4LW3A

Crystal structure of the drosophila beta1,4galactosyltransferase7 catalytic domain d211n single mutant enzyme complex with manganese and udp-galactose
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
242
Chain Sequence
DGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLENDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-4-galactosyltransferase 7
publication title Crystal Structures of beta-1,4-Galactosyltransferase 7 Enzyme Reveal Conformational Changes and Substrate Binding.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 68
structure length 242
sequence length 242
ec nomenclature ec 2.4.1.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4lw3A00
1V82A 5C3DA 2Z87A 2WGZA 1KWSA 3D5NA 3RSBA 4M28A 3V0PA 2BO7A 4KXOA 1FWYA 4YS8A 5EJZA 4B42A 2AH9A 3SX3A 4HO5A 3I0HA 3E26A 5C1LA 1EYRA 2UX8A 3I0LA 2BO8A 1LL3A 2P6WA 4AAWA 4DECA 2QKXA 5FTVA 3U2TA 5BXCA 2X60A 3USQA 3CU0A 1JYLA 1NWGB 2WVLA 3ZGGA 2OI6A 4NANA 3PKQA 3T7NA 1JVDA 4LW3A 1H5RA 1V83A 5C4DA 1VGUA 1GX4A 3DJ4A 2RJ1A 3R2WA 5C4CA 4KC2A 1G97A 1NMMB 5EJ1A 3ZF8A 1GA8A 3EE5A 4Y7GA 1WVCA 1ZJOA 4IRQA 2YC5A 2YQSA 1FZWA 1ON6A 3SXGA 2OEGA 1EZIA 4B5BA 5FUHA 2PGVA 1VM8A 1SS9A 3ZGFA 4CJ8A 5CQOA 3I0FA 1H7FA 2GGQA 5FU0A 1ZJPA 1W57A 1YP4A 4EE4A 4FROA 1MC3A 4D0ZA 4EEMA 4ARWA 1G93A 3V0LA 4FRHA 5IFYA 2A8UA 2RJ4A 2APCA 1G9RA 1Z90A 1FGXA 1H5TA 1ZI1A 1FG5N 1MP5A 2X5SA 2PGYA 1VGTA 4FRMA 3CKNA 3JUKA 4Y7FA 1VH1A 1G95A 2D7IA 4HO2A 3TQDA 4LW6A 3SXCA 3U2VA 5CQLX 4EEOA 1V84A 2YESA 1E5KA 2Y6PA 5CMJA 1H4DA 3KIAA 2I5KA 2AM5A 2RJ7A 1LVWA 3CKVA 1W55A 1ZI3A 1NF5B 1PZYB 3U0YA 1O7OA 5C48A 1QGSA 3T7OA 2Z86A 3OH2A 2A8WA 2YQJA 2FFUA 2ICYA 2VSHA 4M2AA 3I0DA 1ZDGA 3IOIA 3HL3A 3OH1A 4D11A 3DK5A 3V0NA 2FYDB 4Y63A 1ZJ2A 4B2WA 3V90A 2FFVA 5C3AA 2QH5A 1OMZA 2FYBA 4MYBA 3I0IX 3D8VA 2O1FA 4Y7VA 1VGWA 1TVYA 1OQMB 1H5SB 1S4PA 3BRKX 5AJPA 4FRBA 3Q80A 5CQNX 5CQPA 1HM0A 5EIYA 1LZ7A 1K4VA 1LL2A 1MP4A 4Y7TA 3NGWA 4FRAA 4G87A 4EE3A 4ZDQA 2O1HA 4Y6NA 3V8ZA 1FO9A 5CQMX 2PX7A 3OH3A 2ICXA 4KNXA 4Y62A 2AM4A 3JUJA 1JVGA 5C8RA 2XMHA 1VICA 1FR8A 4Y6UA 4KPZA 3OH0A 4BQHA 2YC3A 1O23B 3V0OA 1H7EA 4J18A 1FXJA 5C36A 3SX8A 5C4FA 5DDTA 3BCVA 4FRDA 1HM8A 1ZCVA 1ZJ3A 2ZU9A 5CMGX 1FR9A 2RJ6A 1WSZA 2RITA 4HCQA 1XHBA 2AGDA 2FY7A 2VFZA 1S4NA 1LZJA 4HO9A 4FREA 2VS4A 4KC4A 5J49A 5L6SA 2AESA 1VPAA 5HS2A 3Q7UA 4KT7A 2D7RA 3JTJA 1OMXA 4CJCA 2Q4JA 5I1FA 1NKHB 1WT0A 3V0QA 1GQCA 5JQQA 1W77A 2OI5A 4CVHA 1G3LA 2OEFA 2PA4A 2VXLA 4C2SA 1G2VA 4M4KA 3ZLLA 1INIA 4P00A 4KRVA 1O0RA 4G3PA 2P73A 4FRLA 4Y64A 5AJNA 4E1KA 5C4EA 1GQ9A 4KQLA 2Y7AA 5C1HA 1G0RA 3PNNA 5C3BA 1JYKA 2YQCA 3FWWA 2XWMA 1HM9A 3N9WA 3E25A 4FRQA 4G3QA 2WVMA 2V0HA 2AM3A 2P72A 4EE5A 2JCJA 2W0VA 1WT3A 2O1GA 1S4OA 2OI7A 1G1LA 4FCUA 5CMIA 3USRA 2D0JA 1R7XA 1FGGA 1PZTA 5DDVA 3LW6A 1H3MA 3DUVA 5C38A 5AJOA 2WVKA 3SXAA 4B4GA 1ZCUA 1VZUA 3I0CA 3I0GA 4HO3A 4AYLA 3GUEA 5C47A 1QWJA 2ZU8A 4GBPA 1G8OA 1TZFA 3SXBA 1HJLA 3QVBA 3V8YA 1WT2A 1H7HA 3OAMA 3V91A 1INJA 3O3PA 1R7UA 3PKPA 3F1CA 3U2XA 2Y4JA 2FYAA 3K8DA 4DE7A 4KNRA 2MZBA 3OC9A 4KPXA 1ZI5A 2V0KA 1ZCYA 2VS3A 1R81A 2Y4LA 1LL0A 2Y4KA 1ZJ1A 4EEGA 5C1GA 4ASJA 3F1YA 1FRWA 1R7TA 2JCLA 2YQHA 3IOJA 2ZU7A 1O7QA 3TZTA 2V0JA 3ST8A 1VH3A 2YCMA 4D11C 2VS5A 2WE9A 2AE7A 1LZ0A 2BO6A 2GGOA 2NXVA 3SPTA 2X65A 3I0KA 4JISA 4FCEA 3U2UA 3U2WA 1VZTA 3T7MA 4HO0A 4D0TA 1R80A 4Y7UA 1GWVA 1H5SD 1H7QA 4L41C 2RJ8A 3K8EA 1ZJ0A 1QG8A 1ZDFA 3I0JA 2I7BA 1R82A 4EEAA 2RJ9A 4NAKA 4AC3A 3FOQA 4B3UA 1ZCTA 2RJ5A 4D48A 3OGZA 1ZHJA 2VXMA 3SXDA 3IOHA 5FV9A 1R7VA 5C4BA 4EVWA 1YROB 1JV1A 2DPWA 