5IDSA

Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
289
structure length
289
Chain Sequence
TQRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTPQDTPRFQQLLGDGSQWGMNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDNIYYGHDFQPLLKAADAQSSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEKPKAPKSNYAVTGLYFYDQQVVDIAKAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYAWLDTGTHDSLLDASQFIATLENRQGLKVACPEEIAWRSGWINASQLEALVQPLTKNGYGQYLMQILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title Crystal Structure of a Glucose-1-phosphate Thymidylyltransferase from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 91
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5idsA00
1FWYA 4D0ZA 2X5SA 3IOHA 1GX0A 2WVLA 3U2XA 5C1GA 4Y64A 1G3LA 1E5KA 3R3IA 1MP5A 3IOIA 1GA8A 4KC1A 2VS5A 3SX7A 3I0CA 4JD0A 2Q4JA 2WEEA 2BO4A 2W0WA 4HO2A 2BO6A 1MC3A 4B42A 5C3DA 1ZJ3A 1ZCYA 2WVMA 2JCJA 1GWVA 1G1LA 1VICA 2X60A 2O1FA 2D7RA 2Y4MA 2RJ4A 2Z87A 4D48A 2XMHA 1G2VA 1H7QA 2ZU7A 4HG6A 4ARWA 2YQHA 1TW5A 3JTJA 1ZCUA 2PGVA 4FRAA 4GBPA 1H7TA 3CKJA 2QGIA 5C38A 2YQSA 5CQPA 1FO8A 1JYKA 2WGZA 4BMAA 3GUEA 5CMFX 2AGDA 2BO8A 5IFYA 1R7UA 3V0OA 1G97A 4YS8A 4UEGA 5C4FA 3SX8A 1R7VA 2GGOA 4G87A 4B4GA 1QGQA 1VZUA 2XWMA 1ZI3A 4IRQA 3OH0A 3O3PA 1ZI5A 2AM3A 4M28A 2VFZA 4NAIA 4Y6UA 5EJ1A 4FRDA 3CKNA 2RIYA 4B5BA 1ZJ1A 2V0KA 2VSHA 1TW1A 1YP3A 5AJNA 3KIAA 4EEGA 3V8ZA 1ZCTA 1KWSA 1LVWA 1VGUA 1VH1A 2VS4A 3I0EA 4FCEA 1WT3A 1ZJOA 3U2WA 1H5SD 3FOQA 2PX7A 1I52A 4K6RA 5CQNX 4M2AA 4NAKA 1H5TA 1R81A 3V0LA 4EEOA 4EE4A 2Z86A 3SXBA 1JVDA 3I0IX 4FRPA 4B4BA 3V90A 2FFVA 2W0VA 1WVCA 3I0HA 4FRLA 3RMWA 3F1CA 2YC5A 5CMJA 2GGQA 4MNDA 1FR9A 2AM4A 4XWIA 3ZGGA 1HM9A 1TZFA 3U2VA 4L41C 4EE5A 2BO7A 2AH9A 3I0FA 4E1KA 2FY7A 1FGGA 3USQA 3POLA 2V0HA 3PNNA 4HO4A 4ASJA 1W77A 4Y9XA 1ZJPA 4Y7FA 3I0GA 4HO5A 5FU8A 1QGSA 5AJPA 3I0JA 4G3QA 3V0MA 3SX5A 1ON6A 3Q7UA 4NALA 5CQLX 4B4MA 5C36A 3D98A 5C4DA 1H5TB 4IRPA 4C2SA 4Y63A 2YC3A 3TQDA 1G9RA 2AE7A 3T7NA 1WSZA 2RJ5A 4G3SA 4Y6NA 1QG8A 5HS2A 5L6VA 4KQLA 2FYDB 4HO9A 4DDZA 2FYBA 1R7TA 2OI7A 5CMGX 5C4CA 5CQOA 1NWGB 4HO8A 1HM8A 1R82A 4KNRA 3HL3A 1JV1A 4FCUA 1IINA 1H5SA 2RITA 2V0LA 2VS3A 2VXMA 1NKHB 2V0JA 2XWNA 2Y4JA 2JCKA 4P00A 4D11C 2E3DA 1JVGA 1H7FA 1GWWA 1HJJA 1HJLA 1JV3A 1S4NA 5AJOA 3SXEA 3N9WA 2RJ8A 1ZDFA 2CU2A 4J18A 4FRBA 4KC4A 4CVHA 3IOJA 1FO9A 5EIYA 3SX3A 4FRHA 3Q80A 2RIZA 2P6WA 1H3MA 1W55A 4AYLA 3SXGA 3R2WA 1FZWA 2I5KA 3CKVA 3V0NA 4ECMA 2VSIA 4M2BA 3RMVA 1YP2A 4KC2A 1H5SB 4G3PA 3DUVA 4FROA 4Y7UA 2A8UA 3CU0A 2PGYA 4CJBA 4EEAA 3SPTA 1VGTA 1H4CA 3I0KA 5FUHA 2I7BA 3DJ4A 1H7GA 5C47A 4EEMA 4Y7GA 1GQCA 2FFUA 1H7LA 2WVKA 4AAWA 1VZXA 5CMHA 1LZIA 2Y6PA 1EZIA 4Y7TA 1ZDGA 3NGWA 2P73A 1O7OA 1NMMB 3D8VA 4M4KA 1NQIB 1S4PA 3SXDA 5BXCA 2DPWA 2AESA 1G8OA 2X65A 2WAWA 2D0JA 2Y7AA 1O0RA 1PZYB 1FR8A 2NXVA 1H4DA 2JCOA 1FXOA 1MP4A 3V0PA 1XZ6A 4DECA 2FYAA 1FRWA 2MZBA 5DDTA 3I0LA 1FOAA 5IDSA 1WT0A 3OH2A 2Y4LA 1YROB 3ZF8A 1FXJA 5CQMX 1H7HA 4KNXA 3F1YA 1H5RA 1H7EA 1VPAA 3SXAA 3V0QA 4AC3A 2OEFA 4HOCA 2QKXA 2ZU9A 1SS9A 4LW3A 4NANA 1R7YA 2VD4A 1NHEB 4FRQA 3U2TA 2YESA 4KXOA 4JISA 5C4EA 2O1HA 3D5NA 4MYBA 1GQ9A 5FTVA 3T7OA 1V82A 1H5SC 4B2WA 1Z90A 4P02A 1LZ0A 1V84A 4FQWA 2XMEA 3OH3A 2WE9A 2X5ZA 1OMXA 2YQJA 5C4BA 4HO6A 4ZDQA 5FTSA 1PZTA 1ZHJA 4AYJA 1FGXA 1INIA 2XWLA 4FRMA 2RJ0A 3ZLLA 2E8BA 4KPXA 4KT7A 1OQMB 4FREA 3K8DA 2I5EA 2ICYA 4CJ8A 5J49A 1G0RA 1H5RB 3OKRA 4Y62A 1WT2A 3ZGFA 2YQCA 3BRKX 4LW6A 3V91A 1H4EA 4ASYA 3JUJA 2RJ7A 3PKPA 1VH3A 1ZJ0A 3U0YA 3E25A 5FV9A 1R80A 1INJA 2ZU8A 3E26A 5FU0A 