A;  4G3P A;  4B2X A;  1H7H A;  2I5K A;  1O7O A;  2AH9 A;  5CQN X;  1EZI A;  2QKX A;  2Y4K A;  4M28 A;  2Z86 A;  2QGI A;  5FV9 A;  3ZLL A;  4FIY A;  4XWI A;  1GWV A;  2A8U A;  4HO9 A;  1R80 A;  1YP2 A;  3V91 A;  5CQO A;  3U2T A;  3CKN A;  1IIN A;  2A8W A;  1WT2 A;  2FYB A;  4B42 A;  2RJ5 A;  2FYD B;  1H7L A;  2YCM A;  1NF5 B;  5D91 A;  4CJC A;  5C3B A;  1HJL A;  1VZX A;  3SXB A;  3N9W A;  2PGV A;  4LW6 A;  4D11 A;  1INJ A;  4Y9X A;  2PX7 A;  5IDT A;  2P72 A;  3I0L A;  2WEE A;  3NGW A;  1ON8 A;  3OH4 A;  4KC1 A;  5CQM X;  1ZHJ A;  2BO7 A;  2Y4L A;  4M2A A;  3V0O A;  2BO4 A;  5C36 A;  3R2W A;  5C3D A;  3BCV A;  3POL A;  3SPT A;  1QGQ A;  2PA4 A;  2PGY A;  3I0D A;  3O3P A;  2QH5 A;  1VH1 A;  5C4F A;  4HO8 A;  3V0L A;  1JVD A;  2GGO A;  5C48 A;  2VD4 A;  1QG8 A;  3OH0 A;  4BMA A;  3IOH A;  3K8E A;  1VGZ A;  4CVH A;  1ZJ0 A;  1FXO A;  1HJJ A;  5C49 A;  1S4N A;  2YES A;  1W55 A;  5JQQ A;  3ZF8 A;  2E3D A;  4HO3 A;  2O1G A;  2ICY A;  1KWS A;  2AM4 A;  3D5N A;  3LW6 A;  4B2W A;  5CMJ A;  4FRE A;  5FU8 A;  1NMM B;  4KT7 A;  3F1Y A;  1FRW A;  2RJ9 A;  2XWL A;  3IOI A;  3E26 A;  2AGD A;  4KQL A;  5C8R A;  2WGZ A;  3PNN A;  1R7U A;  1JYL A;  4FRM A;  1NQI B;  4BQH A;  2YQJ A;  2VS3 A;  2GGQ A;  4FIX A;  1FO8 A;  1VH3 A;  1FO9 A;  3I0E A;  4AAW A;  1VZT A;  1R7X A;  1ZCT A;  4D0T A;  1H7T A;  1G93 A;  1H7E A;  3CKJ A;  1I52 A;  4IRQ A;  1R82 A;  2RIZ A;  1HM9 A;  5C4D A;  1LL2 A;  2Y4J A;  1MP4 A;  1SS9 A;  1FR8 A;  1ZI5 A;  5CMH A;  4HG6 A;  1S4P A;  3R3I A;  4FRP A;  5D92 A;  5L6S A;  4AC3 A;  1QWJ A;  5C1L A;  2BO6 A;  1IIM A;  1NWG B;  2Y6P A;  4HO5 A;  1INI A;  2RJ8 A;  1ZI3 A;  4FCU A;  5AJP A;  5CMG X;  2WAW A;  4G87 A;  2V0J A;  1JV3 A;  3I0K A;  1LL0 A;  2P73 A;  3RSB A;  2YQH A;  2VK9 A;  2DPW A;  4LW3 A;  2JCK A;  3CKQ A;  1FWY A;  1JV1 A;  2JCL A;  1R7Y A;  4EVW A;  1H4C A;  3OC9 A;  3V0Q A;  5BXC A;  3KIA A;  1WT1 A;  3U0Y A;  2Q4J A;  3CKV A;  1V83 A;  2D7R A;  1R7T A;  3TZT A;  1VPA A;  1VGW A;  4K6R A;  4D0Z A;  1OMZ A;  1FZW A;  3T7M A;  1R81 A;  2VSH A;  4DDZ A;  1LL3 A;  5EJ1 A;  4FRH A;  5C4B A;  2ZU7 A;  1ZDF A;  4CJ8 A;  5FTV A;  1FGG A;  2YC5 A;  2UX8 A; 
#chains in the Genus database with same CATH homology