3CKQA 5FU8A 4K6RA 4R7PA 1ZIZA 3CKJA 1QGQA 2RJ0A 3SXEA 3CKOA 5C49A 1TW1A 4HO6A 3OKRA 2XMEA 2JCKA 5CMHA 1JV3A 1R7YA 2I5EA 5FYEA 1YP2A 1HJJA 1HV9A 2VD4A 2RIYA 3R3IA 1IINA 4HO8A 1FOAA 2W0WA 3SX7A 1H5SA 4XWIA 2E8BA 4M2BA 4B4BA 2CU2A 4B2XA 1ZI4A 1GWWA 2E3DA 1MP3A 4DDZA 5IDSA 1FO8A 4HOCA 1VZXA 2RIZA 4B4MA 2V0LA 4BMAA 1H5RB 5FTSA 4CJBA 2JCOA 1NHEB 3CGXA 1LZIA 2WEEA 3RMVA 4IRPA 4Y9XA 1NQIB 4G3SA 3V0MA 4UEGA 3ZLKA 4ASYA 2VSIA 5CMFX 2X5ZA 1GX0A 3U0XA 1G23A 1I52A 4KC1A 3D98A 3RMWA 1YP3A 2V0IA 4ECMA 2QGIA 4MNDA 4P02A 4NALA 1IIMA 2RIXA 3I0EA 1H7GA 5IDTA 1H7TA 4JD0A 5L6VA 2WAWA 1H5SC 4NAIA 2XWLA 2FYCB 4HO4A 2BO4A 1H4EA 1WT1A 1VGZA 1FXOA 1XZ6A 1ON8A 3POLA 2XWNA 3SX5A 1TW5A 2Y4MA 4AYJA 4FRPA 1H4CA 4HG6A 3OH4A 3Q4SA 1H7LA 4FQWA 1H5TB 2AECA
chains in the Genus database with same CATH superfamily
1V82A 5C3DA 2Z87A 2WGZA 1KWSA 3D5NA 3RSBA 4M28A 3V0PA 2BO7A 4KXOA 1FWYA 4YS8A 5EJZA 4B42A 2AH9A 2C0NA 3SX3A 4HO5A 3I0HA 3E26A 5C1LA 1EYRA 2UX8A 3I0LA 2BO8A 1LL3A 2P6WA 4AAWA 4DECA 2QKXA 5FTVA 3U2TA 5BXCA 2X60A 3USQA 3CU0A 1JYLA 1NWGB 2WVLA 3ZGGA 2OI6A 4NANA 3PKQA 3T7NA 1JVDA 4LW3A 1H5RA 1V83A 5C4DA 1VGUA 1GX4A 3DJ4A 2RJ1A 3R2WA 5C4CA 4KC2A 1G97A 1NMMB 5EJ1A 3ZF8A 1GA8A 3EE5A 4Y7GA 1WVCA 2VK9A 1ZJOA 4IRQA 2YC5A 2YQSA 1FZWA 1ON6A 3SXGA 2OEGA 1EZIA 4B5BA 5FUHA 2PGVA 1VM8A 1SS9A 3ZGFA 4CJ8A 5CQOA 3I0FA 1H7FA 2GGQA 5FU0A 1ZJPA 1W57A 1YP4A 4EE4A 4FROA 4Q7CA 1MC3A 4D0ZA 4EEMA 4ARWA 1G93A 3V0LA 4FRHA 5IFYA 2A8UA 2RJ4A 2APCA 1G9RA 1Z90A 2J0AA 1FGXA 1H5TA 1ZI1A 1FG5N 1MP5A 2X5SA 2PGYA 1VGTA 4FRMA 3CKNA 3JUKA 4Y7FA 1VH1A 1G95A 2D7IA 4HO2A 3TQDA 4LW6A 3SXCA 3U2VA 5CQLX 4EEOA 1V84A 2YESA 1E5KA 2Y6PA 5CMJA 1H4DA 3KIAA 2I5KA 2AM5A 2RJ7A 1LVWA 3CKVA 1W55A 1ZI3A 1NF5B 1PZYB 3U0YA 1O7OA 5C48A 1QGSA 3T7OA 2Z86A 3OH2A 2A8WA 2YQJA 2FFUA 2ICYA 2VSHA 4M2AA 3I0DA 1ZDGA 3IOIA 3HL3A 3OH1A 4D11A 3DK5A 3V0NA 2FYDB 4Y63A 1ZJ2A 4B2WA 3V90A 2FFVA 5C3AA 2QH5A 1OMZA 2FYBA 4MYBA 3I0IX 3D8VA 2O1FA 4Y7VA 1VGWA 1TVYA 1OQMB 1H5SB 1S4PA 3BRKX 5AJPA 4FRBA 3Q80A 5CQNX 5CQPA 1HM0A 5EIYA 1LZ7A 1K4VA 1LL2A 1MP4A 4Y7TA 3NGWA 4FRAA 4G87A 4EE3A 4ZDQA 2O1HA 4Y6NA 3V8ZA 1FO9A 5CQMX 2PX7A 3OH3A 2ICXA 4KNXA 4Y62A 2AM4A 3JUJA 1JVGA 5C8RA 2XMHA 1VICA 1FR8A 4Y6UA 4KPZA 3OH0A 4BQHA 2YC3A 1O23B 3V0OA 1H7EA 4J18A 1FXJA 5C36A 3SX8A 5C4FA 5DDTA 3BCVA 4FRDA 1HM8A 1ZCVA 1ZJ3A 2ZU9A 5CMGX 1FR9A 2RJ6A 1WSZA 2RITA 4HCQA 1XHBA 2AGDA 2FY7A 2VFZA 1S4NA 1LZJA 4HO9A 4FREA 2VS4A 4KC4A 5J49A 5L6SA 2AESA 1VPAA 5HS2A 3Q7UA 4KT7A 2D7RA 3JTJA 1OMXA 4CJCA 2Q4JA 5I1FA 1NKHB 1WT0A 3V0QA 1GQCA 5JQQA 1W77A 2OI5A 4CVHA 1G3LA 2OEFA 2PA4A 2VXLA 4C2SA 1G2VA 4M4KA 3ZLLA 1INIA 4P00A 4KRVA 1O0RA 4G3PA 2P73A 4FRLA 4Y64A 5AJNA 4E1KA 5C4EA 1GQ9A 4KQLA 2Y7AA 5C1HA 1G0RA 3PNNA 5C3BA 1JYKA 2YQCA 3FWWA 2XWMA 1HM9A 3N9WA 3E25A 4FRQA 4G3QA 2WVMA 2V0HA 2AM3A 2P72A 4EE5A 2JCJA 2W0VA 1WT3A 2O1GA 1S4OA 2OI7A 1G1LA 4FCUA 5CMIA 3USRA 2D0JA 1R7XA 1FGGA 1PZTA 5DDVA 3LW6A 1H3MA 3DUVA 5C38A 5AJOA 2WVKA 3SXAA 4B4GA 1ZCUA 1VZUA 3I0CA 3I0GA 4HO3A 4AYLA 3GUEA 5C47A 1QWJA 2ZU8A 4GBPA 1G8OA 1TZFA 3SXBA 1HJLA 3QVBA 3V8YA 1WT2A 1H7HA 3OAMA 3V91A 1INJA 3O3PA 1R7UA 3PKPA 3F1CA 3U2XA 2Y4JA 2FYAA 3K8DA 4DE7A 4KNRA 2MZBA 3OC9A 4KPXA 1ZI5A 2V0KA 1ZCYA 2VS3A 1R81A 2Y4LA 1LL0A 2Y4KA 1ZJ1A 4EEGA 5C1GA 4ASJA 5D91A 3F1YA 1FRWA 1R7TA 2JCLA 2YQHA 3IOJA 2ZU7A 1O7QA 3TZTA 2V0JA 3ST8A 1VH3A 2YCMA 4D11C 2VS5A 2WE9A 2AE7A 1LZ0A 2BO6A 2GGOA 2NXVA 3SPTA 2X65A 3I0KA 4JISA 4FCEA 3U2UA 3U2WA 1VZTA 3T7MA 4HO0A 4D0TA 1R80A 4Y7UA 1GWVA 1H5SD 1H7QA 4L41C 2RJ8A 3K8EA 1ZJ0A 1QG8A 1ZDFA 3I0JA 2I7BA 