2OI5A 1ZI4A 1LZ7A 5L6SA 1R7XA 5IDTA 1ZJ2A 1LL3A 3T7MA 2AECA 3CKOA 3PKQA 2A8WA 1O7QA 1WT1A 2OEGA 4EE3A 3BCVA 1VGZA 2UX8A 5DDVA 4KPZA 3V8YA 2RJ9A 4HO3A 1JYLA 5FYEA 1W57A 4Y7VA 4D0TA 5C48A 1V83A 3TZTA 1ZIZA 4R7PA 3CGXA 3U2UA 2PA4A 2ICXA 1ZCVA 2Y4KA 4EVWA 1LL0A 5CMIA 4D11A 1G23A 2P72A 1MP3A 1S4OA 2QH5A 3ZLKA 3USRA 5C49A 2V0IA 1TVYA 1HM0A 1YP4A 3QVBA 5EJZA 3CKQA 1ZI1A 5C8RA 4HO0A 1G95A 1O23B 3OAMA 2D7IA 3DK5A 4KRVA 2AM5A 3OH1A 5I1FA 3JUKA 1GX4A 2RJ1A 2RIXA 1LL2A 1ON8A 1QWJA 1NF5B 4HCQA 1FG5N 2OI6A 2VXLA 1EYRA 5JQQA 2FYCB 4BQHA 3I0DA 4B2XA 4CJCA 3RSBA 1OMZA 4DE7A 3LW6A 2O1GA 3ST8A 1K4VA 5C1LA 2YCMA 1HV9A 1IIMA 3FWWA 3Q4SA 3U0XA 3SXCA 5C1HA 3OGZA 1LZJA 3K8EA 2RJ6A 3OC9A 1XHBA 5C3AA 1G93A 1VGWA 1VM8A 3OH4A 1VZTA 5C3BA 4B3UA 3EE5A 2APCA 2JCLA
chains in the Genus database with same CATH superfamily
1FWYA 4D0ZA 2X5SA 3IOHA 1GX0A 2WVLA 3U2XA 5C1GA 4FIXA 4Y64A 1G3LA 1E5KA 5D92A 3R3IA 1MP5A 3IOIA 1GA8A 4KC1A 2VS5A 3SX7A 3I0CA 4JD0A 2Q4JA 2WEEA 2BO4A 2W0WA 4HO2A 2BO6A 1MC3A 4B42A 5C3DA 1ZJ3A 1ZCYA 2WVMA 2JCJA 1GWVA 1G1LA 1VICA 2X60A 2O1FA 2D7RA 2Y4MA 2RJ4A 2Z87A 4D48A 2XMHA 1G2VA 1H7QA 2ZU7A 4HG6A 4ARWA 2YQHA 1TW5A 3JTJA 1ZCUA 4Q7CA 2PGVA 5D91A 4FRAA 4GBPA 1H7TA 3CKJA 2QGIA 5C38A 2YQSA 5CQPA 1FO8A 1JYKA 2WGZA 4BMAA 3GUEA 5CMFX 2AGDA 2BO8A 5IFYA 1R7UA 3V0OA 1G97A 4YS8A 4UEGA 5C4FA 3SX8A 1R7VA 2GGOA 4G87A 4FIYA 4B4GA 1QGQA 1VZUA 2XWMA 1ZI3A 4IRQA 3OH0A 3O3PA 1ZI5A 2AM3A 4M28A 2VFZA 4NAIA 4Y6UA 5EJ1A 4FRDA 3CKNA 2RIYA 4B5BA 1ZJ1A 2V0KA 2VSHA 1TW1A 1YP3A 5AJNA 3KIAA 4EEGA 3V8ZA 1ZCTA 1KWSA 1LVWA 1VGUA 1VH1A 2VS4A 3I0EA 4FCEA 1WT3A 1ZJOA 3U2WA 1H5SD 3FOQA 2PX7A 1I52A 4K6RA 5CQNX 4M2AA 4NAKA 1H5TA 1R81A 3V0LA 4EEOA 4EE4A 2Z86A 3SXBA 1JVDA 3I0IX 4FRPA 4B4BA 3V90A 2FFVA 2W0VA 1WVCA 3I0HA 4FRLA 3RMWA 3F1CA 2YC5A 5CMJA 2GGQA 2C0NA 4MNDA 1FR9A 2AM4A 4XWIA 3ZGGA 1HM9A 1TZFA 3U2VA 4L41C 4EE5A 2BO7A 2AH9A 3I0FA 4E1KA 2FY7A 1FGGA 3USQA 3POLA 2V0HA 3PNNA 4HO4A 4ASJA 1W77A 4Y9XA 1ZJPA 4Y7FA 3I0GA 4HO5A 5FU8A 1QGSA 5AJPA 3I0JA 2VK9A 4G3QA 3V0MA 3SX5A 1ON6A 3Q7UA 4NALA 5CQLX 4B4MA 5C36A 3D98A 5C4DA 1H5TB 4IRPA 4C2SA 4Y63A 2YC3A 3TQDA 1G9RA 2AE7A 3T7NA 1WSZA 2RJ5A 4G3SA 4Y6NA 1QG8A 5HS2A 5L6VA 4KQLA 2FYDB 4HO9A 4DDZA 2FYBA 1R7TA 2OI7A 5CMGX 5C4CA 5CQOA 1NWGB 4HO8A 1HM8A 1R82A 4KNRA 3HL3A 1JV1A 4FCUA 1IINA 1H5SA 2RITA 2V0LA 2VS3A 2VXMA 1NKHB 2V0JA 2XWNA 2Y4JA 2JCKA 4P00A 4D11C 2E3DA 1JVGA 1H7FA 1GWWA 1HJJA 1HJLA 1JV3A 1S4NA 5AJOA 3SXEA 3N9WA 2RJ8A 1ZDFA 2CU2A 4J18A 4FRBA 4KC4A 4CVHA 3IOJA 1FO9A 5EIYA 3SX3A 4FRHA 3Q80A 2RIZA 2P6WA 1H3MA 1W55A 4AYLA 3SXGA 3R2WA 1FZWA 2I5KA 3CKVA 3V0NA 4ECMA 2VSIA 4M2BA 3RMVA 1YP2A 4KC2A 1H5SB 2J0BA 4G3PA 3DUVA 4FROA 4Y7UA 2A8UA 3CU0A 2PGYA 4CJBA 4EEAA 3SPTA 1VGTA 1H4CA 3I0KA 5FUHA 2I7BA 3DJ4A 1H7GA 5C47A 4EEMA 4Y7GA 1GQCA 2FFUA 1H7LA 2WVKA 4AAWA 1VZXA 5CMHA 1LZIA 2Y6PA 1EZIA 4Y7TA 1ZDGA 3NGWA 2P73A 1O7OA 1NMMB 3D8VA 4M4KA 1NQIB 1S4PA 3SXDA 5BXCA 2DPWA 2AESA 1G8OA 2X65A 2WAWA 2D0JA 4MIXA 2Y7AA 1O0RA 1PZYB 1FR8A 2NXVA 1H4DA 2JCOA 1FXOA 1MP4A 3V0PA 1XZ6A 4DECA 2FYAA 1FRWA 2MZBA 5DDTA 3I0LA 1FOAA 5IDSA 1WT0A 3OH2A 2Y4LA 1YROB 3ZF8A 1FXJA 5CQMX 1H7HA 4KNXA 3F1YA 1H5RA 1H7EA 1VPAA 3SXAA 3V0QA 4AC3A 2OEFA 4HOCA 2QKXA 2ZU9A 1SS9A 4LW3A 4NANA 1R7YA 2VD4A 1NHEB 4FRQA 3U2TA 2YESA 4KXOA 4JISA 5C4EA 2O1HA 3D5NA 4MYBA 1GQ9A 5FTVA 3T7OA 1V82A 1H5SC 4B2WA 1Z90A 4P02A 1LZ0A 4O6NA 1V84A 4FQWA 2XMEA 3OH3A 2WE9A 2X5ZA 1OMXA 2YQJA 5C4BA 4HO6A 4ZDQA 5FTSA 1PZTA 1ZHJA 4AYJA 1FGXA 1INIA 2XWLA 4FRMA 2RJ0A 3ZLLA 2E8BA 4KPXA 4KT7A 1OQMB 4FREA 3K8DA 2I5EA 2ICYA 4CJ8A 