1H5TA

Thymidylyltransferase complexed with thymidylyldiphosphate-glucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and Crystallographic Analyses Support a Sequential-Ordered Bi Bi Catalytic Mechanism for Escherichia Coli Glucose-1-Phosphate Thymidylyltransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 104
structure length 290
sequence length 290
chains with identical sequence C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5tA00
3PNNA 4HOCA 1S4NA 1LVWA 2YQSA 1FZWA 1H5TA 1H7FA 1ZJ2A 2X65A 4AYJA 2Y4KA 1MC3A 1KWSA 2FFUA 5HS2A 4EEOA 2VFZA 1PZYB 1FRWA 2FFVA 2CU2A 1YP3A 1MP3A 3I0HA 4FRMA 1NWGB 2WGZA 2E3DA 5CQMX 3R2WA 3SXBA 3SXGA 5C36A 4EVWA 1ON6A 3KIAA 2O1FA 2V0JA 4Y6NA 1E5KA 2W0VA 3SX8A 1ZJ0A 1H4DA 2RJ6A 3I0IX 3TQDA 1ZI3A 3BRKX 3I0DA 3DUVA 4FRBA 4Y7FA 4JISA 3HL3A 4BMAA 1FWYA 2VSIA 1H7QA 1JVDA 5FUHA 4C2SA 3CU0A 2FYBA 3E26A 2OI6A 5EJ1A 1HM0A 2Y4MA 4FRQA 4FRHA 4EEAA 3USRA 5C48A 4KC1A 3K8DA 4P00A 1LZIA 4FROA 1ZJPA 3Q80A 2VXLA 1NMMB 2BO7A 2RIYA 2OEFA 4KC4A 2RIXA 1FXOA 2OI7A 2OEGA 5C38A 3F1YA 5AJNA 1LL2A 5EIYA 5FV9A 4ZDQA 1S4OA 2X5ZA 1VH3A 2RJ5A 4NANA 4FRDA 1QGQA 4B2WA 1ZI1A 1ZDGA 1OMZA 4YS8A 3I0KA 4KNXA 5AJPA 4G87A 1NQIB 3OH3A 1ZI5A 1S4PA 4KQLA 2YC3A 1WVCA 1ZJOA 4B2XA 1QGSA 4CJCA 2YESA 3V8ZA 1ZHJA 4Y6UA 1HJLA 1IIMA 4Y62A 1NKHB 5C1GA 1FO8A 2WEEA 3OGZA 3I0GA 3QVBA 4B3UA 2RITA 3V0QA 5CQLX 1R7VA 1FOAA 1VPAA 2YCMA 1FR9A 4GBPA 3I0CA 4DE7A 1G93A 3R3IA 1HV9A 2JCKA 1PZTA 3GUEA 4KPZA 3TZTA 5CMIA 1R82A 3V91A 2P72A 3LW6A 2GGOA 2WAWA 2RJ7A 1LZ0A 3BCVA 3O3PA 2WVMA 4D11A 5C3DA 2VS4A 1R7YA 2Z87A 4Y7TA 2XMEA 2JCJA 1H5RB 4BQHA 2BO4A 1Z90A 4ARWA 1ZCVA 1ZCUA 2X60A 1ON8A 1G97A 5J49A 4M2AA 2AH9A 1TW1A 2VS3A 2X5SA 3F1CA 2FYAA 2QKXA 2WE9A 2PX7A 4MYBA 1SS9A 4Y9XA 2FY7A 1G23A 3SX7A 2V0KA 4EE4A 5JQQA 2BO6A 3SXCA 1VZUA 4FQWA 5AJOA 2PGYA 1G8OA 1H7EA 1R80A 4M2BA 4AC3A 3RMWA 3V0OA 1WSZA 3U2TA 2I7BA 2WVKA 5BXCA 4HO3A 4D48A 1QG8A 3JTJA 1TW5A 2XWNA 3ZGFA 3IOIA 1R7XA 3DJ4A 1INIA 3D5NA 1K4VA 5C47A 2Y4JA 5FTVA 4HO4A 3OC9A 3PKPA 2DPWA 1TVYA 2P6WA 3OAMA 3V0NA 1FGXA 2D7IA 4HO8A 2FYDB 4CJ8A 4AAWA 2O1HA 1G2VA 1QWJA 4B42A 1WT3A 2VS5A 1ZIZA 3T7MA 1FR8A 1JVGA 1V82A 2RJ0A 1HM9A 1JV1A 3K8EA 4LW3A 5CQNX 4Y63A 3FOQA 2Z86A 4FRLA 1LZ7A 2Y4LA 2BO8A 3U0YA 5CQPA 4EE5A 1H5SD 3I0LA 1NF5B 1VGUA 4KT7A 2Q4JA 4B5BA 3PKQA 4KC2A 5FU0A 2V0IA 3RMVA 1G95A 1VH1A 1JV3A 2ICXA 4P02A 4CJBA 2O1GA 5CMFX 5C49A 3SXAA 1O7QA 2RJ9A 5L6SA 2I5EA 3SPTA 2A8UA 1IINA 4NAKA 4B4BA 4E1KA 2QGIA 4ECMA 2VSHA 1R7TA 3IOHA 3SXDA 1EZIA 1VICA 1HJJA 1W57A 1WT1A 1JYKA 4D0TA 3D98A 1V83A 3JUJA 3RSBA 2Y7AA 5L6VA 1JYLA 4FRAA 4ASYA 4HO9A 4J18A 5I1FA 4M4KA 4M28A 4IRQA 4FRPA 4G3SA 4B4MA 3CKNA 2AE7A 3V8YA 3OH2A 5CMJA 2GGQA 1W55A 3U2XA 4Y7VA 3ZF8A 3ZLKA 3U2WA 3EE5A 2AM5A 3CKJA 1VM8A 4FREA 1GX4A 4HO5A 3IOJA 4AYLA 3T7NA 1WT2A 2VD4A 1FO9A 2E8BA 2ZU8A 2AM4A 2XWLA 1O7OA 3JUKA 2Y6PA 5FYEA 2P73A 1ZJ1A 1FXJA 4K6RA 2V0LA 1H5RA 1YP2A 4EEMA 1G3LA 5IDTA 3U2VA 2AGDA 2RJ1A 1ZI4A 1H7HA 1VGWA 1YROB 1O0RA 2PGVA 1G1LA 2YQHA 3SX5A 3E25A 3Q4SA 2D7RA 1H7TA 3N9WA 4HO2A 3V0LA 3USQA 4EEGA 5C4DA 2NXVA 1I52A 4L41C 1NHEB 3V0MA 1H3MA 1VGZA 4DECA 3POLA 1H5SC 3V90A 1R7UA 4EE3A 2ICYA 4G3PA 2MZBA 4FCUA 4NALA 2ZU7A 3V0PA 3DK5A 3D8VA 5C4CA 5IFYA 1O23B 1OMXA 2APCA 2RJ8A 2WVLA 3FWWA 5C1HA 3CKVA 1H7GA 5FU8A 1GQCA 3I0FA 1HM8A 1WT0A 5C4BA 1LZJA 2V0HA 3CGXA 1LL0A 4G3QA 1GWVA 4HCQA 2RIZA 2D0JA 3NGWA 4HG6A 4KPXA 4D0ZA 5DDVA 2YQJA 3I0JA 2XMHA 3CKQA 3OKRA 3ST8A 4D11C 5FTSA 4DDZA 5C3BA 1H5SB 4KNRA 4XWIA 4R7PA 3ZLLA 5CMGX 1FG5N 1MP5A 5C3AA 