1R82A 4EEAA 2RJ9A 4NAKA 4AC3A 3FOQA 4B3UA 1ZCTA 2RJ5A 4D48A 3OGZA 1ZHJA 2VXMA 3SXDA 3IOHA 5FV9A 1R7VA 5C4BA 4EVWA 1YROB 1JV1A 2DPWA 3CKQA 5FU8A 4K6RA 4R7PA 1ZIZA 3CKJA 1QGQA 2RJ0A 3SXEA 3CKOA 5C49A 1TW1A 4HO6A 3OKRA 2XMEA 2JCKA 5CMHA 1JV3A 1R7YA 2J0BA 2I5EA 5FYEA 1YP2A 1HJJA 1HV9A 5D92A 2VD4A 2RIYA 3R3IA 4O6NA 1IINA 4HO8A 1FOAA 2W0WA 3SX7A 1H5SA 4XWIA 2E8BA 4M2BA 4B4BA 2CU2A 4B2XA 1ZI4A 1GWWA 2E3DA 1MP3A 4MIXA 4DDZA 5IDSA 1FO8A 4HOCA 1VZXA 2RIZA 4B4MA 2V0LA 4BMAA 1H5RB 5FTSA 4CJBA 2JCOA 1NHEB 3CGXA 1LZIA 2WEEA 3RMVA 4IRPA 4Y9XA 1NQIB 4G3SA 3V0MA 4UEGA 3ZLKA 4ASYA 2VSIA 5CMFX 2X5ZA 4O6MA 1GX0A 3U0XA 1G23A 1I52A 4KC1A 4FIXA 3D98A 3RMWA 1YP3A 2V0IA 4ECMA 2QGIA 4MNDA 4P02A 4NALA 1IIMA 2RIXA 3I0EA 1H7GA 5IDTA 1H7TA 4JD0A 5L6VA 2WAWA 1H5SC 4NAIA 2XWLA 2FYCB 4HO4A 2BO4A 1H4EA 1WT1A 1VGZA 1FXOA 1XZ6A 1ON8A 3POLA 2XWNA 3SX5A 1TW5A 2Y4MA 4AYJA 4FRPA 1H4CA 4HG6A 3OH4A 4FIYA 3Q4SA 1H7LA 4FQWA 1H5TB 2AECA
chains in the Genus database with same CATH topology
1V82A 5C3DA 2Z87A 2WGZA 1KWSA 3D5NA 3RSBA 4M28A 3V0PA 2BO7A 4KXOA 1FWYA 4YS8A 5EJZA 4B42A 2AH9A 2C0NA 3SX3A 4HO5A 3I0HA 3E26A 5C1LA 1EYRA 2UX8A 3I0LA 2BO8A 1LL3A 2P6WA 4AAWA 4DECA 2QKXA 5FTVA 3U2TA 5BXCA 2X60A 3USQA 3CU0A 1JYLA 1NWGB 2WVLA 3ZGGA 2OI6A 4NANA 3PKQA 3T7NA 1JVDA 4LW3A 1H5RA 1V83A 5C4DA 1VGUA 1GX4A 3DJ4A 2RJ1A 3R2WA 5C4CA 4KC2A 1G97A 1NMMB 5EJ1A 3ZF8A 1GA8A 3EE5A 4Y7GA 1WVCA 2VK9A 1ZJOA 4IRQA 2YC5A 2YQSA 1FZWA 1ON6A 3SXGA 2OEGA 1EZIA 4B5BA 5FUHA 2PGVA 1VM8A 1SS9A 3ZGFA 4CJ8A 5CQOA 3I0FA 1H7FA 2GGQA 5FU0A 1ZJPA 1W57A 1YP4A 4EE4A 4FROA 4Q7CA 1MC3A 4D0ZA 4EEMA 4ARWA 1G93A 3V0LA 4FRHA 5IFYA 2A8UA 2RJ4A 2APCA 1G9RA 1Z90A 2J0AA 1FGXA 1H5TA 1ZI1A 1FG5N 1MP5A 2X5SA 2PGYA 1VGTA 4FRMA 3CKNA 3JUKA 4Y7FA 1VH1A 1G95A 2D7IA 4HO2A 3TQDA 4LW6A 3SXCA 3U2VA 5CQLX 4EEOA 1V84A 2YESA 1E5KA 2Y6PA 5CMJA 1H4DA 3KIAA 2I5KA 2AM5A 2RJ7A 1LVWA 3CKVA 1W55A 1ZI3A 1NF5B 1PZYB 3U0YA 1O7OA 5C48A 1QGSA 3T7OA 2Z86A 3OH2A 2A8WA 2YQJA 2FFUA 2ICYA 2VSHA 4M2AA 3I0DA 1ZDGA 3IOIA 3HL3A 3OH1A 4D11A 3DK5A 3V0NA 2FYDB 4Y63A 1ZJ2A 4B2WA 3V90A 2FFVA 5C3AA 2QH5A 1OMZA 2FYBA 4MYBA 3I0IX 3D8VA 2O1FA 4Y7VA 1VGWA 1TVYA 1OQMB 1H5SB 1S4PA 3BRKX 5AJPA 4FRBA 3Q80A 5CQNX 5CQPA 1HM0A 5EIYA 1LZ7A 1K4VA 1LL2A 1MP4A 4Y7TA 3NGWA 4FRAA 4G87A 4EE3A 4ZDQA 2O1HA 4Y6NA 3V8ZA 1FO9A 5CQMX 2PX7A 3OH3A 2ICXA 4KNXA 4Y62A 2AM4A 3JUJA 1JVGA 5C8RA 2XMHA 1VICA 1FR8A 4Y6UA 4KPZA 3OH0A 4BQHA 2YC3A 1O23B 3V0OA 1H7EA 4J18A 1FXJA 5C36A 3SX8A 5C4FA 5DDTA 3BCVA 4FRDA 1HM8A 1ZCVA 1ZJ3A 2ZU9A 5CMGX 1FR9A 2RJ6A 1WSZA 2RITA 4HCQA 1XHBA 2AGDA 2FY7A 2VFZA 1S4NA 1LZJA 4HO9A 4FREA 2VS4A 4KC4A 5J49A 5L6SA 2AESA 1VPAA 5HS2A 3Q7UA 4KT7A 2D7RA 3JTJA 1OMXA 4CJCA 2Q4JA 5I1FA 1NKHB 1WT0A 3V0QA 1GQCA 5JQQA 1W77A 2OI5A 4CVHA 1G3LA 2OEFA 2PA4A 2VXLA 4C2SA 1G2VA 4M4KA 3ZLLA 1INIA 4P00A 4KRVA 1O0RA 4G3PA 2P73A 4FRLA 4Y64A 5AJNA 4E1KA 5C4EA 1GQ9A 4KQLA 2Y7AA 5C1HA 1G0RA 3PNNA 5C3BA 1JYKA 2YQCA 3FWWA 2XWMA 1HM9A 3N9WA 3E25A 4FRQA 4G3QA 2WVMA 2V0HA 2AM3A 2P72A 4EE5A 2JCJA 2W0VA 1WT3A 2O1GA 1S4OA 2OI7A 1G1LA 4FCUA 5CMIA 3USRA 2D0JA 1R7XA 1FGGA 1PZTA 5DDVA 3LW6A 1H3MA 3DUVA 5C38A 5AJOA 2WVKA 3SXAA 4B4GA 1ZCUA 1VZUA 3I0CA 3I0GA 4HO3A 4AYLA 3GUEA 5C47A 1QWJA 2ZU8A 4GBPA 1G8OA 1TZFA 3SXBA 1HJLA 3QVBA 3V8YA 1WT2A 1H7HA 3OAMA 3V91A 1INJA 3O3PA 1R7UA 3PKPA 3F1CA 3U2XA 2Y4JA 2FYAA 3K8DA 4DE7A 4KNRA 2MZBA 3OC9A 4KPXA 1ZI5A 2V0KA 1ZCYA 2VS3A 1R81A 2Y4LA 1LL0A 2Y4KA 1ZJ1A 4EEGA 5C1GA 4ASJA 5D91A 3F1YA 1FRWA 1R7TA 2JCLA 2YQHA 3IOJA 2ZU7A 1O7QA 3TZTA 2V0JA 3ST8A 1VH3A 2YCMA 4D11C 2VS5A 2WE9A 2AE7A 