5J49A 1G0RA 1H5RB 3OKRA 4Y62A 1WT2A 3ZGFA 2YQCA 3BRKX 4LW6A 3V91A 1H4EA 4ASYA 3JUJA 2RJ7A 3PKPA 1VH3A 1ZJ0A 3U0YA 3E25A 5FV9A 1R80A 1INJA 2ZU8A 3E26A 5FU0A 2OI5A 1ZI4A 1LZ7A 5L6SA 1R7XA 5IDTA 1ZJ2A 1LL3A 3T7MA 2AECA 3CKOA 3PKQA 2A8WA 1O7QA 1WT1A 2OEGA 4EE3A 3BCVA 1VGZA 2UX8A 5DDVA 4KPZA 3V8YA 2RJ9A 4HO3A 1JYLA 5FYEA 1W57A 4Y7VA 4D0TA 5C48A 1V83A 3TZTA 1ZIZA 4R7PA 3CGXA 3U2UA 2PA4A 2ICXA 1ZCVA 2Y4KA 4EVWA 1LL0A 5CMIA 4D11A 1G23A 2P72A 1MP3A 1S4OA 2QH5A 3ZLKA 3USRA 5C49A 2V0IA 1TVYA 1HM0A 1YP4A 3QVBA 5EJZA 3CKQA 1ZI1A 5C8RA 4HO0A 1G95A 1O23B 3OAMA 2D7IA 3DK5A 4KRVA 2AM5A 3OH1A 5I1FA 3JUKA 1GX4A 2RJ1A 2RIXA 1LL2A 1ON8A 1QWJA 1NF5B 4HCQA 4O6MA 1FG5N 2OI6A 2VXLA 1EYRA 5JQQA 2FYCB 4BQHA 3I0DA 4B2XA 4CJCA 3RSBA 1OMZA 4DE7A 3LW6A 2O1GA 3ST8A 1K4VA 5C1LA 2YCMA 1HV9A 1IIMA 3FWWA 3Q4SA 3U0XA 3SXCA 5C1HA 3OGZA 1LZJA 3K8EA 2J0AA 2RJ6A 3OC9A 1XHBA 5C3AA 1G93A 1VGWA 1VM8A 3OH4A 1VZTA 5C3BA 4B3UA 3EE5A 2APCA 2JCLA
chains in the Genus database with same CATH topology
1FWYA 4D0ZA 2X5SA 3IOHA 1GX0A 2WVLA 3U2XA 5C1GA 4FIXA 4Y64A 1G3LA 1E5KA 5D92A 3R3IA 1MP5A 3IOIA 1GA8A 4KC1A 2VS5A 3SX7A 3I0CA 4JD0A 2Q4JA 2WEEA 2BO4A 2W0WA 4HO2A 2BO6A 1MC3A 4B42A 5C3DA 1ZJ3A 1ZCYA 2WVMA 2JCJA 1GWVA 1G1LA 1VICA 2X60A 2O1FA 2D7RA 2Y4MA 2RJ4A 2Z87A 4D48A 2XMHA 1G2VA 1H7QA 2ZU7A 4HG6A 4ARWA 2YQHA 1TW5A 3JTJA 1ZCUA 4Q7CA 2PGVA 5D91A 4FRAA 4GBPA 1H7TA 3CKJA 2QGIA 5C38A 2YQSA 5CQPA 1FO8A 1JYKA 2WGZA 4BMAA 3GUEA 5CMFX 2AGDA 2BO8A 5IFYA 1R7UA 3V0OA 1G97A 4YS8A 4UEGA 5C4FA 3SX8A 1R7VA 2GGOA 4G87A 4FIYA 4B4GA 1QGQA 1VZUA 2XWMA 1ZI3A 4IRQA 3OH0A 3O3PA 1ZI5A 2AM3A 4M28A 2VFZA 4NAIA 4Y6UA 5EJ1A 4FRDA 3CKNA 2RIYA 4B5BA 1ZJ1A 2V0KA 2VSHA 1TW1A 1YP3A 5AJNA 3KIAA 4EEGA 3V8ZA 1ZCTA 1KWSA 1LVWA 1VGUA 1VH1A 2VS4A 3I0EA 4FCEA 1WT3A 1ZJOA 3U2WA 1H5SD 3FOQA 2PX7A 1I52A 4K6RA 5CQNX 4M2AA 4NAKA 1H5TA 1R81A 3V0LA 4EEOA 4EE4A 2Z86A 3SXBA 1JVDA 3I0IX 4FRPA 4B4BA 3V90A 2FFVA 2W0VA 1WVCA 3I0HA 4FRLA 3RMWA 3F1CA 2YC5A 5CMJA 2GGQA 2C0NA 4MNDA 1FR9A 2AM4A 4XWIA 3ZGGA 1HM9A 1TZFA 3U2VA 4L41C 4EE5A 2BO7A 2AH9A 3I0FA 4E1KA 2FY7A 1FGGA 3USQA 3POLA 2V0HA 3PNNA 4HO4A 4ASJA 1W77A 4Y9XA 1ZJPA 4Y7FA 3I0GA 4HO5A 5FU8A 1QGSA 5AJPA 3I0JA 2VK9A 4G3QA 3V0MA 3SX5A 1ON6A 3Q7UA 4NALA 5CQLX 4B4MA 5C36A 3D98A 5C4DA 1H5TB 4IRPA 4C2SA 4Y63A 2YC3A 3TQDA 1G9RA 2AE7A 3T7NA 1WSZA 2RJ5A 4G3SA 4Y6NA 1QG8A 5HS2A 5L6VA 4KQLA 2FYDB 4HO9A 4DDZA 2FYBA 1R7TA 2OI7A 5CMGX 5C4CA 5CQOA 1NWGB 4HO8A 1HM8A 1R82A 4KNRA 3HL3A 1JV1A 4FCUA 1IINA 1H5SA 2RITA 2V0LA 2VS3A 2VXMA 1NKHB 2V0JA 2XWNA 2Y4JA 2JCKA 4P00A 4D11C 2E3DA 1JVGA 1H7FA 1GWWA 1HJJA 1HJLA 1JV3A 1S4NA 5AJOA 3SXEA 3N9WA 2RJ8A 1ZDFA 2CU2A 4J18A 4FRBA 4KC4A 4CVHA 3IOJA 1FO9A 5EIYA 3SX3A 4FRHA 3Q80A 2RIZA 2P6WA 1H3MA 1W55A 4AYLA 3SXGA 3R2WA 1FZWA 2I5KA 3CKVA 3V0NA 4ECMA 2VSIA 4M2BA 3RMVA 1YP2A 4KC2A 1H5SB 2J0BA 4G3PA 3DUVA 4FROA 4Y7UA 2A8UA 3CU0A 2PGYA 4CJBA 4EEAA 3SPTA 1VGTA 1H4CA 3I0KA 5FUHA 2I7BA 3DJ4A 1H7GA 5C47A 4EEMA 4Y7GA 1GQCA 2FFUA 1H7LA 2WVKA 4AAWA 1VZXA 5CMHA 1LZIA 2Y6PA 1EZIA 4Y7TA 1ZDGA 3NGWA 2P73A 1O7OA 1NMMB 3D8VA 4M4KA 1NQIB 1S4PA 3SXDA 5BXCA 2DPWA 2AESA 1G8OA 2X65A 2WAWA 2D0JA 4MIXA 2Y7AA 1O0RA 1PZYB 1FR8A 2NXVA 1H4DA 2JCOA 1FXOA 1MP4A 3V0PA 1XZ6A 4DECA 2FYAA 1FRWA 2MZBA 5DDTA 3I0LA 1FOAA 5IDSA 1WT0A 3OH2A 2Y4LA 1YROB 3ZF8A 1FXJA 5CQMX 1H7HA 4KNXA 3F1YA 1H5RA 1H7EA 1VPAA 3SXAA 3V0QA 4AC3A 2OEFA 4HOCA 2QKXA 2ZU9A 1SS9A 4LW3A 4NANA 1R7YA 2VD4A 1NHEB 4FRQA 3U2TA 2YESA 4KXOA 4JISA 5C4EA 2O1HA 3D5NA 4MYBA 1GQ9A 5FTVA 3T7OA 1V82A 1H5SC 4B2WA 1Z90A 4P02A 1LZ0A 4O6NA 1V84A 4FQWA 