5EJZA 1G0RA 2AM3A 2W0WA 2FYCB 1INJA 2PA4A 4Y64A 1GA8A 4MNDA 1H5SA 1H4CA 4KRVA 4NAIA 4B4GA 4CVHA 4FCEA 1LL3A 1ZCYA 4UEGA 4KXOA 3OH1A 2VXMA 2A8WA 3I0EA 1H7LA 1ZJ3A 2AESA 2JCOA 1MP4A 3OH0A 4IRPA 4HO0A 3SXEA 3T7OA 1G9RA 2QH5A 4HO6A 3SX3A 3ZGGA 1VZXA 4ASJA 2I5KA 2XWMA 5CQOA 1OQMB 5C8RA 5CMHA 5C4FA 1VGTA 2AECA 1V84A 1H4EA 1GX0A 3U0XA 5C1LA 3U2UA 1EYRA 4LW6A 1XZ6A 1YP4A 2RJ4A 2JCLA 1R81A 1XHBA 2YC5A 2ZU9A 3CKOA 5C4EA 1H5TB 5DDTA 4Y7GA 1FGGA 1W77A 4JD0A 2OI5A 3Q7UA 1ZDFA 2YQCA 1GQ9A 5IDSA 2UX8A 3OH4A 1TZFA 1GWWA 1VZTA 1ZCTA 4Y7UA
chains in the Genus database with same CATH superfamily
3PNNA 4HOCA 1S4NA 1LVWA 2YQSA 1FZWA 1H5TA 1H7FA 1ZJ2A 2X65A 4AYJA 2Y4KA 1MC3A 1KWSA 2FFUA 5HS2A 4EEOA 2VFZA 1PZYB 1FRWA 2FFVA 2CU2A 1YP3A 1MP3A 3I0HA 4FRMA 1NWGB 2WGZA 2E3DA 5CQMX 3R2WA 3SXBA 3SXGA 5C36A 4EVWA 1ON6A 3KIAA 2O1FA 2V0JA 4Y6NA 1E5KA 2W0VA 3SX8A 1ZJ0A 1H4DA 2RJ6A 3I0IX 3TQDA 1ZI3A 3BRKX 3I0DA 3DUVA 4FRBA 4Y7FA 4JISA 3HL3A 4BMAA 1FWYA 2VSIA 1H7QA 1JVDA 5FUHA 4C2SA 3CU0A 2FYBA 3E26A 2OI6A 5EJ1A 1HM0A 2Y4MA 4FRQA 4FRHA 4EEAA 3USRA 5C48A 4KC1A 3K8DA 4P00A 1LZIA 4FIXA 4FROA 1ZJPA 3Q80A 2VXLA 1NMMB 2BO7A 2RIYA 2OEFA 4KC4A 2RIXA 1FXOA 2OI7A 2OEGA 5C38A 3F1YA 5AJNA 1LL2A 5EIYA 5FV9A 4ZDQA 1S4OA 2X5ZA 1VH3A 2RJ5A 4NANA 4FRDA 1QGQA 4B2WA 1ZI1A 1ZDGA 1OMZA 4YS8A 3I0KA 4KNXA 5AJPA 4G87A 1NQIB 3OH3A 1ZI5A 1S4PA 4KQLA 2YC3A 1WVCA 1ZJOA 4B2XA 1QGSA 4CJCA 2YESA 3V8ZA 1ZHJA 4Y6UA 1HJLA 1IIMA 4Y62A 1NKHB 5C1GA 1FO8A 2WEEA 3OGZA 3I0GA 3QVBA 4B3UA 2RITA 3V0QA 5CQLX 1R7VA 1FOAA 1VPAA 2YCMA 1FR9A 4GBPA 3I0CA 4DE7A 1G93A 3R3IA 1HV9A 2JCKA 1PZTA 3GUEA 4KPZA 3TZTA 5CMIA 1R82A 3V91A 2P72A 3LW6A 2GGOA 2WAWA 2RJ7A 1LZ0A 3BCVA 3O3PA 2C0NA 2WVMA 4D11A 5C3DA 2VS4A 1R7YA 2Z87A 4Y7TA 2XMEA 2JCJA 1H5RB 4BQHA 2BO4A 1Z90A 4ARWA 1ZCVA 1ZCUA 2X60A 1ON8A 1G97A 5J49A 4M2AA 2VK9A 2AH9A 1TW1A 2VS3A 2X5SA 3F1CA 2FYAA 2QKXA 2WE9A 2PX7A 4MYBA 1SS9A 4Y9XA 2FY7A 1G23A 3SX7A 2V0KA 4EE4A 5JQQA 2BO6A 3SXCA 1VZUA 4FQWA 5AJOA 2PGYA 1G8OA 1H7EA 1R80A 4M2BA 4AC3A 3RMWA 3V0OA 1WSZA 3U2TA 2I7BA 2WVKA 5BXCA 4HO3A 4D48A 1QG8A 3JTJA 1TW5A 2XWNA 3ZGFA 3IOIA 1R7XA 3DJ4A 1INIA 3D5NA 1K4VA 5C47A 2Y4JA 5FTVA 4HO4A 3OC9A 3PKPA 2DPWA 1TVYA 2P6WA 3OAMA 3V0NA 1FGXA 2D7IA 4HO8A 2FYDB 4CJ8A 4AAWA 2O1HA 1G2VA 1QWJA 4B42A 1WT3A 2VS5A 1ZIZA 3T7MA 1FR8A 1JVGA 1V82A 2RJ0A 1HM9A 1JV1A 3K8EA 4LW3A 5CQNX 4Y63A 3FOQA 2Z86A 4FRLA 1LZ7A 2Y4LA 2BO8A 3U0YA 5CQPA 4EE5A 1H5SD 3I0LA 1NF5B 1VGUA 4KT7A 2Q4JA 4B5BA 3PKQA 4KC2A 5FU0A 2V0IA 3RMVA 1G95A 1VH1A 1JV3A 2ICXA 4P02A 4CJBA 2O1GA 5CMFX 5C49A 3SXAA 1O7QA 4O6MA 2RJ9A 5L6SA 2I5EA 3SPTA 2A8UA 1IINA 4NAKA 4B4BA 4E1KA 2QGIA 4ECMA 2VSHA 1R7TA 3IOHA 3SXDA 1EZIA 1VICA 1HJJA 4O6NA 1W57A 1WT1A 1JYKA 4D0TA 3D98A 1V83A 3JUJA 3RSBA 2Y7AA 5L6VA 1JYLA 4FRAA 4ASYA 4HO9A 4J18A 5I1FA 4M4KA 4M28A 4IRQA 4FRPA 4G3SA 4B4MA 3CKNA 2AE7A 3V8YA 3OH2A 5CMJA 2GGQA 1W55A 3U2XA 4Y7VA 3ZF8A 3ZLKA 3U2WA 3EE5A 2AM5A 3CKJA 1VM8A 4FREA 1GX4A 4HO5A 3IOJA 4AYLA 3T7NA 4MIXA 1WT2A 2VD4A 1FO9A 2E8BA 2ZU8A 2AM4A 2XWLA 1O7OA 3JUKA 2Y6PA 5FYEA 2P73A 1ZJ1A 1FXJA 4K6RA 2V0LA 1H5RA 1YP2A 4EEMA 1G3LA 5IDTA 3U2VA 2AGDA 2RJ1A 1ZI4A 1H7HA 1VGWA 1YROB 1O0RA 2PGVA 1G1LA 2YQHA 3SX5A 3E25A 3Q4SA 2D7RA 1H7TA 3N9WA 4HO2A 3V0LA 3USQA 4EEGA 5C4DA 2NXVA 1I52A 4L41C 5D92A 1NHEB 3V0MA 1H3MA 1VGZA 4Q7CA 3POLA 1H5SC 4DECA 3V90A 1R7UA 4EE3A 2ICYA 4G3PA 2MZBA 4FCUA 4NALA 2ZU7A 3V0PA 3DK5A 3D8VA 5C4CA 5IFYA 1O23B 1OMXA 2APCA 2RJ8A 2WVLA 3FWWA 2J0AA 5C1HA 3CKVA 1H7GA 5FU8A 1GQCA 3I0FA 1HM8A 1WT0A 5C4BA 1LZJA 2V0HA 