1LZ0A 2BO6A 2GGOA 2NXVA 3SPTA 2X65A 3I0KA 4JISA 4FCEA 3U2UA 3U2WA 1VZTA 3T7MA 4HO0A 4D0TA 1R80A 4Y7UA 1GWVA 1H5SD 1H7QA 4L41C 2RJ8A 3K8EA 1ZJ0A 1QG8A 1ZDFA 3I0JA 2I7BA 1R82A 4EEAA 2RJ9A 4NAKA 4AC3A 3FOQA 4B3UA 1ZCTA 2RJ5A 4D48A 3OGZA 1ZHJA 2VXMA 3SXDA 3IOHA 5FV9A 1R7VA 5C4BA 4EVWA 1YROB 1JV1A 2DPWA 3CKQA 5FU8A 4K6RA 4R7PA 1ZIZA 3CKJA 1QGQA 2RJ0A 3SXEA 3CKOA 5C49A 1TW1A 4HO6A 3OKRA 2XMEA 2JCKA 5CMHA 1JV3A 1R7YA 2J0BA 2I5EA 5FYEA 1YP2A 1HJJA 1HV9A 5D92A 2VD4A 2RIYA 3R3IA 4O6NA 1IINA 4HO8A 1FOAA 2W0WA 3SX7A 1H5SA 4XWIA 2E8BA 4M2BA 4B4BA 2CU2A 4B2XA 1ZI4A 1GWWA 2E3DA 1MP3A 4MIXA 4DDZA 5IDSA 1FO8A 4HOCA 1VZXA 2RIZA 4B4MA 2V0LA 4BMAA 1H5RB 5FTSA 4CJBA 2JCOA 1NHEB 3CGXA 1LZIA 2WEEA 3RMVA 4IRPA 4Y9XA 1NQIB 4G3SA 3V0MA 4UEGA 3ZLKA 4ASYA 2VSIA 5CMFX 2X5ZA 4O6MA 1GX0A 3U0XA 1G23A 1I52A 4KC1A 4FIXA 3D98A 3RMWA 1YP3A 2V0IA 4ECMA 2QGIA 4MNDA 4P02A 4NALA 1IIMA 2RIXA 3I0EA 1H7GA 5IDTA 1H7TA 4JD0A 5L6VA 2WAWA 1H5SC 4NAIA 2XWLA 2FYCB 4HO4A 2BO4A 1H4EA 1WT1A 1VGZA 1FXOA 1XZ6A 1ON8A 3POLA 2XWNA 3SX5A 1TW5A 2Y4MA 4AYJA 4FRPA 1H4CA 4HG6A 3OH4A 4FIYA 3Q4SA 1H7LA 4FQWA 1H5TB 2AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V82 A;  5C3D A;  2Z87 A;  2WGZ A;  1KWS A;  3D5N A;  3RSB A;  4M28 A;  3V0P A;  2BO7 A;  4KXO A;  1FWY A;  4YS8 A;  5EJZ A;  4B42 A;  2AH9 A;  3SX3 A;  4HO5 A;  3I0H A;  3E26 A;  5C1L A;  1EYR A;  2UX8 A;  3I0L A;  2BO8 A;  1LL3 A;  2P6W A;  4AAW A;  4DEC A;  2QKX A;  5FTV A;  3U2T A;  5BXC A;  2X60 A;  3USQ A;  3CU0 A;  1JYL A;  1NWG B;  2WVL A;  3ZGG A;  2OI6 A;  4NAN A;  3PKQ A;  3T7N A;  1JVD A;  4LW3 A;  1H5R A;  1V83 A;  5C4D A;  1VGU A;  1GX4 A;  3DJ4 A;  2RJ1 A;  3R2W A;  5C4C A;  4KC2 A;  1G97 A;  1NMM B;  5EJ1 A;  3ZF8 A;  1GA8 A;  3EE5 A;  4Y7G A;  1WVC A;  1ZJO A;  4IRQ A;  2YC5 A;  2YQS A;  1FZW A;  1ON6 A;  3SXG A;  2OEG A;  1EZI A;  4B5B A;  5FUH A;  2PGV A;  1VM8 A;  1SS9 A;  3ZGF A;  4CJ8 A;  5CQO A;  3I0F A;  1H7F A;  2GGQ A;  5FU0 A;  1ZJP A;  1W57 A;  1YP4 A;  4EE4 A;  4FRO A;  1MC3 A;  4D0Z A;  4EEM A;  4ARW A;  1G93 A;  3V0L A;  4FRH A;  5IFY A;  2A8U A;  2RJ4 A;  2APC A;  1G9R A;  1Z90 A;  1FGX A;  1H5T A;  1ZI1 A;  1FG5 N;  1MP5 A;  2X5S A;  2PGY A;  1VGT A;  4FRM A;  3CKN A;  3JUK A;  4Y7F A;  1VH1 A;  1G95 A;  2D7I A;  4HO2 A;  3TQD A;  4LW6 A;  3SXC A;  3U2V A;  5CQL X;  4EEO A;  1V84 A;  2YES A;  1E5K A;  2Y6P A;  5CMJ A;  1H4D A;  3KIA A;  2I5K A;  2AM5 A;  2RJ7 A;  1LVW A;  3CKV A;  1W55 A;  1ZI3 A;  1NF5 B;  1PZY B;  3U0Y A;  1O7O A;  5C48 A;  1QGS A;  3T7O A;  2Z86 A;  3OH2 A;  2A8W A;  2YQJ A;  2FFU A;  2ICY A;  2VSH A;  4M2A A;  3I0D A;  1ZDG A;  3IOI A;  3HL3 A;  3OH1 A;  4D11 A;  3DK5 A;  3V0N A;  2FYD B;  4Y63 A;  1ZJ2 A;  4B2W A;  3V90 A;  2FFV A;  5C3A A;  2QH5 A;  1OMZ A;  2FYB A;  4MYB A;  3I0I X;  3D8V A;  2O1F A;  4Y7V A;  1VGW A;  1TVY A;  1OQM B;  1H5S B;  1S4P A;  3BRK X;  5AJP A;  4FRB A;  3Q80 A;  5CQN X;  5CQP A;  1HM0 A;  5EIY A;  1LZ7 A;  1K4V A;  1LL2 A;  1MP4 A;  4Y7T A;  3NGW A;  4FRA A;  4G87 A;  4EE3 A;  4ZDQ A;  2O1H A;  4Y6N A;  3V8Z A;  1FO9 A;  5CQM X;  2PX7 A;  3OH3 A;  2ICX A;  4KNX A;  4Y62 A;  2AM4 A;  3JUJ A;  1JVG A;  5C8R A;  2XMH A;  1VIC A;  1FR8 A;  4Y6U A;  4KPZ A;  3OH0 A;  4BQH A;  2YC3 A;  1O23 B;  3V0O A;  1H7E A;  4J18 A;  1FXJ A;  5C36 A;  3SX8 A;  5C4F A;  5DDT A;  3BCV A;  4FRD A;  1HM8 A;  1ZCV A;  1ZJ3 A;  2ZU9 A;  5CMG X;  1FR9 A;  2RJ6 A;  1WSZ A;  2RIT A;  4HCQ A;  1XHB A;  2AGD A;  2FY7 A;  2VFZ A;  1S4N A;  1LZJ A;  4HO9 A;  4FRE A;  2VS4 A;  4KC4 