2XMEA 3OH3A 2WE9A 2X5ZA 1OMXA 2YQJA 5C4BA 4HO6A 4ZDQA 5FTSA 1PZTA 1ZHJA 4AYJA 1FGXA 1INIA 2XWLA 4FRMA 2RJ0A 3ZLLA 2E8BA 4KPXA 4KT7A 1OQMB 4FREA 3K8DA 2I5EA 2ICYA 4CJ8A 5J49A 1G0RA 1H5RB 3OKRA 4Y62A 1WT2A 3ZGFA 2YQCA 3BRKX 4LW6A 3V91A 1H4EA 4ASYA 3JUJA 2RJ7A 3PKPA 1VH3A 1ZJ0A 3U0YA 3E25A 5FV9A 1R80A 1INJA 2ZU8A 3E26A 5FU0A 2OI5A 1ZI4A 1LZ7A 5L6SA 1R7XA 5IDTA 1ZJ2A 1LL3A 3T7MA 2AECA 3CKOA 3PKQA 2A8WA 1O7QA 1WT1A 2OEGA 4EE3A 3BCVA 1VGZA 2UX8A 5DDVA 4KPZA 3V8YA 2RJ9A 4HO3A 1JYLA 5FYEA 1W57A 4Y7VA 4D0TA 5C48A 1V83A 3TZTA 1ZIZA 4R7PA 3CGXA 3U2UA 2PA4A 2ICXA 1ZCVA 2Y4KA 4EVWA 1LL0A 5CMIA 4D11A 1G23A 2P72A 1MP3A 1S4OA 2QH5A 3ZLKA 3USRA 5C49A 2V0IA 1TVYA 1HM0A 1YP4A 3QVBA 5EJZA 3CKQA 1ZI1A 5C8RA 4HO0A 1G95A 1O23B 3OAMA 2D7IA 3DK5A 4KRVA 2AM5A 3OH1A 5I1FA 3JUKA 1GX4A 2RJ1A 2RIXA 1LL2A 1ON8A 1QWJA 1NF5B 4HCQA 4O6MA 1FG5N 2OI6A 2VXLA 1EYRA 5JQQA 2FYCB 4BQHA 3I0DA 4B2XA 4CJCA 3RSBA 1OMZA 4DE7A 3LW6A 2O1GA 3ST8A 1K4VA 5C1LA 2YCMA 1HV9A 1IIMA 3FWWA 3Q4SA 3U0XA 3SXCA 5C1HA 3OGZA 1LZJA 3K8EA 2J0AA 2RJ6A 3OC9A 1XHBA 5C3AA 1G93A 1VGWA 1VM8A 3OH4A 1VZTA 5C3BA 4B3UA 3EE5A 2APCA 2JCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWY A;  4D0Z A;  2X5S A;  3IOH A;  1GX0 A;  2WVL A;  3U2X A;  5C1G A;  4Y64 A;  1G3L A;  1E5K A;  3R3I A;  1MP5 A;  3IOI A;  1GA8 A;  4KC1 A;  2VS5 A;  3SX7 A;  3I0C A;  4JD0 A;  2Q4J A;  2WEE A;  2BO4 A;  2W0W A;  4HO2 A;  2BO6 A;  1MC3 A;  4B42 A;  5C3D A;  1ZJ3 A;  1ZCY A;  2WVM A;  2JCJ A;  1GWV A;  1G1L A;  1VIC A;  2X60 A;  2O1F A;  2D7R A;  2Y4M A;  2RJ4 A;  2Z87 A;  4D48 A;  2XMH A;  1G2V A;  1H7Q A;  2ZU7 A;  4HG6 A;  4ARW A;  2YQH A;  1TW5 A;  3JTJ A;  1ZCU A;  2PGV A;  4FRA A;  4GBP A;  1H7T A;  3CKJ A;  2QGI A;  5C38 A;  2YQS A;  5CQP A;  1FO8 A;  1JYK A;  2WGZ A;  4BMA A;  3GUE A;  5CMF X;  2AGD A;  2BO8 A;  5IFY A;  1R7U A;  3V0O A;  1G97 A;  4YS8 A;  4UEG A;  5C4F A;  3SX8 A;  1R7V A;  2GGO A;  4G87 A;  4B4G A;  1QGQ A;  1VZU A;  2XWM A;  1ZI3 A;  4IRQ A;  3OH0 A;  3O3P A;  1ZI5 A;  2AM3 A;  4M28 A;  2VFZ A;  4NAI A;  4Y6U A;  5EJ1 A;  4FRD A;  3CKN A;  2RIY A;  4B5B A;  1ZJ1 A;  2V0K A;  2VSH A;  1TW1 A;  1YP3 A;  5AJN A;  3KIA A;  4EEG A;  3V8Z A;  1ZCT A;  1KWS A;  1LVW A;  1VGU A;  1VH1 A;  2VS4 A;  3I0E A;  4FCE A;  1WT3 A;  1ZJO A;  3U2W A;  1H5S D;  3FOQ A;  2PX7 A;  1I52 A;  4K6R A;  5CQN X;  4M2A A;  4NAK A;  1H5T A;  1R81 A;  3V0L A;  4EEO A;  4EE4 A;  2Z86 A;  3SXB A;  1JVD A;  3I0I X;  4FRP A;  4B4B A;  3V90 A;  2FFV A;  2W0V A;  1WVC A;  3I0H A;  4FRL A;  3RMW A;  3F1C A;  2YC5 A;  5CMJ A;  2GGQ A;  4MND A;  1FR9 A;  2AM4 A;  4XWI A;  3ZGG A;  1HM9 A;  1TZF A;  3U2V A;  4L41 C;  4EE5 A;  2BO7 A;  2AH9 A;  3I0F A;  4E1K A;  2FY7 A;  1FGG A;  3USQ A;  3POL A;  2V0H A;  3PNN A;  4HO4 A;  4ASJ A;  1W77 A;  4Y9X A;  1ZJP A;  4Y7F A;  3I0G A;  4HO5 A;  5FU8 A;  1QGS A;  5AJP A;  3I0J A;  4G3Q A;  3V0M A;  3SX5 A;  1ON6 A;  3Q7U A;  4NAL A;  5CQL X;  4B4M A;  5C36 A;  3D98 A;  5C4D A;  1H5T B;  4IRP A;  4C2S A;  4Y63 A;  2YC3 A;  3TQD A;  1G9R A;  2AE7 A;  3T7N A;  1WSZ A;  2RJ5 A;  4G3S A;  4Y6N A;  1QG8 A;  5HS2 A;  5L6V A;  4KQL A;  2FYD B;  4HO9 A;  4DDZ A;  2FYB A;  1R7T A;  2OI7 A;  5CMG X;  5C4C A;  5CQO A;  1NWG B;  4HO8 A;  1HM8 A;  1R82 A;  4KNR A;  3HL3 A;  1JV1 A;  4FCU A;  1IIN A;  1H5S A;  2RIT A;  2V0L A;  2VS3 A;  2VXM A;  1NKH B;  2V0J A;  2XWN A;  2Y4J A;  2JCK A;  4P00 A;  4D11 C;  2E3D A;  1JVG A;  1H7F A;  1GWW A;  1HJJ A;  1HJL A;  1JV3 A;  1S4N A;  5AJO A;  3SXE A;  3N9W A;  2RJ8 