3CGXA 1LL0A 4G3QA 1GWVA 4HCQA 2RIZA 2D0JA 3NGWA 4HG6A 4KPXA 4D0ZA 2J0BA 5DDVA 2YQJA 3I0JA 2XMHA 3CKQA 3OKRA 3ST8A 4D11C 5FTSA 4DDZA 5C3BA 1H5SB 4KNRA 4XWIA 4R7PA 3ZLLA 5CMGX 1FG5N 1MP5A 5C3AA 5EJZA 1G0RA 2AM3A 2W0WA 2FYCB 1INJA 2PA4A 4Y64A 1GA8A 4MNDA 1H5SA 1H4CA 4KRVA 4NAIA 4B4GA 4CVHA 4FCEA 1LL3A 1ZCYA 4UEGA 4KXOA 3OH1A 2VXMA 2A8WA 3I0EA 1H7LA 1ZJ3A 2AESA 4FIYA 2JCOA 1MP4A 3OH0A 4IRPA 4HO0A 3SXEA 3T7OA 1G9RA 2QH5A 4HO6A 3SX3A 3ZGGA 1VZXA 4ASJA 5D91A 2I5KA 2XWMA 5CQOA 1OQMB 5C8RA 5CMHA 5C4FA 1VGTA 2AECA 1V84A 1H4EA 1GX0A 3U0XA 5C1LA 3U2UA 1EYRA 4LW6A 1XZ6A 1YP4A 2RJ4A 2JCLA 1R81A 1XHBA 2YC5A 2ZU9A 3CKOA 5C4EA 1H5TB 5DDTA 4Y7GA 1FGGA 1W77A 4JD0A 2OI5A 3Q7UA 1ZDFA 2YQCA 1GQ9A 5IDSA 2UX8A 3OH4A 1TZFA 1GWWA 1VZTA 1ZCTA 4Y7UA
chains in the Genus database with same CATH topology
3PNNA 4HOCA 1S4NA 1LVWA 2YQSA 1FZWA 1H5TA 1H7FA 1ZJ2A 2X65A 4AYJA 2Y4KA 1MC3A 1KWSA 2FFUA 5HS2A 4EEOA 2VFZA 1PZYB 1FRWA 2FFVA 2CU2A 1YP3A 1MP3A 3I0HA 4FRMA 1NWGB 2WGZA 2E3DA 5CQMX 3R2WA 3SXBA 3SXGA 5C36A 4EVWA 1ON6A 3KIAA 2O1FA 2V0JA 4Y6NA 1E5KA 2W0VA 3SX8A 1ZJ0A 1H4DA 2RJ6A 3I0IX 3TQDA 1ZI3A 3BRKX 3I0DA 3DUVA 4FRBA 4Y7FA 4JISA 3HL3A 4BMAA 1FWYA 2VSIA 1H7QA 1JVDA 5FUHA 4C2SA 3CU0A 2FYBA 3E26A 2OI6A 5EJ1A 1HM0A 2Y4MA 4FRQA 4FRHA 4EEAA 3USRA 5C48A 4KC1A 3K8DA 4P00A 1LZIA 4FIXA 4FROA 1ZJPA 3Q80A 2VXLA 1NMMB 2BO7A 2RIYA 2OEFA 4KC4A 2RIXA 1FXOA 2OI7A 2OEGA 5C38A 3F1YA 5AJNA 1LL2A 5EIYA 5FV9A 4ZDQA 1S4OA 2X5ZA 1VH3A 2RJ5A 4NANA 4FRDA 1QGQA 4B2WA 1ZI1A 1ZDGA 1OMZA 4YS8A 3I0KA 4KNXA 5AJPA 4G87A 1NQIB 3OH3A 1ZI5A 1S4PA 4KQLA 2YC3A 1WVCA 1ZJOA 4B2XA 1QGSA 4CJCA 2YESA 3V8ZA 1ZHJA 4Y6UA 1HJLA 1IIMA 4Y62A 1NKHB 5C1GA 1FO8A 2WEEA 3OGZA 3I0GA 3QVBA 4B3UA 2RITA 3V0QA 5CQLX 1R7VA 1FOAA 1VPAA 2YCMA 1FR9A 4GBPA 3I0CA 4DE7A 1G93A 3R3IA 1HV9A 2JCKA 1PZTA 3GUEA 4KPZA 3TZTA 5CMIA 1R82A 3V91A 2P72A 3LW6A 2GGOA 2WAWA 2RJ7A 1LZ0A 3BCVA 3O3PA 2C0NA 2WVMA 4D11A 5C3DA 2VS4A 1R7YA 2Z87A 4Y7TA 2XMEA 2JCJA 1H5RB 4BQHA 2BO4A 1Z90A 4ARWA 1ZCVA 1ZCUA 2X60A 1ON8A 1G97A 5J49A 4M2AA 2VK9A 2AH9A 1TW1A 2VS3A 2X5SA 3F1CA 2FYAA 2QKXA 2WE9A 2PX7A 4MYBA 1SS9A 4Y9XA 2FY7A 1G23A 3SX7A 2V0KA 4EE4A 5JQQA 2BO6A 3SXCA 1VZUA 4FQWA 5AJOA 2PGYA 1G8OA 1H7EA 1R80A 4M2BA 4AC3A 3RMWA 3V0OA 1WSZA 3U2TA 2I7BA 2WVKA 5BXCA 4HO3A 4D48A 1QG8A 3JTJA 1TW5A 2XWNA 3ZGFA 3IOIA 1R7XA 3DJ4A 1INIA 3D5NA 1K4VA 5C47A 2Y4JA 5FTVA 4HO4A 3OC9A 3PKPA 2DPWA 1TVYA 2P6WA 3OAMA 3V0NA 1FGXA 2D7IA 4HO8A 2FYDB 4CJ8A 4AAWA 2O1HA 1G2VA 1QWJA 4B42A 1WT3A 2VS5A 1ZIZA 3T7MA 1FR8A 1JVGA 1V82A 2RJ0A 1HM9A 1JV1A 3K8EA 4LW3A 5CQNX 4Y63A 3FOQA 2Z86A 4FRLA 1LZ7A 2Y4LA 2BO8A 3U0YA 5CQPA 4EE5A 1H5SD 3I0LA 1NF5B 1VGUA 4KT7A 2Q4JA 4B5BA 3PKQA 4KC2A 5FU0A 2V0IA 3RMVA 1G95A 1VH1A 1JV3A 2ICXA 4P02A 4CJBA 2O1GA 5CMFX 5C49A 3SXAA 1O7QA 4O6MA 2RJ9A 5L6SA 2I5EA 3SPTA 2A8UA 1IINA 4NAKA 4B4BA 4E1KA 2QGIA 4ECMA 2VSHA 1R7TA 3IOHA 3SXDA 1EZIA 1VICA 1HJJA 4O6NA 1W57A 1WT1A 1JYKA 4D0TA 3D98A 1V83A 3JUJA 3RSBA 2Y7AA 5L6VA 1JYLA 4FRAA 4ASYA 4HO9A 4J18A 5I1FA 4M4KA 4M28A 4IRQA 4FRPA 4G3SA 4B4MA 3CKNA 2AE7A 3V8YA 3OH2A 5CMJA 2GGQA 1W55A 3U2XA 4Y7VA 3ZF8A 3ZLKA 3U2WA 3EE5A 2AM5A 3CKJA 1VM8A 4FREA 1GX4A 4HO5A 3IOJA 4AYLA 3T7NA 4MIXA 1WT2A 2VD4A 1FO9A 2E8BA 2ZU8A 2AM4A 2XWLA 1O7OA 3JUKA 2Y6PA 5FYEA 2P73A 1ZJ1A 1FXJA 4K6RA 2V0LA 1H5RA 1YP2A 4EEMA 1G3LA 5IDTA 3U2VA 2AGDA 2RJ1A 1ZI4A 1H7HA 1VGWA 1YROB 1O0RA 2PGVA 1G1LA 2YQHA 3SX5A 3E25A 3Q4SA 2D7RA 1H7TA 3N9WA 4HO2A 3V0LA 3USQA 4EEGA 5C4DA 2NXVA 1I52A 4L41C 5D92A 1NHEB 3V0MA 1H3MA 1VGZA 4Q7CA 3POLA 1H5SC 