A;  5J49 A;  5L6S A;  2AES A;  1VPA A;  5HS2 A;  3Q7U A;  4KT7 A;  2D7R A;  3JTJ A;  1OMX A;  4CJC A;  2Q4J A;  5I1F A;  1NKH B;  1WT0 A;  3V0Q A;  1GQC A;  5JQQ A;  1W77 A;  2OI5 A;  4CVH A;  1G3L A;  2OEF A;  2PA4 A;  2VXL A;  4C2S A;  1G2V A;  4M4K A;  3ZLL A;  1INI A;  4P00 A;  4KRV A;  1O0R A;  4G3P A;  2P73 A;  4FRL A;  4Y64 A;  5AJN A;  4E1K A;  5C4E A;  1GQ9 A;  4KQL A;  2Y7A A;  5C1H A;  1G0R A;  3PNN A;  5C3B A;  1JYK A;  2YQC A;  3FWW A;  2XWM A;  1HM9 A;  3N9W A;  3E25 A;  4FRQ A;  4G3Q A;  2WVM A;  2V0H A;  2AM3 A;  2P72 A;  4EE5 A;  2JCJ A;  2W0V A;  1WT3 A;  2O1G A;  1S4O A;  2OI7 A;  1G1L A;  4FCU A;  5CMI A;  3USR A;  2D0J A;  1R7X A;  1FGG A;  1PZT A;  5DDV A;  3LW6 A;  1H3M A;  3DUV A;  5C38 A;  5AJO A;  2WVK A;  3SXA A;  4B4G A;  1ZCU A;  1VZU A;  3I0C A;  3I0G A;  4HO3 A;  4AYL A;  3GUE A;  5C47 A;  1QWJ A;  2ZU8 A;  4GBP A;  1G8O A;  1TZF A;  3SXB A;  1HJL A;  3QVB A;  3V8Y A;  1WT2 A;  1H7H A;  3OAM A;  3V91 A;  1INJ A;  3O3P A;  1R7U A;  3PKP A;  3F1C A;  3U2X A;  2Y4J A;  2FYA A;  3K8D A;  4DE7 A;  4KNR A;  2MZB A;  3OC9 A;  4KPX A;  1ZI5 A;  2V0K A;  1ZCY A;  2VS3 A;  1R81 A;  2Y4L A;  1LL0 A;  2Y4K A;  1ZJ1 A;  4EEG A;  5C1G A;  4ASJ A;  3F1Y A;  1FRW A;  1R7T A;  2JCL A;  2YQH A;  3IOJ A;  2ZU7 A;  1O7Q A;  3TZT A;  2V0J A;  3ST8 A;  1VH3 A;  2YCM A;  4D11 C;  2VS5 A;  2WE9 A;  2AE7 A;  1LZ0 A;  2BO6 A;  2GGO A;  2NXV A;  3SPT A;  2X65 A;  3I0K A;  4JIS A;  4FCE A;  3U2U A;  3U2W A;  1VZT A;  3T7M A;  4HO0 A;  4D0T A;  1R80 A;  4Y7U A;  1GWV A;  1H5S D;  1H7Q A;  4L41 C;  2RJ8 A;  3K8E A;  1ZJ0 A;  1QG8 A;  1ZDF A;  3I0J A;  2I7B A;  1R82 A;  4EEA A;  2RJ9 A;  4NAK A;  4AC3 A;  3FOQ A;  4B3U A;  1ZCT A;  2RJ5 A;  4D48 A;  3OGZ A;  1ZHJ A;  2VXM A;  3SXD A;  3IOH A;  5FV9 A;  1R7V A;  5C4B A;  4EVW A;  1YRO B;  1JV1 A;  2DPW A;  3CKQ A;  5FU8 A;  4K6R A;  4R7P A;  1ZIZ A;  3CKJ A;  1QGQ A;  2RJ0 A;  3SXE A;  3CKO A;  5C49 A;  1TW1 A;  4HO6 A;  3OKR A;  2XME A;  2JCK A;  5CMH A;  1JV3 A;  1R7Y A;  2I5E A;  5FYE A;  1YP2 A;  1HJJ A;  1HV9 A;  2VD4 A;  2RIY A;  3R3I A;  1IIN A;  4HO8 A;  1FOA A;  2W0W A;  3SX7 A;  1H5S A;  4XWI A;  2E8B A;  4M2B A;  4B4B A;  2CU2 A;  4B2X A;  1ZI4 A;  1GWW A;  2E3D A;  1MP3 A;  4DDZ A;  5IDS A;  1FO8 A;  4HOC A;  1VZX A;  2RIZ A;  4B4M A;  2V0L A;  4BMA A;  1H5R B;  5FTS A;  4CJB A;  2JCO A;  1NHE B;  3CGX A;  1LZI A;  2WEE A;  3RMV A;  4IRP A;  4Y9X A;  1NQI B;  4G3S A;  3V0M A;  4UEG A;  3ZLK A;  4ASY A;  2VSI A;  5CMF X;  2X5Z A;  1GX0 A;  3U0X A;  1G23 A;  1I52 A;  4KC1 A;  3D98 A;  3RMW A;  1YP3 A;  2V0I A;  4ECM A;  2QGI A;  4MND A;  4P02 A;  4NAL A;  1IIM A;  2RIX A;  3I0E A;  1H7G A;  5IDT A;  1H7T A;  4JD0 A;  5L6V A;  2WAW A;  1H5S C;  4NAI A;  2XWL A;  2FYC B;  4HO4 A;  2BO4 A;  1H4E A;  1WT1 A;  1VGZ A;  1FXO A;  1XZ6 A;  1ON8 A;  3POL A;  2XWN A;  3SX5 A;  1TW5 A;  2Y4M A;  4AYJ A;  4FRP A;  1H4C A;  4HG6 A;  3OH4 A;  3Q4S A;  1H7L A;  4FQW A;  1H5T B;  2AEC A; 
#chains in the Genus database with same CATH topology