A;  1ZDF A;  2CU2 A;  4J18 A;  4FRB A;  4KC4 A;  4CVH A;  3IOJ A;  1FO9 A;  5EIY A;  3SX3 A;  4FRH A;  3Q80 A;  2RIZ A;  2P6W A;  1H3M A;  1W55 A;  4AYL A;  3SXG A;  3R2W A;  1FZW A;  2I5K A;  3CKV A;  3V0N A;  4ECM A;  2VSI A;  4M2B A;  3RMV A;  1YP2 A;  4KC2 A;  1H5S B;  4G3P A;  3DUV A;  4FRO A;  4Y7U A;  2A8U A;  3CU0 A;  2PGY A;  4CJB A;  4EEA A;  3SPT A;  1VGT A;  1H4C A;  3I0K A;  5FUH A;  2I7B A;  3DJ4 A;  1H7G A;  5C47 A;  4EEM A;  4Y7G A;  1GQC A;  2FFU A;  1H7L A;  2WVK A;  4AAW A;  1VZX A;  5CMH A;  1LZI A;  2Y6P A;  1EZI A;  4Y7T A;  1ZDG A;  3NGW A;  2P73 A;  1O7O A;  1NMM B;  3D8V A;  4M4K A;  1NQI B;  1S4P A;  3SXD A;  5BXC A;  2DPW A;  2AES A;  1G8O A;  2X65 A;  2WAW A;  2D0J A;  2Y7A A;  1O0R A;  1PZY B;  1FR8 A;  2NXV A;  1H4D A;  2JCO A;  1FXO A;  1MP4 A;  3V0P A;  1XZ6 A;  4DEC A;  2FYA A;  1FRW A;  2MZB A;  5DDT A;  3I0L A;  1FOA A;  5IDS A;  1WT0 A;  3OH2 A;  2Y4L A;  1YRO B;  3ZF8 A;  1FXJ A;  5CQM X;  1H7H A;  4KNX A;  3F1Y A;  1H5R A;  1H7E A;  1VPA A;  3SXA A;  3V0Q A;  4AC3 A;  2OEF A;  4HOC A;  2QKX A;  2ZU9 A;  1SS9 A;  4LW3 A;  4NAN A;  1R7Y A;  2VD4 A;  1NHE B;  4FRQ A;  3U2T A;  2YES A;  4KXO A;  4JIS A;  5C4E A;  2O1H A;  3D5N A;  4MYB A;  1GQ9 A;  5FTV A;  3T7O A;  1V82 A;  1H5S C;  4B2W A;  1Z90 A;  4P02 A;  1LZ0 A;  1V84 A;  4FQW A;  2XME A;  3OH3 A;  2WE9 A;  2X5Z A;  1OMX A;  2YQJ A;  5C4B A;  4HO6 A;  4ZDQ A;  5FTS A;  1PZT A;  1ZHJ A;  4AYJ A;  1FGX A;  1INI A;  2XWL A;  4FRM A;  2RJ0 A;  3ZLL A;  2E8B A;  4KPX A;  4KT7 A;  1OQM B;  4FRE A;  3K8D A;  2I5E A;  2ICY A;  4CJ8 A;  5J49 A;  1G0R A;  1H5R B;  3OKR A;  4Y62 A;  1WT2 A;  3ZGF A;  2YQC A;  3BRK X;  4LW6 A;  3V91 A;  1H4E A;  4ASY A;  3JUJ A;  2RJ7 A;  3PKP A;  1VH3 A;  1ZJ0 A;  3U0Y A;  3E25 A;  5FV9 A;  1R80 A;  1INJ A;  2ZU8 A;  3E26 A;  5FU0 A;  2OI5 A;  1ZI4 A;  1LZ7 A;  5L6S A;  1R7X A;  5IDT A;  1ZJ2 A;  1LL3 A;  3T7M A;  2AEC A;  3CKO A;  3PKQ A;  2A8W A;  1O7Q A;  1WT1 A;  2OEG A;  4EE3 A;  3BCV A;  1VGZ A;  2UX8 A;  5DDV A;  4KPZ A;  3V8Y A;  2RJ9 A;  4HO3 A;  1JYL A;  5FYE A;  1W57 A;  4Y7V A;  4D0T A;  5C48 A;  1V83 A;  3TZT A;  1ZIZ A;  4R7P A;  3CGX A;  3U2U A;  2PA4 A;  2ICX A;  1ZCV A;  2Y4K A;  4EVW A;  1LL0 A;  5CMI A;  4D11 A;  1G23 A;  2P72 A;  1MP3 A;  1S4O A;  2QH5 A;  3ZLK A;  3USR A;  5C49 A;  2V0I A;  1TVY A;  1HM0 A;  1YP4 A;  3QVB A;  5EJZ A;  3CKQ A;  1ZI1 A;  5C8R A;  4HO0 A;  1G95 A;  1O23 B;  3OAM A;  2D7I A;  3DK5 A;  4KRV A;  2AM5 A;  3OH1 A;  5I1F A;  3JUK A;  1GX4 A;  2RJ1 A;  2RIX A;  1LL2 A;  1ON8 A;  1QWJ A;  1NF5 B;  4HCQ A;  1FG5 N;  2OI6 A;  2VXL A;  1EYR A;  5JQQ A;  2FYC B;  4BQH A;  3I0D A;  4B2X A;  4CJC A;  3RSB A;  1OMZ A;  4DE7 A;  3LW6 A;  2O1G A;  3ST8 A;  1K4V A;  5C1L A;  2YCM A;  1HV9 A;  1IIM A;  3FWW A;  3Q4S A;  3U0X A;  3SXC A;  5C1H A;  3OGZ A;  1LZJ A;  3K8E A;  2RJ6 A;  3OC9 A;  1XHB A;  5C3A A;  1G93 A;  1VGW A;  1VM8 A;  3OH4 A;  1VZT A;  5C3B A;  4B3U A;  3EE5 A;  2APC A;  2JCL A; 
#chains in the Genus database with same CATH topology