4DECA 3V90A 1R7UA 4EE3A 2ICYA 4G3PA 2MZBA 4FCUA 4NALA 2ZU7A 3V0PA 3DK5A 3D8VA 5C4CA 5IFYA 1O23B 1OMXA 2APCA 2RJ8A 2WVLA 3FWWA 2J0AA 5C1HA 3CKVA 1H7GA 5FU8A 1GQCA 3I0FA 1HM8A 1WT0A 5C4BA 1LZJA 2V0HA 3CGXA 1LL0A 4G3QA 1GWVA 4HCQA 2RIZA 2D0JA 3NGWA 4HG6A 4KPXA 4D0ZA 2J0BA 5DDVA 2YQJA 3I0JA 2XMHA 3CKQA 3OKRA 3ST8A 4D11C 5FTSA 4DDZA 5C3BA 1H5SB 4KNRA 4XWIA 4R7PA 3ZLLA 5CMGX 1FG5N 1MP5A 5C3AA 5EJZA 1G0RA 2AM3A 2W0WA 2FYCB 1INJA 2PA4A 4Y64A 1GA8A 4MNDA 1H5SA 1H4CA 4KRVA 4NAIA 4B4GA 4CVHA 4FCEA 1LL3A 1ZCYA 4UEGA 4KXOA 3OH1A 2VXMA 2A8WA 3I0EA 1H7LA 1ZJ3A 2AESA 4FIYA 2JCOA 1MP4A 3OH0A 4IRPA 4HO0A 3SXEA 3T7OA 1G9RA 2QH5A 4HO6A 3SX3A 3ZGGA 1VZXA 4ASJA 5D91A 2I5KA 2XWMA 5CQOA 1OQMB 5C8RA 5CMHA 5C4FA 1VGTA 2AECA 1V84A 1H4EA 1GX0A 3U0XA 5C1LA 3U2UA 1EYRA 4LW6A 1XZ6A 1YP4A 2RJ4A 2JCLA 1R81A 1XHBA 2YC5A 2ZU9A 3CKOA 5C4EA 1H5TB 5DDTA 4Y7GA 1FGGA 1W77A 4JD0A 2OI5A 3Q7UA 1ZDFA 2YQCA 1GQ9A 5IDSA 2UX8A 3OH4A 1TZFA 1GWWA 1VZTA 1ZCTA 4Y7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNN A;  4HOC A;  1S4N A;  1LVW A;  2YQS A;  1FZW A;  1H5T A;  1H7F A;  1ZJ2 A;  2X65 A;  4AYJ A;  2Y4K A;  1MC3 A;  1KWS A;  2FFU A;  5HS2 A;  4EEO A;  2VFZ A;  1PZY B;  1FRW A;  2FFV A;  2CU2 A;  1YP3 A;  1MP3 A;  3I0H A;  4FRM A;  1NWG B;  2WGZ A;  2E3D A;  5CQM X;  3R2W A;  3SXB A;  3SXG A;  5C36 A;  4EVW A;  1ON6 A;  3KIA A;  2O1F A;  2V0J A;  4Y6N A;  1E5K A;  2W0V A;  3SX8 A;  1ZJ0 A;  1H4D A;  2RJ6 A;  3I0I X;  3TQD A;  1ZI3 A;  3BRK X;  3I0D A;  3DUV A;  4FRB A;  4Y7F A;  4JIS A;  3HL3 A;  4BMA A;  1FWY A;  2VSI A;  1H7Q A;  1JVD A;  5FUH A;  4C2S A;  3CU0 A;  2FYB A;  3E26 A;  2OI6 A;  5EJ1 A;  1HM0 A;  2Y4M A;  4FRQ A;  4FRH A;  4EEA A;  3USR A;  5C48 A;  4KC1 A;  3K8D A;  4P00 A;  1LZI A;  4FRO A;  1ZJP A;  3Q80 A;  2VXL A;  1NMM B;  2BO7 A;  2RIY A;  2OEF A;  4KC4 A;  2RIX A;  1FXO A;  2OI7 A;  2OEG A;  5C38 A;  3F1Y A;  5AJN A;  1LL2 A;  5EIY A;  5FV9 A;  4ZDQ A;  1S4O A;  2X5Z A;  1VH3 A;  2RJ5 A;  4NAN A;  4FRD A;  1QGQ A;  4B2W A;  1ZI1 A;  1ZDG A;  1OMZ A;  4YS8 A;  3I0K A;  4KNX A;  5AJP A;  4G87 A;  1NQI B;  3OH3 A;  1ZI5 A;  1S4P A;  4KQL A;  2YC3 A;  1WVC A;  1ZJO A;  4B2X A;  1QGS A;  4CJC A;  2YES A;  3V8Z A;  1ZHJ A;  4Y6U A;  1HJL A;  1IIM A;  4Y62 A;  1NKH B;  5C1G A;  1FO8 A;  2WEE A;  3OGZ A;  3I0G A;  3QVB A;  4B3U A;  2RIT A;  3V0Q A;  5CQL X;  1R7V A;  1FOA A;  1VPA A;  2YCM A;  1FR9 A;  4GBP A;  3I0C A;  4DE7 A;  1G93 A;  3R3I A;  1HV9 A;  2JCK A;  1PZT A;  3GUE A;  4KPZ A;  3TZT A;  5CMI A;  1R82 A;  3V91 A;  2P72 A;  3LW6 A;  2GGO A;  2WAW A;  2RJ7 A;  1LZ0 A;  3BCV A;  3O3P A;  2WVM A;  4D11 A;  5C3D A;  2VS4 A;  1R7Y A;  2Z87 A;  4Y7T A;  2XME A;  2JCJ A;  1H5R B;  4BQH A;  2BO4 A;  1Z90 A;  4ARW A;  1ZCV A;  1ZCU A;  2X60 A;  1ON8 A;  1G97 A;  5J49 A;  4M2A A;  2AH9 A;  1TW1 A;  2VS3 A;  2X5S A;  3F1C A;  2FYA A;  2QKX A;  2WE9 A;  2PX7 A;  4MYB A;  1SS9 A;  4Y9X A;  2FY7 A;  1G23 A;  3SX7 A;  2V0K A;  4EE4 A;  5JQQ A;  2BO6 A;  3SXC A;  1VZU A;  4FQW A;  5AJO A;  2PGY A;  1G8O A;  1H7E A;  1R80 A;  4M2B A;  4AC3 A;  3RMW A;  3V0O A;  1WSZ A;  3U2T A;  2I7B A;  2WVK A;  5BXC A;  4HO3 A;  4D48 A;  1QG8 A;  3JTJ A;  1TW5 A;  2XWN A;  3ZGF A;  3IOI A;  1R7X A;  3DJ4 A;  1INI A;  3D5N A;  1K4V A;  5C47 A;  2Y4J A;  5FTV A;  4HO4 A;  3OC9 A;  3PKP A;  2DPW A;  1TVY A;  2P6W A;  3OAM A;  3V0N A;  1FGX A;  2D7I A;  4HO8 A;  2FYD B;  4CJ8 A;  4AAW A;  2O1H A;  1G2V A;  1QWJ A;  4B42 A;  1WT3 A;  2VS5 A;  1ZIZ A;  3T7M