 1V82 A;  5C3D A;  2Z87 A;  2WGZ A;  1KWS A;  3D5N A;  3RSB A;  4M28 A;  3V0P A;  2BO7 A;  4KXO A;  1FWY A;  4YS8 A;  5EJZ A;  4B42 A;  2AH9 A;  2C0N A;  3SX3 A;  4HO5 A;  3I0H A;  3E26 A;  5C1L A;  1EYR A;  2UX8 A;  3I0L A;  2BO8 A;  1LL3 A;  2P6W A;  4AAW A;  4DEC A;  2QKX A;  5FTV A;  3U2T A;  5BXC A;  2X60 A;  3USQ A;  3CU0 A;  1JYL A;  1NWG B;  2WVL A;  3ZGG A;  2OI6 A;  4NAN A;  3PKQ A;  3T7N A;  1JVD A;  4LW3 A;  1H5R A;  1V83 A;  5C4D A;  1VGU A;  1GX4 A;  3DJ4 A;  2RJ1 A;  3R2W A;  5C4C A;  4KC2 A;  1G97 A;  1NMM B;  5EJ1 A;  3ZF8 A;  1GA8 A;  3EE5 A;  4Y7G A;  1WVC A;  2VK9 A;  1ZJO A;  4IRQ A;  2YC5 A;  2YQS A;  1FZW A;  1ON6 A;  3SXG A;  2OEG A;  1EZI A;  4B5B A;  5FUH A;  2PGV A;  1VM8 A;  1SS9 A;  3ZGF A;  4CJ8 A;  5CQO A;  3I0F A;  1H7F A;  2GGQ A;  5FU0 A;  1ZJP A;  1W57 A;  1YP4 A;  4EE4 A;  4FRO A;  4Q7C A;  1MC3 A;  4D0Z A;  4EEM A;  4ARW A;  1G93 A;  3V0L A;  4FRH A;  5IFY A;  2A8U A;  2RJ4 A;  2APC A;  1G9R A;  1Z90 A;  2J0A A;  1FGX A;  1H5T A;  1ZI1 A;  1FG5 N;  1MP5 A;  2X5S A;  2PGY A;  1VGT A;  4FRM A;  3CKN A;  3JUK A;  4Y7F A;  1VH1 A;  1G95 A;  2D7I A;  4HO2 A;  3TQD A;  4LW6 A;  3SXC A;  3U2V A;  5CQL X;  4EEO A;  1V84 A;  2YES A;  1E5K A;  2Y6P A;  5CMJ A;  1H4D A;  3KIA A;  2I5K A;  2AM5 A;  2RJ7 A;  1LVW A;  3CKV A;  1W55 A;  1ZI3 A;  1NF5 B;  1PZY B;  3U0Y A;  1O7O A;  5C48 A;  1QGS A;  3T7O A;  2Z86 A;  3OH2 A;  2A8W A;  2YQJ A;  2FFU A;  2ICY A;  2VSH A;  4M2A A;  3I0D A;  1ZDG A;  3IOI A;  3HL3 A;  3OH1 A;  4D11 A;  3DK5 A;  3V0N A;  2FYD B;  4Y63 A;  1ZJ2 A;  4B2W A;  3V90 A;  2FFV A;  5C3A A;  2QH5 A;  1OMZ A;  2FYB A;  4MYB A;  3I0I X;  3D8V A;  2O1F A;  4Y7V A;  1VGW A;  1TVY A;  1OQM B;  1H5S B;  1S4P A;  3BRK X;  5AJP A;  4FRB A;  3Q80 A;  5CQN X;  5CQP A;  1HM0 A;  5EIY A;  1LZ7 A;  1K4V A;  1LL2 A;  1MP4 A;  4Y7T A;  3NGW A;  4FRA A;  4G87 A;  4EE3 A;  4ZDQ A;  2O1H A;  4Y6N A;  3V8Z A;  1FO9 A;  5CQM X;  2PX7 A;  3OH3 A;  2ICX A;  4KNX A;  4Y62 A;  2AM4 A;  3JUJ A;  1JVG A;  5C8R A;  2XMH A;  1VIC A;  1FR8 A;  4Y6U A;  4KPZ A;  3OH0 A;  4BQH A;  2YC3 A;  1O23 B;  3V0O A;  1H7E A;  4J18 A;  1FXJ A;  5C36 A;  3SX8 A;  5C4F A;  5DDT A;  3BCV A;  4FRD A;  1HM8 A;  1ZCV A;  1ZJ3 A;  2ZU9 A;  5CMG X;  1FR9 A;  2RJ6 A;  1WSZ A;  2RIT A;  4HCQ A;  1XHB A;  2AGD A;  2FY7 A;  2VFZ A;  1S4N A;  1LZJ A;  4HO9 A;  4FRE A;  2VS4 A;  4KC4 A;  5J49 A;  5L6S A;  2AES A;  1VPA A;  5HS2 A;  3Q7U A;  4KT7 A;  2D7R A;  3JTJ A;  1OMX A;  4CJC A;  2Q4J A;  5I1F A;  1NKH B;  1WT0 A;  3V0Q A;  1GQC A;  5JQQ A;  1W77 A;  2OI5 A;  4CVH A;  1G3L A;  2OEF A;  2PA4 A;  2VXL A;  4C2S A;  1G2V A;  4M4K A;  3ZLL A;  1INI A;  4P00 A;  4KRV A;  1O0R A;  4G3P A;  2P73 A;  4FRL A;  4Y64 A;  5AJN A;  4E1K A;  5C4E A;  1GQ9 A;  4KQL A;  2Y7A A;  5C1H A;  1G0R A;  3PNN A;  5C3B A;  1JYK A;  2YQC A;  3FWW A;  2XWM A;  1HM9 A;  3N9W A;  3E25 A;  4FRQ A;  4G3Q A;  2WVM A;  2V0H A;  2AM3 A;  2P72 A;  4EE5 A;  2JCJ A;  2W0V A;  1WT3 A;  2O1G A;  1S4O A;  2OI7 A;  1G1L A;  4FCU A;  5CMI A;  3USR A;  2D0J A;  1R7X A;  1FGG A;  1PZT A;  5DDV A;  3LW6 A;  1H3M A;  3DUV A;  5C38 A;  5AJO A;  2WVK A;  3SXA A;  4B4G A;  1ZCU A;  1VZU A;  3I0C A;  3I0G A;  4HO3 A;  4AYL A;  3GUE A;  5C47 A;  1QWJ A;  2ZU8 A;  4GBP A;  1G8O A;  1TZF A;  3SXB A;  1HJL A;  3QVB A;  3V8Y A;  1WT2 A;  1H7H A;  3OAM A;  3V91 A;  1INJ A;  3O3P A;  1R7U A;  3PKP A;  3F1C A;  3U2X A;  2Y4J A;  2FYA A;  3K8D A;  4DE7 A;  4KNR A;  2MZB A;  3OC9 A;  4KPX A;  1ZI5 A;  2V0K A;  1ZCY A;  2VS3 A;  1R81 A;  2Y4L A;  1LL0 A;  2Y4K A;  1ZJ1 A;  4EEG A;  5C1G A;  4ASJ A;  5D91 A;  3F1Y A;  1FRW A;  1R7T A;  2JCL A;  2YQH A;  3IOJ A;  2ZU7 A;  1O7Q A;  3TZT A;  2V0J A;  3ST8 A;  1VH3 A;  2YCM A;  4D11 C;  2VS5 A;  2WE9 A;  2AE7 A;  1LZ0 A;  2BO6 A;  2GGO A;  2NXV A;  3SPT A;  2X65 A;  3I0K A;  4JIS A;  4FCE A;  3U2U A;  3U2W A;  1VZT A;  3T7M A;  4HO0 A;  4D0T A;  1R80 A;  4Y7U A;  1GWV A;  1H5S D;  1H7Q A;  4L41 C;  2RJ8 