 1FWY A;  4D0Z A;  2X5S A;  3IOH A;  1GX0 A;  2WVL A;  3U2X A;  5C1G A;  4FIX A;  4Y64 A;  1G3L A;  1E5K A;  5D92 A;  3R3I A;  1MP5 A;  3IOI A;  1GA8 A;  4KC1 A;  2VS5 A;  3SX7 A;  3I0C A;  4JD0 A;  2Q4J A;  2WEE A;  2BO4 A;  2W0W A;  4HO2 A;  2BO6 A;  1MC3 A;  4B42 A;  5C3D A;  1ZJ3 A;  1ZCY A;  2WVM A;  2JCJ A;  1GWV A;  1G1L A;  1VIC A;  2X60 A;  2O1F A;  2D7R A;  2Y4M A;  2RJ4 A;  2Z87 A;  4D48 A;  2XMH A;  1G2V A;  1H7Q A;  2ZU7 A;  4HG6 A;  4ARW A;  2YQH A;  1TW5 A;  3JTJ A;  1ZCU A;  4Q7C A;  2PGV A;  5D91 A;  4FRA A;  4GBP A;  1H7T A;  3CKJ A;  2QGI A;  5C38 A;  2YQS A;  5CQP A;  1FO8 A;  1JYK A;  2WGZ A;  4BMA A;  3GUE A;  5CMF X;  2AGD A;  2BO8 A;  5IFY A;  1R7U A;  3V0O A;  1G97 A;  4YS8 A;  4UEG A;  5C4F A;  3SX8 A;  1R7V A;  2GGO A;  4G87 A;  4FIY A;  4B4G A;  1QGQ A;  1VZU A;  2XWM A;  1ZI3 A;  4IRQ A;  3OH0 A;  3O3P A;  1ZI5 A;  2AM3 A;  4M28 A;  2VFZ A;  4NAI A;  4Y6U A;  5EJ1 A;  4FRD A;  3CKN A;  2RIY A;  4B5B A;  1ZJ1 A;  2V0K A;  2VSH A;  1TW1 A;  1YP3 A;  5AJN A;  3KIA A;  4EEG A;  3V8Z A;  1ZCT A;  1KWS A;  1LVW A;  1VGU A;  1VH1 A;  2VS4 A;  3I0E A;  4FCE A;  1WT3 A;  1ZJO A;  3U2W A;  1H5S D;  3FOQ A;  2PX7 A;  1I52 A;  4K6R A;  5CQN X;  4M2A A;  4NAK A;  1H5T A;  1R81 A;  3V0L A;  4EEO A;  4EE4 A;  2Z86 A;  3SXB A;  1JVD A;  3I0I X;  4FRP A;  4B4B A;  3V90 A;  2FFV A;  2W0V A;  1WVC A;  3I0H A;  4FRL A;  3RMW A;  3F1C A;  2YC5 A;  5CMJ A;  2GGQ A;  2C0N A;  4MND A;  1FR9 A;  2AM4 A;  4XWI A;  3ZGG A;  1HM9 A;  1TZF A;  3U2V A;  4L41 C;  4EE5 A;  2BO7 A;  2AH9 A;  3I0F A;  4E1K A;  2FY7 A;  1FGG A;  3USQ A;  3POL A;  2V0H A;  3PNN A;  4HO4 A;  4ASJ A;  1W77 A;  4Y9X A;  1ZJP A;  4Y7F A;  3I0G A;  4HO5 A;  5FU8 A;  1QGS A;  5AJP A;  3I0J A;  2VK9 A;  4G3Q A;  3V0M A;  3SX5 A;  1ON6 A;  3Q7U A;  4NAL A;  5CQL X;  4B4M A;  5C36 A;  3D98 A;  5C4D A;  1H5T B;  4IRP A;  4C2S A;  4Y63 A;  2YC3 A;  3TQD A;  1G9R A;  2AE7 A;  3T7N A;  1WSZ A;  2RJ5 A;  4G3S A;  4Y6N A;  1QG8 A;  5HS2 A;  5L6V A;  4KQL A;  2FYD B;  4HO9 A;  4DDZ A;  2FYB A;  1R7T A;  2OI7 A;  5CMG X;  5C4C A;  5CQO A;  1NWG B;  4HO8 A;  1HM8 A;  1R82 A;  4KNR A;  3HL3 A;  1JV1 A;  4FCU A;  1IIN A;  1H5S A;  2RIT A;  2V0L A;  2VS3 A;  2VXM A;  1NKH B;  2V0J A;  2XWN A;  2Y4J A;  2JCK A;  4P00 A;  4D11 C;  2E3D A;  1JVG A;  1H7F A;  1GWW A;  1HJJ A;  1HJL A;  1JV3 A;  1S4N A;  5AJO A;  3SXE A;  3N9W A;  2RJ8 A;  1ZDF A;  2CU2 A;  4J18 A;  4FRB A;  4KC4 A;  4CVH A;  3IOJ A;  1FO9 A;  5EIY A;  3SX3 A;  4FRH A;  3Q80 A;  2RIZ A;  2P6W A;  1H3M A;  1W55 A;  4AYL A;  3SXG A;  3R2W A;  1FZW A;  2I5K A;  3CKV A;  3V0N A;  4ECM A;  2VSI A;  4M2B A;  3RMV A;  1YP2 A;  4KC2 A;  1H5S B;  2J0B A;  4G3P A;  3DUV A;  4FRO A;  4Y7U A;  2A8U A;  3CU0 A;  2PGY A;  4CJB A;  4EEA A;  3SPT A;  1VGT A;  1H4C A;  3I0K A;  5FUH A;  2I7B A;  3DJ4 A;  1H7G A;  5C47 A;  4EEM A;  4Y7G A;  1GQC A;  2FFU A;  1H7L A;  2WVK A;  4AAW A;  1VZX A;  5CMH A;  1LZI A;  2Y6P A;  1EZI A;  4Y7T A;  1ZDG A;  3NGW A;  2P73 A;  1O7O A;  1NMM B;  3D8V A;  4M4K A;  1NQI B;  1S4P A;  3SXD A;  5BXC A;  2DPW A;  2AES A;  1G8O A;  2X65 A;  2WAW A;  2D0J A;  4MIX A;  2Y7A A;  1O0R A;  1PZY B;  1FR8 A;  2NXV A;  1H4D A;  2JCO A;  1FXO A;  1MP4 A;  3V0P A;  1XZ6 A;  4DEC A;  2FYA A;  1FRW A;  2MZB A;  5DDT A;  3I0L A;  1FOA A;  5IDS A;  1WT0 A;  3OH2 A;  2Y4L A;  1YRO B;  3ZF8 A;  1FXJ A;  5CQM X;  1H7H A;  4KNX A;  3F1Y A;  1H5R A;  1H7E A;  1VPA A;  3SXA A;  3V0Q A;  4AC3 A;  2OEF A;  4HOC A;  2QKX A;  2ZU9 A;  1SS9 A;  4LW3 A;  4NAN A;  1R7Y A;  2VD4 A;  1NHE B;  4FRQ A;  3U2T A;  2YES A;  4KXO A;  4JIS A;  5C4E A;  2O1H A;  3D5N A;  4MYB A;  1GQ9 A;  5FTV A;  3T7O A;  1V82 A;  1H5S C;  4B2W A;  1Z90 A;  4P02 A;  1LZ0 A;  4O6N A;  1V84 A;  4FQW A;  2XME A;  3OH3 A;  2WE9 A;  2X5Z A;  1OMX A;  2YQJ A;  5C4B A;  4HO6 A;  4ZDQ A;  5FTS A;  1PZT A;  1ZHJ A;  4AYJ A;  1FGX A;  1INI A;  2XWL A;  4FRM A;  2RJ0 A;  3ZLL A;  2E8B A;  4KPX A;  4KT7 A;  