A;  1FR8 A;  1JVG A;  1V82 A;  2RJ0 A;  1HM9 A;  1JV1 A;  3K8E A;  4LW3 A;  5CQN X;  4Y63 A;  3FOQ A;  2Z86 A;  4FRL A;  1LZ7 A;  2Y4L A;  2BO8 A;  3U0Y A;  5CQP A;  4EE5 A;  1H5S D;  3I0L A;  1NF5 B;  1VGU A;  4KT7 A;  2Q4J A;  4B5B A;  3PKQ A;  4KC2 A;  5FU0 A;  2V0I A;  3RMV A;  1G95 A;  1VH1 A;  1JV3 A;  2ICX A;  4P02 A;  4CJB A;  2O1G A;  5CMF X;  5C49 A;  3SXA A;  1O7Q A;  2RJ9 A;  5L6S A;  2I5E A;  3SPT A;  2A8U A;  1IIN A;  4NAK A;  4B4B A;  4E1K A;  2QGI A;  4ECM A;  2VSH A;  1R7T A;  3IOH A;  3SXD A;  1EZI A;  1VIC A;  1HJJ A;  1W57 A;  1WT1 A;  1JYK A;  4D0T A;  3D98 A;  1V83 A;  3JUJ A;  3RSB A;  2Y7A A;  5L6V A;  1JYL A;  4FRA A;  4ASY A;  4HO9 A;  4J18 A;  5I1F A;  4M4K A;  4M28 A;  4IRQ A;  4FRP A;  4G3S A;  4B4M A;  3CKN A;  2AE7 A;  3V8Y A;  3OH2 A;  5CMJ A;  2GGQ A;  1W55 A;  3U2X A;  4Y7V A;  3ZF8 A;  3ZLK A;  3U2W A;  3EE5 A;  2AM5 A;  3CKJ A;  1VM8 A;  4FRE A;  1GX4 A;  4HO5 A;  3IOJ A;  4AYL A;  3T7N A;  1WT2 A;  2VD4 A;  1FO9 A;  2E8B A;  2ZU8 A;  2AM4 A;  2XWL A;  1O7O A;  3JUK A;  2Y6P A;  5FYE A;  2P73 A;  1ZJ1 A;  1FXJ A;  4K6R A;  2V0L A;  1H5R A;  1YP2 A;  4EEM A;  1G3L A;  5IDT A;  3U2V A;  2AGD A;  2RJ1 A;  1ZI4 A;  1H7H A;  1VGW A;  1YRO B;  1O0R A;  2PGV A;  1G1L A;  2YQH A;  3SX5 A;  3E25 A;  3Q4S A;  2D7R A;  1H7T A;  3N9W A;  4HO2 A;  3V0L A;  3USQ A;  4EEG A;  5C4D A;  2NXV A;  1I52 A;  4L41 C;  1NHE B;  3V0M A;  1H3M A;  1VGZ A;  4DEC A;  3POL A;  1H5S C;  3V90 A;  1R7U A;  4EE3 A;  2ICY A;  4G3P A;  2MZB A;  4FCU A;  4NAL A;  2ZU7 A;  3V0P A;  3DK5 A;  3D8V A;  5C4C A;  5IFY A;  1O23 B;  1OMX A;  2APC A;  2RJ8 A;  2WVL A;  3FWW A;  5C1H A;  3CKV A;  1H7G A;  5FU8 A;  1GQC A;  3I0F A;  1HM8 A;  1WT0 A;  5C4B A;  1LZJ A;  2V0H A;  3CGX A;  1LL0 A;  4G3Q A;  1GWV A;  4HCQ A;  2RIZ A;  2D0J A;  3NGW A;  4HG6 A;  4KPX A;  4D0Z A;  5DDV A;  2YQJ A;  3I0J A;  2XMH A;  3CKQ A;  3OKR A;  3ST8 A;  4D11 C;  5FTS A;  4DDZ A;  5C3B A;  1H5S B;  4KNR A;  4XWI A;  4R7P A;  3ZLL A;  5CMG X;  1FG5 N;  1MP5 A;  5C3A A;  5EJZ A;  1G0R A;  2AM3 A;  2W0W A;  2FYC B;  1INJ A;  2PA4 A;  4Y64 A;  1GA8 A;  4MND A;  1H5S A;  1H4C A;  4KRV A;  4NAI A;  4B4G A;  4CVH A;  4FCE A;  1LL3 A;  1ZCY A;  4UEG A;  4KXO A;  3OH1 A;  2VXM A;  2A8W A;  3I0E A;  1H7L A;  1ZJ3 A;  2AES A;  2JCO A;  1MP4 A;  3OH0 A;  4IRP A;  4HO0 A;  3SXE A;  3T7O A;  1G9R A;  2QH5 A;  4HO6 A;  3SX3 A;  3ZGG A;  1VZX A;  4ASJ A;  2I5K A;  2XWM A;  5CQO A;  1OQM B;  5C8R A;  5CMH A;  5C4F A;  1VGT A;  2AEC A;  1V84 A;  1H4E A;  1GX0 A;  3U0X A;  5C1L A;  3U2U A;  1EYR A;  4LW6 A;  1XZ6 A;  1YP4 A;  2RJ4 A;  2JCL A;  1R81 A;  1XHB A;  2YC5 A;  2ZU9 A;  3CKO A;  5C4E A;  1H5T B;  5DDT A;  4Y7G A;  1FGG A;  1W77 A;  4JD0 A;  2OI5 A;  3Q7U A;  1ZDF A;  2YQC A;  1GQ9 A;  5IDS A;  2UX8 A;  3OH4 A;  1TZF A;  1GWW A;  1VZT A;  1ZCT A;  4Y7U A; 
#chains in the Genus database with same CATH topology
 3PNN A;  4HOC A;  1S4N A;  1LVW A;  2YQS A;  1FZW A;  1H5T A;  1H7F A;  1ZJ2 A;  2X65 A;  4AYJ A;  2Y4K A;  1MC3 A;  1KWS A;  2FFU A;  5HS2 A;  4EEO A;  2VFZ A;  1PZY B;  1FRW A;  2FFV A;  2CU2 A;  1YP3 A;  1MP3 A;  3I0H A;  4FRM A;  1NWG B;  2WGZ A;  2E3D A;  5CQM X;  3R2W A;  3SXB A;  3SXG A;  5C36 A;  4EVW A;  1ON6 A;  3KIA A;  2O1F A;  2V0J A;  4Y6N A;  1E5K A;  2W0V A;  3SX8 A;  1ZJ0 A;  1H4D A;  2RJ6 A;  3I0I X;  3TQD A;  1ZI3 A;  3BRK X;  3I0D A;  3DUV A;  4FRB A;  4Y7F A;  4JIS A;  3HL3 A;  4BMA A;  1FWY A;  2VSI A;  1H7Q A;  