A;  3K8E A;  1ZJ0 A;  1QG8 A;  1ZDF A;  3I0J A;  2I7B A;  1R82 A;  4EEA A;  2RJ9 A;  4NAK A;  4AC3 A;  3FOQ A;  4B3U A;  1ZCT A;  2RJ5 A;  4D48 A;  3OGZ A;  1ZHJ A;  2VXM A;  3SXD A;  3IOH A;  5FV9 A;  1R7V A;  5C4B A;  4EVW A;  1YRO B;  1JV1 A;  2DPW A;  3CKQ A;  5FU8 A;  4K6R A;  4R7P A;  1ZIZ A;  3CKJ A;  1QGQ A;  2RJ0 A;  3SXE A;  3CKO A;  5C49 A;  1TW1 A;  4HO6 A;  3OKR A;  2XME A;  2JCK A;  5CMH A;  1JV3 A;  1R7Y A;  2J0B A;  2I5E A;  5FYE A;  1YP2 A;  1HJJ A;  1HV9 A;  5D92 A;  2VD4 A;  2RIY A;  3R3I A;  4O6N A;  1IIN A;  4HO8 A;  1FOA A;  2W0W A;  3SX7 A;  1H5S A;  4XWI A;  2E8B A;  4M2B A;  4B4B A;  2CU2 A;  4B2X A;  1ZI4 A;  1GWW A;  2E3D A;  1MP3 A;  4MIX A;  4DDZ A;  5IDS A;  1FO8 A;  4HOC A;  1VZX A;  2RIZ A;  4B4M A;  2V0L A;  4BMA A;  1H5R B;  5FTS A;  4CJB A;  2JCO A;  1NHE B;  3CGX A;  1LZI A;  2WEE A;  3RMV A;  4IRP A;  4Y9X A;  1NQI B;  4G3S A;  3V0M A;  4UEG A;  3ZLK A;  4ASY A;  2VSI A;  5CMF X;  2X5Z A;  4O6M A;  1GX0 A;  3U0X A;  1G23 A;  1I52 A;  4KC1 A;  4FIX A;  3D98 A;  3RMW A;  1YP3 A;  2V0I A;  4ECM A;  2QGI A;  4MND A;  4P02 A;  4NAL A;  1IIM A;  2RIX A;  3I0E A;  1H7G A;  5IDT A;  1H7T A;  4JD0 A;  5L6V A;  2WAW A;  1H5S C;  4NAI A;  2XWL A;  2FYC B;  4HO4 A;  2BO4 A;  1H4E A;  1WT1 A;  1VGZ A;  1FXO A;  1XZ6 A;  1ON8 A;  3POL A;  2XWN A;  3SX5 A;  1TW5 A;  2Y4M A;  4AYJ A;  4FRP A;  1H4C A;  4HG6 A;  3OH4 A;  4FIY A;  3Q4S A;  1H7L A;  4FQW A;  1H5T B;  2AEC A; 
#chains in the Genus database with same CATH homology
 1V82 A;  5C3D A;  2Z87 A;  2WGZ A;  1KWS A;  3D5N A;  3RSB A;  4M28 A;  3V0P A;  2BO7 A;  4KXO A;  1FWY A;  4YS8 A;  5EJZ A;  4B42 A;  2AH9 A;  2C0N A;  3SX3 A;  4HO5 A;  3I0H A;  3E26 A;  5C1L A;  1EYR A;  2UX8 A;  3I0L A;  2BO8 A;  1LL3 A;  2P6W A;  4AAW A;  4DEC A;  2QKX A;  5FTV A;  3U2T A;  5BXC A;  2X60 A;  3USQ A;  3CU0 A;  1JYL A;  1NWG B;  2WVL A;  3ZGG A;  2OI6 A;  4NAN A;  3PKQ A;  3T7N A;  1JVD A;  4LW3 A;  1H5R A;  1V83 A;  5C4D A;  1VGU A;  1GX4 A;  3DJ4 A;  2RJ1 A;  3R2W A;  5C4C A;  4KC2 A;  1G97 A;  1NMM B;  5EJ1 A;  3ZF8 A;  1GA8 A;  3EE5 A;  4Y7G A;  1WVC A;  2VK9 A;  1ZJO A;  4IRQ A;  2YC5 A;  2YQS A;  1FZW A;  1ON6 A;  3SXG A;  2OEG A;  1EZI A;  4B5B A;  5FUH A;  2PGV A;  1VM8 A;  1SS9 A;  3ZGF A;  4CJ8 A;  5CQO A;  3I0F A;  1H7F A;  2GGQ A;  5FU0 A;  1ZJP A;  1W57 A;  1YP4 A;  4EE4 A;  4FRO A;  4Q7C A;  1MC3 A;  4D0Z A;  4EEM A;  4ARW A;  1G93 A;  3V0L A;  4FRH A;  5IFY A;  2A8U A;  2RJ4 A;  2APC A;  1G9R A;  1Z90 A;  2J0A A;  1FGX A;  1H5T A;  1ZI1 A;  1FG5 N;  1MP5 A;  2X5S A;  2PGY A;  1VGT A;  4FRM A;  3CKN A;  3JUK A;  4Y7F A;  1VH1 A;  1G95 A;  2D7I A;  4HO2 A;  3TQD A;  4LW6 A;  3SXC A;  3U2V A;  5CQL X;  4EEO A;  1V84 A;  2YES A;  1E5K A;  2Y6P A;  5CMJ A;  1H4D A;  3KIA A;  2I5K A;  2AM5 A;  2RJ7 A;  1LVW A;  3CKV A;  1W55 A;  1ZI3 A;  1NF5 B;  1PZY B;  3U0Y A;  1O7O A;  5C48 A;  1QGS A;  3T7O A;  2Z86 A;  3OH2 A;  2A8W A;  2YQJ A;  2FFU A;  2ICY A;  2VSH A;  4M2A A;  3I0D A;  1ZDG A;  3IOI A;  3HL3 A;  3OH1 A;  4D11 A;  3DK5 A;  3V0N A;  2FYD B;  4Y63 A;  1ZJ2 A;  4B2W A;  3V90 A;  2FFV A;  5C3A A;  2QH5 A;  1OMZ A;  2FYB A;  4MYB A;  3I0I X;  3D8V A;  2O1F A;  4Y7V A;  1VGW A;  1TVY A;  1OQM B;  1H5S B;  1S4P A;  3BRK X;  5AJP A;  4FRB A;  3Q80 A;  5CQN X;  5CQP A;  1HM0 A;  5EIY A;  1LZ7 A;  1K4V A;  1LL2 A;  1MP4 A;  4Y7T A;  3NGW A;  4FRA A;  4G87 A;  4EE3 A;  4ZDQ A;  2O1H A;  4Y6N A;  3V8Z A;  1FO9 A;  5CQM X;  2PX7 A;  3OH3 A;  2ICX A;  4KNX A;  4Y62 