1OQM B;  4FRE A;  3K8D A;  2I5E A;  2ICY A;  4CJ8 A;  5J49 A;  1G0R A;  1H5R B;  3OKR A;  4Y62 A;  1WT2 A;  3ZGF A;  2YQC A;  3BRK X;  4LW6 A;  3V91 A;  1H4E A;  4ASY A;  3JUJ A;  2RJ7 A;  3PKP A;  1VH3 A;  1ZJ0 A;  3U0Y A;  3E25 A;  5FV9 A;  1R80 A;  1INJ A;  2ZU8 A;  3E26 A;  5FU0 A;  2OI5 A;  1ZI4 A;  1LZ7 A;  5L6S A;  1R7X A;  5IDT A;  1ZJ2 A;  1LL3 A;  3T7M A;  2AEC A;  3CKO A;  3PKQ A;  2A8W A;  1O7Q A;  1WT1 A;  2OEG A;  4EE3 A;  3BCV A;  1VGZ A;  2UX8 A;  5DDV A;  4KPZ A;  3V8Y A;  2RJ9 A;  4HO3 A;  1JYL A;  5FYE A;  1W57 A;  4Y7V A;  4D0T A;  5C48 A;  1V83 A;  3TZT A;  1ZIZ A;  4R7P A;  3CGX A;  3U2U A;  2PA4 A;  2ICX A;  1ZCV A;  2Y4K A;  4EVW A;  1LL0 A;  5CMI A;  4D11 A;  1G23 A;  2P72 A;  1MP3 A;  1S4O A;  2QH5 A;  3ZLK A;  3USR A;  5C49 A;  2V0I A;  1TVY A;  1HM0 A;  1YP4 A;  3QVB A;  5EJZ A;  3CKQ A;  1ZI1 A;  5C8R A;  4HO0 A;  1G95 A;  1O23 B;  3OAM A;  2D7I A;  3DK5 A;  4KRV A;  2AM5 A;  3OH1 A;  5I1F A;  3JUK A;  1GX4 A;  2RJ1 A;  2RIX A;  1LL2 A;  1ON8 A;  1QWJ A;  1NF5 B;  4HCQ A;  4O6M A;  1FG5 N;  2OI6 A;  2VXL A;  1EYR A;  5JQQ A;  2FYC B;  4BQH A;  3I0D A;  4B2X A;  4CJC A;  3RSB A;  1OMZ A;  4DE7 A;  3LW6 A;  2O1G A;  3ST8 A;  1K4V A;  5C1L A;  2YCM A;  1HV9 A;  1IIM A;  3FWW A;  3Q4S A;  3U0X A;  3SXC A;  5C1H A;  3OGZ A;  1LZJ A;  3K8E A;  2J0A A;  2RJ6 A;  3OC9 A;  1XHB A;  5C3A A;  1G93 A;  1VGW A;  1VM8 A;  3OH4 A;  1VZT A;  5C3B A;  4B3U A;  3EE5 A;  2APC A;  2JCL A; 
#chains in the Genus database with same CATH homology
 1FWY A;  4D0Z A;  2X5S A;  3IOH A;  1GX0 A;  2WVL A;  3U2X A;  5C1G A;  4FIX A;  4Y64 A;  1G3L A;  1E5K A;  5D92 A;  3R3I A;  1MP5 A;  3IOI A;  1GA8 A;  4KC1 A;  2VS5 A;  3SX7 A;  3I0C A;  4JD0 A;  2Q4J A;  2WEE A;  2BO4 A;  2W0W A;  4HO2 A;  2BO6 A;  1MC3 A;  4B42 A;  5C3D A;  1ZJ3 A;  1ZCY A;  2WVM A;  2JCJ A;  1GWV A;  1G1L A;  1VIC A;  2X60 A;  2O1F A;  2D7R A;  2Y4M A;  2RJ4 A;  2Z87 A;  4D48 A;  2XMH A;  1G2V A;  1H7Q A;  2ZU7 A;  4HG6 A;  4ARW A;  2YQH A;  1TW5 A;  3JTJ A;  1ZCU A;  4Q7C A;  2PGV A;  5D91 A;  4FRA A;  4GBP A;  1H7T A;  3CKJ A;  2QGI A;  5C38 A;  2YQS A;  5CQP A;  1FO8 A;  1JYK A;  2WGZ A;  4BMA A;  3GUE A;  5CMF X;  2AGD A;  2BO8 A;  5IFY A;  1R7U A;  3V0O A;  1G97 A;  4YS8 A;  4UEG A;  5C4F A;  3SX8 A;  1R7V A;  2GGO A;  4G87 A;  4FIY A;  4B4G A;  1QGQ A;  1VZU A;  2XWM A;  1ZI3 A;  4IRQ A;  3OH0 A;  3O3P A;  1ZI5 A;  2AM3 A;  4M28 A;  2VFZ A;  4NAI A;  4Y6U A;  5EJ1 A;  4FRD A;  3CKN A;  2RIY A;  4B5B A;  1ZJ1 A;  2V0K A;  2VSH A;  1TW1 A;  1YP3 A;  5AJN A;  3KIA A;  4EEG A;  3V8Z A;  1ZCT A;  1KWS A;  1LVW A;  1VGU A;  1VH1 A;  2VS4 A;  3I0E A;  4FCE A;  1WT3 A;  1ZJO A;  3U2W A;  1H5S D;  3FOQ A;  2PX7 A;  1I52 A;  4K6R A;  5CQN X;  4M2A A;  4NAK A;  1H5T A;  1R81 A;  3V0L A;  4EEO A;  4EE4 A;  2Z86 A;  3SXB A;  1JVD A;  3I0I X;  4FRP A;  4B4B A;  3V90 A;  2FFV A;  2W0V A;  1WVC A;  3I0H A;  4FRL A;  3RMW A;  3F1C A;  2YC5 A;  5CMJ A;  2GGQ A;  2C0N A;  4MND A;  1FR9 A;  2AM4 A;  4XWI A;  3ZGG A;  1HM9 A;  1TZF A;  3U2V A;  4L41 C;  4EE5 A;  2BO7 A;  2AH9 A;  3I0F A;  4E1K A;  2FY7 A;  1FGG A;  3USQ A;  3POL A;  2V0H A;  3PNN A;  4HO4 A;  4ASJ A;  1W77 A;  4Y9X A;  1ZJP A;  4Y7F A;  3I0G A;  4HO5 A;  5FU8 A;  1QGS A;  5AJP A;  3I0J A;  2VK9 A;  4G3Q A;  3V0M A;  3SX5 A;  1ON6 A;  3Q7U A;  4NAL A;  5CQL X;  4B4M A;  5C36 A;  3D98 A;  5C4D A;  1H5T B;  4IRP A;  4C2S A;  4Y63 A;  2YC3 A;  3TQD A;  1G9R A;  2AE7 A;  3T7N A;  1WSZ A;  2RJ5 A;  4G3S A;  4Y6N A;  1QG8 