1JVD A;  5FUH A;  4C2S A;  3CU0 A;  2FYB A;  3E26 A;  2OI6 A;  5EJ1 A;  1HM0 A;  2Y4M A;  4FRQ A;  4FRH A;  4EEA A;  3USR A;  5C48 A;  4KC1 A;  3K8D A;  4P00 A;  1LZI A;  4FIX A;  4FRO A;  1ZJP A;  3Q80 A;  2VXL A;  1NMM B;  2BO7 A;  2RIY A;  2OEF A;  4KC4 A;  2RIX A;  1FXO A;  2OI7 A;  2OEG A;  5C38 A;  3F1Y A;  5AJN A;  1LL2 A;  5EIY A;  5FV9 A;  4ZDQ A;  1S4O A;  2X5Z A;  1VH3 A;  2RJ5 A;  4NAN A;  4FRD A;  1QGQ A;  4B2W A;  1ZI1 A;  1ZDG A;  1OMZ A;  4YS8 A;  3I0K A;  4KNX A;  5AJP A;  4G87 A;  1NQI B;  3OH3 A;  1ZI5 A;  1S4P A;  4KQL A;  2YC3 A;  1WVC A;  1ZJO A;  4B2X A;  1QGS A;  4CJC A;  2YES A;  3V8Z A;  1ZHJ A;  4Y6U A;  1HJL A;  1IIM A;  4Y62 A;  1NKH B;  5C1G A;  1FO8 A;  2WEE A;  3OGZ A;  3I0G A;  3QVB A;  4B3U A;  2RIT A;  3V0Q A;  5CQL X;  1R7V A;  1FOA A;  1VPA A;  2YCM A;  1FR9 A;  4GBP A;  3I0C A;  4DE7 A;  1G93 A;  3R3I A;  1HV9 A;  2JCK A;  1PZT A;  3GUE A;  4KPZ A;  3TZT A;  5CMI A;  1R82 A;  3V91 A;  2P72 A;  3LW6 A;  2GGO A;  2WAW A;  2RJ7 A;  1LZ0 A;  3BCV A;  3O3P A;  2C0N A;  2WVM A;  4D11 A;  5C3D A;  2VS4 A;  1R7Y A;  2Z87 A;  4Y7T A;  2XME A;  2JCJ A;  1H5R B;  4BQH A;  2BO4 A;  1Z90 A;  4ARW A;  1ZCV A;  1ZCU A;  2X60 A;  1ON8 A;  1G97 A;  5J49 A;  4M2A A;  2VK9 A;  2AH9 A;  1TW1 A;  2VS3 A;  2X5S A;  3F1C A;  2FYA A;  2QKX A;  2WE9 A;  2PX7 A;  4MYB A;  1SS9 A;  4Y9X A;  2FY7 A;  1G23 A;  3SX7 A;  2V0K A;  4EE4 A;  5JQQ A;  2BO6 A;  3SXC A;  1VZU A;  4FQW A;  5AJO A;  2PGY A;  1G8O A;  1H7E A;  1R80 A;  4M2B A;  4AC3 A;  3RMW A;  3V0O A;  1WSZ A;  3U2T A;  2I7B A;  2WVK A;  5BXC A;  4HO3 A;  4D48 A;  1QG8 A;  3JTJ A;  1TW5 A;  2XWN A;  3ZGF A;  3IOI A;  1R7X A;  3DJ4 A;  1INI A;  3D5N A;  1K4V A;  5C47 A;  2Y4J A;  5FTV A;  4HO4 A;  3OC9 A;  3PKP A;  2DPW A;  1TVY A;  2P6W A;  3OAM A;  3V0N A;  1FGX A;  2D7I A;  4HO8 A;  2FYD B;  4CJ8 A;  4AAW A;  2O1H A;  1G2V A;  1QWJ A;  4B42 A;  1WT3 A;  2VS5 A;  1ZIZ A;  3T7M A;  1FR8 A;  1JVG A;  1V82 A;  2RJ0 A;  1HM9 A;  1JV1 A;  3K8E A;  4LW3 A;  5CQN X;  4Y63 A;  3FOQ A;  2Z86 A;  4FRL A;  1LZ7 A;  2Y4L A;  2BO8 A;  3U0Y A;  5CQP A;  4EE5 A;  1H5S D;  3I0L A;  1NF5 B;  1VGU A;  4KT7 A;  2Q4J A;  4B5B A;  3PKQ A;  4KC2 A;  5FU0 A;  2V0I A;  3RMV A;  1G95 A;  1VH1 A;  1JV3 A;  2ICX A;  4P02 A;  4CJB A;  2O1G A;  5CMF X;  5C49 A;  3SXA A;  1O7Q A;  4O6M A;  2RJ9 A;  5L6S A;  2I5E A;  3SPT A;  2A8U A;  1IIN A;  4NAK A;  4B4B A;  4E1K A;  2QGI A;  4ECM A;  2VSH A;  1R7T A;  3IOH A;  3SXD A;  1EZI A;  1VIC A;  1HJJ A;  4O6N A;  1W57 A;  1WT1 A;  1JYK A;  4D0T A;  3D98 A;  1V83 A;  3JUJ A;  3RSB A;  2Y7A A;  5L6V A;  1JYL A;  4FRA A;  4ASY A;  4HO9 A;  4J18 A;  5I1F A;  4M4K A;  4M28 A;  4IRQ A;  4FRP A;  4G3S A;  4B4M A;  3CKN A;  2AE7 A;  3V8Y A;  3OH2 A;  5CMJ A;  2GGQ A;  1W55 A;  3U2X A;  4Y7V A;  3ZF8 A;  3ZLK A;  3U2W A;  3EE5 A;  2AM5 A;  3CKJ A;  1VM8 A;  4FRE A;  1GX4 A;  4HO5 A;  3IOJ A;  4AYL A;  3T7N A;  4MIX A;  1WT2 A;  2VD4 A;  1FO9 A;  2E8B A;  2ZU8 A;  2AM4 A;  2XWL A;  1O7O A;  3JUK A;  2Y6P A;  5FYE A;  2P73 A;  1ZJ1 A;  1FXJ A;  4K6R A;  2V0L A;  1H5R A;  1YP2 A;  4EEM A;  1G3L A;  5IDT A;  3U2V A;  2AGD A;  2RJ1 A;  1ZI4 A;  1H7H A;  1VGW A;  1YRO B;  1O0R A;  2PGV A;  1G1L A;  2YQH A;  3SX5 A;  3E25 A;  3Q4S A;  2D7R A;  1H7T A;  3N9W A;  4HO2 A;  3V0L A;  3USQ A;  4EEG A;  5C4D A;  2NXV A;  1I52 A;  4L41 C;  5D92 A;  1NHE B;  3V0M A;  1H3M A;  1VGZ A;  4Q7C A;  3POL A;  1H5S C;  4DEC A;  3V90 A;  1R7U A;  4EE3 A;  