 1MP5 A;  2XMH A;  4Y6N A;  3V0M A;  2AEC A;  4EE3 A;  1FGX A;  1FOA A;  1VIC A;  1TZF A;  2FY7 A;  2V0K A;  2WE9 A;  4Q7C A;  1HM8 A;  4P00 A;  3DK5 A;  2OI6 A;  4JIS A;  1ON6 A;  2OI7 A;  4B5B A;  1H5S C;  4B4M A;  1WT3 A;  1YRO B;  1TW5 A;  3V90 A;  1YP3 A;  2OEG A;  5CMF X;  4O6M A;  4YS8 A;  4Y7U A;  3I0J A;  4KXO A;  4HO6 A;  2P6W A;  3PKQ A;  4C2S A;  3T7O A;  1YP4 A;  2OEF A;  2D0J A;  3IOJ A;  2OI5 A;  5CQL X;  1FXJ A;  1H5R A;  2WVK A;  1H7Q A;  3D8V A;  1ZCV A;  4B3U A;  4EEG A;  2RIY A;  3OAM A;  3GUE A;  3OGZ A;  1G8O A;  1O7Q A;  2NXV A;  1OMX A;  2VXL A;  1VGT A;  2ZU8 A;  3RMW A;  4MYB A;  4NAI A;  3CKO A;  1GQC A;  2O1H A;  1NHE B;  3F1C A;  1ZDG A;  4NAN A;  1H7F A;  3DUV A;  3ZLK A;  1VGU A;  5FYE A;  1VM8 A;  1K4V A;  2RJ0 A;  1GWW A;  1LZJ A;  2AM5 A;  2Y7A A;  1G9R A;  5CQP A;  1ZJ2 A;  5AJO A;  4KPX A;  4EE5 A;  1W77 A;  4KNX A;  3SXA A;  5C4E A;  5C47 A;  4EE4 A;  4FRQ A;  1O23 B;  2O1F A;  1H7G A;  4Y7F A;  1LZ7 A;  5HS2 A;  2WVL A;  5FTS A;  1VZU A;  3ZGG A;  5FUH A;  2JCO A;  5L6V A;  3DJ4 A;  4Y7V A;  4EEA A;  3I0H A;  3T7N A;  2FFU A;  2ICX A;  2XWM A;  3QVB A;  1H4E A;  1OQM B;  3U0X A;  5I1F A;  4DE7 A;  2BO8 A;  1Z90 A;  2CU2 A;  2RJ6 A;  1TVY A;  2YQS A;  4KC2 A;  4IRP A;  4CJB A;  1H5S D;  4Y6U A;  4J18 A;  2YC3 A;  1H3M A;  2FYC B;  2FFV A;  4D11 C;  4EEM A;  1NKH B;  3SX5 A;  1MC3 A;  4Y7G A;  3ST8 A;  4KC4 A;  1WT0 A;  3U2U A;  1XHB A;  1H4D A;  3OH1 A;  4FRO A;  3BRK X;  3EE5 A;  3OKR A;  5IFY A;  3Q4S A;  1S4O A;  1QGS A;  2RIX A;  3K8D A;  1GQ9 A;  5C1G A;  1PZY B;  4M4K A;  2I5E A;  4ARW A;  2APC A;  3CU0 A;  2I7B A;  2Z87 A;  2W0V A;  3I0C A;  2WVM A;  4MND A;  2YQC A;  1ZIZ A;  4FRA A;  4FRB A;  2XME A;  2X60 A;  1W57 A;  1PZT A;  4G3Q A;  2RIT A;  2XWN A;  4HO0 A;  2J0A A;  5DDT A;  3U2W A;  4B4B A;  4Y63 A;  1MP3 A;  2AES A;  4B4G A;  1GX0 A;  1GX4 A;  4AYJ A;  2AM3 A;  4NAL A;  1ZCU A;  3FOQ A;  4O6N A;  4Y7T A;  2VFZ A;  5DDV A;  4FRL A;  3U2V A;  1O0R A;  2V0I A;  2V0L A;  1GA8 A;  5J49 A;  5C4C A;  1HV9 A;  2X5Z A;  3SXC A;  1WVC A;  1G97 A;  3SXD A;  3TQD A;  2AE7 A;  1EYR A;  4P02 A;  1TW1 A;  4NAK A;  4ASJ A;  3I0F A;  4ZDQ A;  3JUJ A;  1G1L A;  1FR9 A;  1XZ6 A;  1ZJ3 A;  5EJZ A;  4M2B A;  3ZGF A;  2VS5 A;  4HCQ A;  3SXE A;  2X65 A;  3CGX A;  4MIX A;  1H5T A;  5C1H A;  1H5S A;  2JCJ A;  5C3A A;  2C0N A;  3USQ A;  3JTJ A;  1G3L A;  1LZI A;  2VSI A;  3RMV A;  5AJN A;  5IDS A;  4AYL A;  1HM0 A;  3Q7U A;  5EIY A;  4GBP A;  4E1K A;  3Q80 A;  4FRD A;  3SX3 A;  2X5S A;  3PKP A;  1ZJP A;  4KPZ A;  1H5R B;  2ZU9 A;  2RJ4 A;  3I0G A;  4EEO A;  1FG5 N;  2VXM A;  3D98 A;  1H5T B;  4Y62 A;  3USR A;  1H5S B;  1G0R A;  1LZ0 A;  3V0N A;  1WSZ A;  1G2V A;  1G95 A;  4KNR A;  1ZJ1 A;  3HL3 A;  2FYA A;  3SX7 A;  1ZI1 A;  4DEC A;  1LVW A;  4L41 C;  4R7P A;  2Y4M A;  2MZB A;  2RJ7 A;  1JVG A;  1G23 A;  4D48 A;  4HO4 A;  4HOC A;  3I0I X;  4UEG A;  