A;  5HS2 A;  5L6V A;  4KQL A;  2FYD B;  4HO9 A;  4DDZ A;  2FYB A;  1R7T A;  2OI7 A;  5CMG X;  5C4C A;  5CQO A;  1NWG B;  4HO8 A;  1HM8 A;  1R82 A;  4KNR A;  3HL3 A;  1JV1 A;  4FCU A;  1IIN A;  1H5S A;  2RIT A;  2V0L A;  2VS3 A;  2VXM A;  1NKH B;  2V0J A;  2XWN A;  2Y4J A;  2JCK A;  4P00 A;  4D11 C;  2E3D A;  1JVG A;  1H7F A;  1GWW A;  1HJJ A;  1HJL A;  1JV3 A;  1S4N A;  5AJO A;  3SXE A;  3N9W A;  2RJ8 A;  1ZDF A;  2CU2 A;  4J18 A;  4FRB A;  4KC4 A;  4CVH A;  3IOJ A;  1FO9 A;  5EIY A;  3SX3 A;  4FRH A;  3Q80 A;  2RIZ A;  2P6W A;  1H3M A;  1W55 A;  4AYL A;  3SXG A;  3R2W A;  1FZW A;  2I5K A;  3CKV A;  3V0N A;  4ECM A;  2VSI A;  4M2B A;  3RMV A;  1YP2 A;  4KC2 A;  1H5S B;  2J0B A;  4G3P A;  3DUV A;  4FRO A;  4Y7U A;  2A8U A;  3CU0 A;  2PGY A;  4CJB A;  4EEA A;  3SPT A;  1VGT A;  1H4C A;  3I0K A;  5FUH A;  2I7B A;  3DJ4 A;  1H7G A;  5C47 A;  4EEM A;  4Y7G A;  1GQC A;  2FFU A;  1H7L A;  2WVK A;  4AAW A;  1VZX A;  5CMH A;  1LZI A;  2Y6P A;  1EZI A;  4Y7T A;  1ZDG A;  3NGW A;  2P73 A;  1O7O A;  1NMM B;  3D8V A;  4M4K A;  1NQI B;  1S4P A;  3SXD A;  5BXC A;  2DPW A;  2AES A;  1G8O A;  2X65 A;  2WAW A;  2D0J A;  4MIX A;  2Y7A A;  1O0R A;  1PZY B;  1FR8 A;  2NXV A;  1H4D A;  2JCO A;  1FXO A;  1MP4 A;  3V0P A;  1XZ6 A;  4DEC A;  2FYA A;  1FRW A;  2MZB A;  5DDT A;  3I0L A;  1FOA A;  5IDS A;  1WT0 A;  3OH2 A;  2Y4L A;  1YRO B;  3ZF8 A;  1FXJ A;  5CQM X;  1H7H A;  4KNX A;  3F1Y A;  1H5R A;  1H7E A;  1VPA A;  3SXA A;  3V0Q A;  4AC3 A;  2OEF A;  4HOC A;  2QKX A;  2ZU9 A;  1SS9 A;  4LW3 A;  4NAN A;  1R7Y A;  2VD4 A;  1NHE B;  4FRQ A;  3U2T A;  2YES A;  4KXO A;  4JIS A;  5C4E A;  2O1H A;  3D5N A;  4MYB A;  1GQ9 A;  5FTV A;  3T7O A;  1V82 A;  1H5S C;  4B2W A;  1Z90 A;  4P02 A;  1LZ0 A;  4O6N A;  1V84 A;  4FQW A;  2XME A;  3OH3 A;  2WE9 A;  2X5Z A;  1OMX A;  2YQJ A;  5C4B A;  4HO6 A;  4ZDQ A;  5FTS A;  1PZT A;  1ZHJ A;  4AYJ A;  1FGX A;  1INI A;  2XWL A;  4FRM A;  2RJ0 A;  3ZLL A;  2E8B A;  4KPX A;  4KT7 A;  1OQM B;  4FRE A;  3K8D A;  2I5E A;  2ICY A;  4CJ8 A;  5J49 A;  1G0R A;  1H5R B;  3OKR A;  4Y62 A;  1WT2 A;  3ZGF A;  2YQC A;  3BRK X;  4LW6 A;  3V91 A;  1H4E A;  4ASY A;  3JUJ A;  2RJ7 A;  3PKP A;  1VH3 A;  1ZJ0 A;  3U0Y A;  3E25 A;  5FV9 A;  1R80 A;  1INJ A;  2ZU8 A;  3E26 A;  5FU0 A;  2OI5 A;  1ZI4 A;  1LZ7 A;  5L6S A;  1R7X A;  5IDT A;  1ZJ2 A;  1LL3 A;  3T7M A;  2AEC A;  3CKO A;  3PKQ A;  2A8W A;  1O7Q A;  1WT1 A;  2OEG A;  4EE3 A;  3BCV A;  1VGZ A;  2UX8 A;  5DDV A;  4KPZ A;  3V8Y A;  2RJ9 A;  4HO3 A;  1JYL A;  5FYE A;  1W57 A;  4Y7V A;  4D0T A;  5C48 A;  1V83 A;  3TZT A;  1ZIZ A;  4R7P A;  3CGX A;  3U2U A;  2PA4 A;  2ICX A;  1ZCV A;  2Y4K A;  4EVW A;  1LL0 A;  5CMI A;  4D11 A;  1G23 A;  2P72 A;  1MP3 A;  1S4O A;  2QH5 A;  3ZLK A;  3USR A;  5C49 A;  2V0I A;  1TVY A;  1HM0 A;  1YP4 A;  3QVB A;  5EJZ A;  3CKQ A;  1ZI1 A;  5C8R A;  4HO0 A;  1G95 A;  1O23 B;  3OAM A;  2D7I A;  3DK5 A;  4KRV A;  2AM5 A;  3OH1 A;  5I1F A;  3JUK A;  1GX4 A;  2RJ1 A;  2RIX A;  1LL2 A;  1ON8 A;  1QWJ A;  1NF5 B;  4HCQ A;  4O6M A;  1FG5 N;  2OI6 A;  2VXL A;  1EYR A;  5JQQ A;  2FYC B;  4BQH A;  3I0D A;  4B2X A;  4CJC A;  3RSB A;  1OMZ A;  4DE7 A;  3LW6 A;  2O1G A;  3ST8 A;  1K4V A;  5C1L A;  2YCM A;  1HV9 A;  1IIM A;  3FWW A;  3Q4S A;  3U0X A;  3SXC A;  5C1H A;  3OGZ A;  1LZJ A;  3K8E A;  2J0A A;  2RJ6 A;  3OC9 A;  1XHB A;  5C3A A;  1G93 A;  1VGW A;  1VM8 A;  3OH4 A;  1VZT A;  5C3B A;  4B3U A;  3EE5 A;  2APC A;  2JCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...