A;  2AM4 A;  3JUJ A;  1JVG A;  5C8R A;  2XMH A;  1VIC A;  1FR8 A;  4Y6U A;  4KPZ A;  3OH0 A;  4BQH A;  2YC3 A;  1O23 B;  3V0O A;  1H7E A;  4J18 A;  1FXJ A;  5C36 A;  3SX8 A;  5C4F A;  5DDT A;  3BCV A;  4FRD A;  1HM8 A;  1ZCV A;  1ZJ3 A;  2ZU9 A;  5CMG X;  1FR9 A;  2RJ6 A;  1WSZ A;  2RIT A;  4HCQ A;  1XHB A;  2AGD A;  2FY7 A;  2VFZ A;  1S4N A;  1LZJ A;  4HO9 A;  4FRE A;  2VS4 A;  4KC4 A;  5J49 A;  5L6S A;  2AES A;  1VPA A;  5HS2 A;  3Q7U A;  4KT7 A;  2D7R A;  3JTJ A;  1OMX A;  4CJC A;  2Q4J A;  5I1F A;  1NKH B;  1WT0 A;  3V0Q A;  1GQC A;  5JQQ A;  1W77 A;  2OI5 A;  4CVH A;  1G3L A;  2OEF A;  2PA4 A;  2VXL A;  4C2S A;  1G2V A;  4M4K A;  3ZLL A;  1INI A;  4P00 A;  4KRV A;  1O0R A;  4G3P A;  2P73 A;  4FRL A;  4Y64 A;  5AJN A;  4E1K A;  5C4E A;  1GQ9 A;  4KQL A;  2Y7A A;  5C1H A;  1G0R A;  3PNN A;  5C3B A;  1JYK A;  2YQC A;  3FWW A;  2XWM A;  1HM9 A;  3N9W A;  3E25 A;  4FRQ A;  4G3Q A;  2WVM A;  2V0H A;  2AM3 A;  2P72 A;  4EE5 A;  2JCJ A;  2W0V A;  1WT3 A;  2O1G A;  1S4O A;  2OI7 A;  1G1L A;  4FCU A;  5CMI A;  3USR A;  2D0J A;  1R7X A;  1FGG A;  1PZT A;  5DDV A;  3LW6 A;  1H3M A;  3DUV A;  5C38 A;  5AJO A;  2WVK A;  3SXA A;  4B4G A;  1ZCU A;  1VZU A;  3I0C A;  3I0G A;  4HO3 A;  4AYL A;  3GUE A;  5C47 A;  1QWJ A;  2ZU8 A;  4GBP A;  1G8O A;  1TZF A;  3SXB A;  1HJL A;  3QVB A;  3V8Y A;  1WT2 A;  1H7H A;  3OAM A;  3V91 A;  1INJ A;  3O3P A;  1R7U A;  3PKP A;  3F1C A;  3U2X A;  2Y4J A;  2FYA A;  3K8D A;  4DE7 A;  4KNR A;  2MZB A;  3OC9 A;  4KPX A;  1ZI5 A;  2V0K A;  1ZCY A;  2VS3 A;  1R81 A;  2Y4L A;  1LL0 A;  2Y4K A;  1ZJ1 A;  4EEG A;  5C1G A;  4ASJ A;  5D91 A;  3F1Y A;  1FRW A;  1R7T A;  2JCL A;  2YQH A;  3IOJ A;  2ZU7 A;  1O7Q A;  3TZT A;  2V0J A;  3ST8 A;  1VH3 A;  2YCM A;  4D11 C;  2VS5 A;  2WE9 A;  2AE7 A;  1LZ0 A;  2BO6 A;  2GGO A;  2NXV A;  3SPT A;  2X65 A;  3I0K A;  4JIS A;  4FCE A;  3U2U A;  3U2W A;  1VZT A;  3T7M A;  4HO0 A;  4D0T A;  1R80 A;  4Y7U A;  1GWV A;  1H5S D;  1H7Q A;  4L41 C;  2RJ8 A;  3K8E A;  1ZJ0 A;  1QG8 A;  1ZDF A;  3I0J A;  2I7B A;  1R82 A;  4EEA A;  2RJ9 A;  4NAK A;  4AC3 A;  3FOQ A;  4B3U A;  1ZCT A;  2RJ5 A;  4D48 A;  3OGZ A;  1ZHJ A;  2VXM A;  3SXD A;  3IOH A;  5FV9 A;  1R7V A;  5C4B A;  4EVW A;  1YRO B;  1JV1 A;  2DPW A;  3CKQ A;  5FU8 A;  4K6R A;  4R7P A;  1ZIZ A;  3CKJ A;  1QGQ A;  2RJ0 A;  3SXE A;  3CKO A;  5C49 A;  1TW1 A;  4HO6 A;  3OKR A;  2XME A;  2JCK A;  5CMH A;  1JV3 A;  1R7Y A;  2J0B A;  2I5E A;  5FYE A;  1YP2 A;  1HJJ A;  1HV9 A;  5D92 A;  2VD4 A;  2RIY A;  3R3I A;  4O6N A;  1IIN A;  4HO8 A;  1FOA A;  2W0W A;  3SX7 A;  1H5S A;  4XWI A;  2E8B A;  4M2B A;  4B4B A;  2CU2 A;  4B2X A;  1ZI4 A;  1GWW A;  2E3D A;  1MP3 A;  4MIX A;  4DDZ A;  5IDS A;  1FO8 A;  4HOC A;  1VZX A;  2RIZ A;  4B4M A;  2V0L A;  4BMA A;  1H5R B;  5FTS A;  4CJB A;  2JCO A;  1NHE B;  3CGX A;  1LZI A;  2WEE A;  3RMV A;  4IRP A;  4Y9X A;  1NQI B;  4G3S A;  3V0M A;  4UEG A;  3ZLK A;  4ASY A;  2VSI A;  5CMF X;  2X5Z A;  4O6M A;  1GX0 A;  3U0X A;  1G23 A;  1I52 A;  4KC1 A;  4FIX A;  3D98 A;  3RMW A;  1YP3 A;  2V0I A;  4ECM A;  2QGI A;  4MND A;  4P02 A;  4NAL A;  1IIM A;  2RIX A;  3I0E A;  1H7G A;  5IDT A;  1H7T A;  4JD0 A;  5L6V A;  2WAW A;  1H5S C;  4NAI A;  2XWL A;  2FYC B;  4HO4 A;  2BO4 A;  1H4E A;  1WT1 A;  1VGZ A;  1FXO A;  1XZ6 A;  1ON8 A;  3POL A;  2XWN A;  3SX5 A;  1TW5 A;  2Y4M A;  4AYJ A;  4FRP A;  1H4C A;  4HG6 A;  3OH4 A;  4FIY A;  3Q4S A;  1H7L A;  4FQW A;  1H5T B;  2AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...