2ICY A;  4G3P A;  2MZB A;  4FCU A;  4NAL A;  2ZU7 A;  3V0P A;  3DK5 A;  3D8V A;  5C4C A;  5IFY A;  1O23 B;  1OMX A;  2APC A;  2RJ8 A;  2WVL A;  3FWW A;  2J0A A;  5C1H A;  3CKV A;  1H7G A;  5FU8 A;  1GQC A;  3I0F A;  1HM8 A;  1WT0 A;  5C4B A;  1LZJ A;  2V0H A;  3CGX A;  1LL0 A;  4G3Q A;  1GWV A;  4HCQ A;  2RIZ A;  2D0J A;  3NGW A;  4HG6 A;  4KPX A;  4D0Z A;  2J0B A;  5DDV A;  2YQJ A;  3I0J A;  2XMH A;  3CKQ A;  3OKR A;  3ST8 A;  4D11 C;  5FTS A;  4DDZ A;  5C3B A;  1H5S B;  4KNR A;  4XWI A;  4R7P A;  3ZLL A;  5CMG X;  1FG5 N;  1MP5 A;  5C3A A;  5EJZ A;  1G0R A;  2AM3 A;  2W0W A;  2FYC B;  1INJ A;  2PA4 A;  4Y64 A;  1GA8 A;  4MND A;  1H5S A;  1H4C A;  4KRV A;  4NAI A;  4B4G A;  4CVH A;  4FCE A;  1LL3 A;  1ZCY A;  4UEG A;  4KXO A;  3OH1 A;  2VXM A;  2A8W A;  3I0E A;  1H7L A;  1ZJ3 A;  2AES A;  4FIY A;  2JCO A;  1MP4 A;  3OH0 A;  4IRP A;  4HO0 A;  3SXE A;  3T7O A;  1G9R A;  2QH5 A;  4HO6 A;  3SX3 A;  3ZGG A;  1VZX A;  4ASJ A;  5D91 A;  2I5K A;  2XWM A;  5CQO A;  1OQM B;  5C8R A;  5CMH A;  5C4F A;  1VGT A;  2AEC A;  1V84 A;  1H4E A;  1GX0 A;  3U0X A;  5C1L A;  3U2U A;  1EYR A;  4LW6 A;  1XZ6 A;  1YP4 A;  2RJ4 A;  2JCL A;  1R81 A;  1XHB A;  2YC5 A;  2ZU9 A;  3CKO A;  5C4E A;  1H5T B;  5DDT A;  4Y7G A;  1FGG A;  1W77 A;  4JD0 A;  2OI5 A;  3Q7U A;  1ZDF A;  2YQC A;  1GQ9 A;  5IDS A;  2UX8 A;  3OH4 A;  1TZF A;  1GWW A;  1VZT A;  1ZCT A;  4Y7U A; 
#chains in the Genus database with same CATH homology
 3PNN A;  4HOC A;  1S4N A;  1LVW A;  2YQS A;  1FZW A;  1H5T A;  1H7F A;  1ZJ2 A;  2X65 A;  4AYJ A;  2Y4K A;  1MC3 A;  1KWS A;  2FFU A;  5HS2 A;  4EEO A;  2VFZ A;  1PZY B;  1FRW A;  2FFV A;  2CU2 A;  1YP3 A;  1MP3 A;  3I0H A;  4FRM A;  1NWG B;  2WGZ A;  2E3D A;  5CQM X;  3R2W A;  3SXB A;  3SXG A;  5C36 A;  4EVW A;  1ON6 A;  3KIA A;  2O1F A;  2V0J A;  4Y6N A;  1E5K A;  2W0V A;  3SX8 A;  1ZJ0 A;  1H4D A;  2RJ6 A;  3I0I X;  3TQD A;  1ZI3 A;  3BRK X;  3I0D A;  3DUV A;  4FRB A;  4Y7F A;  4JIS A;  3HL3 A;  4BMA A;  1FWY A;  2VSI A;  1H7Q A;  1JVD A;  5FUH A;  4C2S A;  3CU0 A;  2FYB A;  3E26 A;  2OI6 A;  5EJ1 A;  1HM0 A;  2Y4M A;  4FRQ A;  4FRH A;  4EEA A;  3USR A;  5C48 A;  4KC1 A;  3K8D A;  4P00 A;  1LZI A;  4FIX A;  4FRO A;  1ZJP A;  3Q80 A;  2VXL A;  1NMM B;  2BO7 A;  2RIY A;  2OEF A;  4KC4 A;  2RIX A;  1FXO A;  2OI7 A;  2OEG A;  5C38 A;  3F1Y A;  5AJN A;  1LL2 A;  5EIY A;  5FV9 A;  4ZDQ A;  1S4O A;  2X5Z A;  1VH3 A;  2RJ5 A;  4NAN A;  4FRD A;  1QGQ A;  4B2W A;  1ZI1 A;  1ZDG A;  1OMZ A;  4YS8 A;  3I0K A;  4KNX A;  5AJP A;  4G87 A;  1NQI B;  3OH3 A;  1ZI5 A;  1S4P A;  4KQL A;  2YC3 A;  1WVC A;  1ZJO A;  4B2X A;  1QGS A;  4CJC A;  2YES A;  3V8Z A;  1ZHJ A;  4Y6U A;  1HJL A;  1IIM A;  4Y62 A;  1NKH B;  5C1G A;  1FO8 A;  2WEE A;  3OGZ A;  3I0G A;  3QVB A;  4B3U A;  2RIT A;  3V0Q A;  5CQL X;  1R7V A;  1FOA A;  1VPA A;  2YCM A;  1FR9 A;  4GBP A;  3I0C A;  4DE7 A;  1G93 A;  3R3I A;  1HV9 A;  2JCK A;  1PZT A;  3GUE A;  4KPZ A;  3TZT A;  5CMI A;  1R82 A;  3V91 A;  2P72 A;  3LW6 A;  2GGO A;  2WAW A;  2RJ7 A;  1LZ0 A;  3BCV A;  3O3P A;  2C0N A;  2WVM A;  4D11 A;  5C3D A;  2VS4 A;  1R7Y A;  2Z87 A;  4Y7T A;  2XME A;  2JCJ A;  1H5R B;  4BQH A;  2BO4 A;  1Z90 A;  4ARW A;  1ZCV A;  1ZCU A;  2X60 A;  1ON8 A;  1G97 A;  5J49 A;  4M2A A;  2VK9 A;  2AH9 A;  1TW1 A;  2VS3 A;  2X5S A;  3F1C A;  2FYA A;  2QKX A;  2WE9 A;  2PX7 A;  4MYB A;  1SS9 A;  4Y9X A;  2FY7 A;  1G23 A;  3SX7 A;  2V0K A;  4EE4 A;  5JQQ A;  2BO6 A;  3SXC A;  1VZU A;  4FQW