3OH3 A;  1V82 A;  1E5K A;  4HO2 A;  1ZJO A;  2V0H A;  2E8B A;  3U2X A;  5C38 A;  3SXG A;  3E25 A;  5FU0 A;  3V0P A;  4ASY A;  3FWW A;  4KRV A;  4ECM A;  4G3S A;  2J0B A;  3V8Y A;  2W0W A;  1ZCY A;  2RJ1 A;  4Y64 A;  4JD0 A;  3JUK A;  3OH2 A;  2VS4 A;  3V8Z A;  1R7V A;  1JYK A;  1V84 A;  4FQW A;  2D7I A;  4FCE A;  5CMI A;  3SX8 A;  1ZI4 A;  4G3P A;  4B2X A;  1H7H A;  2I5K A;  1O7O A;  2AH9 A;  5CQN X;  1EZI A;  2QKX A;  2Y4K A;  4M28 A;  2Z86 A;  2QGI A;  5FV9 A;  3ZLL A;  4FIY A;  4XWI A;  1GWV A;  2A8U A;  4HO9 A;  1R80 A;  1YP2 A;  3V91 A;  5CQO A;  3U2T A;  3CKN A;  1IIN A;  2A8W A;  1WT2 A;  2FYB A;  4B42 A;  2RJ5 A;  2FYD B;  1H7L A;  2YCM A;  1NF5 B;  5D91 A;  4CJC A;  5C3B A;  1HJL A;  1VZX A;  3SXB A;  3N9W A;  2PGV A;  4LW6 A;  4D11 A;  1INJ A;  4Y9X A;  2PX7 A;  5IDT A;  2P72 A;  3I0L A;  2WEE A;  3NGW A;  1ON8 A;  3OH4 A;  4KC1 A;  5CQM X;  1ZHJ A;  2BO7 A;  2Y4L A;  4M2A A;  3V0O A;  2BO4 A;  5C36 A;  3R2W A;  5C3D A;  3BCV A;  3POL A;  3SPT A;  1QGQ A;  2PA4 A;  2PGY A;  3I0D A;  3O3P A;  2QH5 A;  1VH1 A;  5C4F A;  4HO8 A;  3V0L A;  1JVD A;  2GGO A;  5C48 A;  2VD4 A;  1QG8 A;  3OH0 A;  4BMA A;  3IOH A;  3K8E A;  1VGZ A;  4CVH A;  1ZJ0 A;  1FXO A;  1HJJ A;  5C49 A;  1S4N A;  2YES A;  1W55 A;  5JQQ A;  3ZF8 A;  2E3D A;  4HO3 A;  2O1G A;  2ICY A;  1KWS A;  2AM4 A;  3D5N A;  3LW6 A;  4B2W A;  5CMJ A;  4FRE A;  5FU8 A;  1NMM B;  4KT7 A;  3F1Y A;  1FRW A;  2RJ9 A;  2XWL A;  3IOI A;  3E26 A;  2AGD A;  4KQL A;  5C8R A;  2WGZ A;  3PNN A;  1R7U A;  1JYL A;  4FRM A;  1NQI B;  4BQH A;  2YQJ A;  2VS3 A;  2GGQ A;  4FIX A;  1FO8 A;  1VH3 A;  1FO9 A;  3I0E A;  4AAW A;  1VZT A;  1R7X A;  1ZCT A;  4D0T A;  1H7T A;  1G93 A;  1H7E A;  3CKJ A;  1I52 A;  4IRQ A;  1R82 A;  2RIZ A;  1HM9 A;  5C4D A;  1LL2 A;  2Y4J A;  1MP4 A;  1SS9 A;  1FR8 A;  1ZI5 A;  5CMH A;  4HG6 A;  1S4P A;  3R3I A;  4FRP A;  5D92 A;  5L6S A;  4AC3 A;  1QWJ A;  5C1L A;  2BO6 A;  1IIM A;  1NWG B;  2Y6P A;  4HO5 A;  1INI A;  2RJ8 A;  1ZI3 A;  4FCU A;  5AJP A;  5CMG X;  2WAW A;  4G87 A;  2V0J A;  1JV3 A;  3I0K A;  1LL0 A;  2P73 A;  3RSB A;  2YQH A;  2VK9 A;  2DPW A;  4LW3 A;  2JCK A;  3CKQ A;  1FWY A;  1JV1 A;  2JCL A;  1R7Y A;  4EVW A;  1H4C A;  3OC9 A;  3V0Q A;  5BXC A;  3KIA A;  1WT1 A;  3U0Y A;  2Q4J A;  3CKV A;  1V83 A;  2D7R A;  1R7T A;  3TZT A;  1VPA A;  1VGW A;  4K6R A;  4D0Z A;  1OMZ A;  1FZW A;  3T7M A;  1R81 A;  2VSH A;  4DDZ A;  1LL3 A;  5EJ1 A;  4FRH A;  5C4B A;  2ZU7 A;  1ZDF A;  4CJ8 A;  5FTV A;  1FGG A;  2YC5 A;  2UX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...