A;  5AJO A;  2PGY A;  1G8O A;  1H7E A;  1R80 A;  4M2B A;  4AC3 A;  3RMW A;  3V0O A;  1WSZ A;  3U2T A;  2I7B A;  2WVK A;  5BXC A;  4HO3 A;  4D48 A;  1QG8 A;  3JTJ A;  1TW5 A;  2XWN A;  3ZGF A;  3IOI A;  1R7X A;  3DJ4 A;  1INI A;  3D5N A;  1K4V A;  5C47 A;  2Y4J A;  5FTV A;  4HO4 A;  3OC9 A;  3PKP A;  2DPW A;  1TVY A;  2P6W A;  3OAM A;  3V0N A;  1FGX A;  2D7I A;  4HO8 A;  2FYD B;  4CJ8 A;  4AAW A;  2O1H A;  1G2V A;  1QWJ A;  4B42 A;  1WT3 A;  2VS5 A;  1ZIZ A;  3T7M A;  1FR8 A;  1JVG A;  1V82 A;  2RJ0 A;  1HM9 A;  1JV1 A;  3K8E A;  4LW3 A;  5CQN X;  4Y63 A;  3FOQ A;  2Z86 A;  4FRL A;  1LZ7 A;  2Y4L A;  2BO8 A;  3U0Y A;  5CQP A;  4EE5 A;  1H5S D;  3I0L A;  1NF5 B;  1VGU A;  4KT7 A;  2Q4J A;  4B5B A;  3PKQ A;  4KC2 A;  5FU0 A;  2V0I A;  3RMV A;  1G95 A;  1VH1 A;  1JV3 A;  2ICX A;  4P02 A;  4CJB A;  2O1G A;  5CMF X;  5C49 A;  3SXA A;  1O7Q A;  4O6M A;  2RJ9 A;  5L6S A;  2I5E A;  3SPT A;  2A8U A;  1IIN A;  4NAK A;  4B4B A;  4E1K A;  2QGI A;  4ECM A;  2VSH A;  1R7T A;  3IOH A;  3SXD A;  1EZI A;  1VIC A;  1HJJ A;  4O6N A;  1W57 A;  1WT1 A;  1JYK A;  4D0T A;  3D98 A;  1V83 A;  3JUJ A;  3RSB A;  2Y7A A;  5L6V A;  1JYL A;  4FRA A;  4ASY A;  4HO9 A;  4J18 A;  5I1F A;  4M4K A;  4M28 A;  4IRQ A;  4FRP A;  4G3S A;  4B4M A;  3CKN A;  2AE7 A;  3V8Y A;  3OH2 A;  5CMJ A;  2GGQ A;  1W55 A;  3U2X A;  4Y7V A;  3ZF8 A;  3ZLK A;  3U2W A;  3EE5 A;  2AM5 A;  3CKJ A;  1VM8 A;  4FRE A;  1GX4 A;  4HO5 A;  3IOJ A;  4AYL A;  3T7N A;  4MIX A;  1WT2 A;  2VD4 A;  1FO9 A;  2E8B A;  2ZU8 A;  2AM4 A;  2XWL A;  1O7O A;  3JUK A;  2Y6P A;  5FYE A;  2P73 A;  1ZJ1 A;  1FXJ A;  4K6R A;  2V0L A;  1H5R A;  1YP2 A;  4EEM A;  1G3L A;  5IDT A;  3U2V A;  2AGD A;  2RJ1 A;  1ZI4 A;  1H7H A;  1VGW A;  1YRO B;  1O0R A;  2PGV A;  1G1L A;  2YQH A;  3SX5 A;  3E25 A;  3Q4S A;  2D7R A;  1H7T A;  3N9W A;  4HO2 A;  3V0L A;  3USQ A;  4EEG A;  5C4D A;  2NXV A;  1I52 A;  4L41 C;  5D92 A;  1NHE B;  3V0M A;  1H3M A;  1VGZ A;  4Q7C A;  3POL A;  1H5S C;  4DEC A;  3V90 A;  1R7U A;  4EE3 A;  2ICY A;  4G3P A;  2MZB A;  4FCU A;  4NAL A;  2ZU7 A;  3V0P A;  3DK5 A;  3D8V A;  5C4C A;  5IFY A;  1O23 B;  1OMX A;  2APC A;  2RJ8 A;  2WVL A;  3FWW A;  2J0A A;  5C1H A;  3CKV A;  1H7G A;  5FU8 A;  1GQC A;  3I0F A;  1HM8 A;  1WT0 A;  5C4B A;  1LZJ A;  2V0H A;  3CGX A;  1LL0 A;  4G3Q A;  1GWV A;  4HCQ A;  2RIZ A;  2D0J A;  3NGW A;  4HG6 A;  4KPX A;  4D0Z A;  2J0B A;  5DDV A;  2YQJ A;  3I0J A;  2XMH A;  3CKQ A;  3OKR A;  3ST8 A;  4D11 C;  5FTS A;  4DDZ A;  5C3B A;  1H5S B;  4KNR A;  4XWI A;  4R7P A;  3ZLL A;  5CMG X;  1FG5 N;  1MP5 A;  5C3A A;  5EJZ A;  1G0R A;  2AM3 A;  2W0W A;  2FYC B;  1INJ A;  2PA4 A;  4Y64 A;  1GA8 A;  4MND A;  1H5S A;  1H4C A;  4KRV A;  4NAI A;  4B4G A;  4CVH A;  4FCE A;  1LL3 A;  1ZCY A;  4UEG A;  4KXO A;  3OH1 A;  2VXM A;  2A8W A;  3I0E A;  1H7L A;  1ZJ3 A;  2AES A;  4FIY A;  2JCO A;  1MP4 A;  3OH0 A;  4IRP A;  4HO0 A;  3SXE A;  3T7O A;  1G9R A;  2QH5 A;  4HO6 A;  3SX3 A;  3ZGG A;  1VZX A;  4ASJ A;  5D91 A;  2I5K A;  2XWM A;  5CQO A;  1OQM B;  5C8R A;  5CMH A;  5C4F A;  1VGT A;  2AEC A;  1V84 A;  1H4E A;  1GX0 A;  3U0X A;  5C1L A;  3U2U A;  1EYR A;  4LW6 A;  1XZ6 A;  1YP4 A;  2RJ4 A;  2JCL A;  1R81 A;  1XHB A;  2YC5 A;  2ZU9 A;  3CKO A;  5C4E A;  1H5T B;  5DDT A;  4Y7G A;  1FGG A;  1W77 A;  4JD0 A;  2OI5 A;  3Q7U A;  1ZDF A;  2YQC A;  1GQ9 A;  5IDS A;  2UX8 A;  3OH4 A;  1TZF A;  1GWW A;  1VZT A;  1ZCT A;  4Y7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...