1H5TA

Thymidylyltransferase complexed with thymidylyldiphosphate-glucose
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and Crystallographic Analyses Support a Sequential-Ordered Bi Bi Catalytic Mechanism for Escherichia Coli Glucose-1-Phosphate Thymidylyltransferase
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 290
sequence length 290
chains with identical sequence C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5tA00
4FRHA 1H4CA 4HO5A 2Z86A 3OAMA 5FYEA 4MYBA 4IRPA 2FYCB 2XMEA 3I0JA 1GA8A 2W0VA 5CQMX 1ZJ1A 5C48A 4B4GA 4D0TA 4DE7A 5FUHA 3SPTA 2OEGA 5L6SA 1S4NA 1LZ7A 1MP3A 3I0GA 1HM8A 2WVLA 1TW1A 2RJ9A 2YQJA 5I1FA 2WGZA 1G93A 2FFUA 1VZUA 1WT0A 2D0JA 1R7YA 4B2XA 1EZIA 4Y7TA 3I0EA 2V0JA 3CKVA 2JCKA 2BO4A 1FXOA 2P73A 3SXEA 1O0RA 3JUKA 4KNXA 1MP4A 1XHBA 1ZCUA 4M28A 1H7HA 4L41C 1HJLA 4UEGA 1ZJPA 4BQHA 4DDZA 1O7OA 1H5TB 3V0LA 3OH1A 4D11A 2QKXA 4FQWA 3U2UA 4J18A 3ZF8A 3Q80A 1H7TA 5IDTA 4E1KA 3I0LA 4M2BA 2WEEA 2P72A 3OC9A 1G0RA 4NANA 1H7EA 1QWJA 1TZFA 2MZBA 1LZ0A 1MP5A 3E26A 4EE4A 2X5ZA 2JCJA 4EEMA 1NF5B 4CJBA 3D8VA 5EJ1A 1HV9A 5CMIA 1YROB 4Y63A 1LL2A 1R7TA 2RJ8A 4NALA 3RMVA 4LW6A 4NAKA 1H5SB 2ZU8A 2VS5A 4B4MA 4KNRA 1LVWA 5C38A 1ZDGA 1NWGB 4G3PA 4P02A 4DECA 4K6RA 3SXGA 1FGGA 4GBPA 1FGXA 3IOHA 4Y7FA 3SX5A 3R2WA 1G97A 5DDVA 4EEAA 4EE3A 3OH3A 2V0HA 4NAIA 2JCOA 2WVKA 3T7OA 5BXCA 4HO8A 1FWYA 3ZGFA 3SXDA 1HM0A 1JV3A 3V90A 1H7GA 1G8OA 1JYKA 1ZJ3A 2VS4A 3F1CA 3USQA 4Y9XA 2W0WA 3I0IX 3SXCA 5C4EA 2O1GA 3DUVA 1FOAA 1NQIB 3F1YA 5CQLX 2XWLA 5C4BA 5HS2A 1R7VA 3U2TA 1ZJ0A 3I0CA 4LW3A 4HO0A 2E3DA 4HO6A 4HG6A 3K8DA 3OH2A 5L6VA 2D7IA 4KQLA 3D98A 2WAWA 3USRA 2AM3A 1G1LA 4D11C 2VXLA 2CU2A 1TW5A 5J49A 5C4CA 2WVMA 4Y64A 1HJJA 2FYDB 2V0KA 2ZU7A 1H5RB 1NHEB 3E25A 2XMHA 1IINA 1ZHJA 5FTVA 4B3UA 3I0HA 2X65A 2UX8A 2Y6PA 2FY7A 2RITA 3Q4SA 5AJNA 4EEGA 3SXBA 1FR8A 4ECMA 2BO8A 3TQDA 2RIXA 1TVYA 3CU0A 5C3DA 1K4VA 2I7BA 2ICYA 5EJZA 1JYLA 2YQHA 2RIYA 3I0DA 2QGIA 2FYBA 4YS8A 1WVCA 1Z90A 5CMFX 4JISA 2VS3A 1XZ6A 2Y4JA 3CGXA 1QG8A 5AJPA 1H4EA 1ZJOA 4ASJA 5DDTA 2OI6A 1H5RA 2O1HA 4G3QA 3FOQA 4M4KA 1LZJA 1JV1A 3PKPA 2ICXA 2DPWA 2YQSA 3CKOA 1QGSA 1R80A 4FRLA 4CJCA 2A8UA 4AYJA 3U0YA 1GQ9A 2I5EA 1ZI3A 2OEFA 3ZGGA 1V84A 2OI5A 4B2WA 2V0IA 5FV9A 2VSHA 3DK5A 5FU8A 5CMJA 1NKHB 2OI7A 4KRVA 2BO7A 3OH4A 5C4DA 3SX7A 5CMGX 4CVHA 2D7RA 4KC1A 4C2SA 3CKJA 4AYLA 2RJ6A 1H3MA 2X60A 2YC3A 3Q7UA 1I52A 1NMMB 3V0PA 4XWIA 1VICA 1H5TA 4EEOA 2RJ0A 1ZCTA 1G95A 4KPXA 4G3SA 1OMXA 1EYRA 1W57A 5CMHA 1H5SD 2RJ4A 3LW6A 4CJ8A 1GX4A 1GWWA 5C8RA 1R82A 3EE5A 2YQCA 5C3AA 4R7PA 2WE9A 4BMAA 4D48A 2RJ7A 4Y62A 1VGZA 2Y7AA 3BCVA 1ON8A 4HCQA 1H5SA 5C3BA 1IIMA 1FR9A 4MNDA 3T7NA 5FTSA 4KPZA 3OH0A 3V0QA 4ARWA 1WT1A 1GWVA 2RJ5A 2VSIA 3BRKX 1LZIA 4EVWA 1OQMB 5C49A 2AGDA 1VH3A 1LL0A 1VGWA 1WSZA 5AJOA 2NXVA 2Q4JA 3SXAA 1ZI1A 4B4BA 2JCLA 3POLA 4B5BA 3CKQA 5FU0A 3ST8A 3R3IA 4HO3A 2P6WA 2ZU9A 3K8EA 1ZI5A 2PGVA 1YP4A 1GX0A 5C1LA 4FRMA 4HO4A 4ASYA 3I0KA 3V0NA 2VXMA 4FRBA 5CQNX 1JVDA 5JQQA 3V91A 3U2VA 4D0ZA 2XWNA 3IOIA 5IDSA 1MC3A 1ZJ2A 2V0LA 3U2XA 1ZDFA 2PX7A 3ZLKA 4P00A 2XWMA 1H7FA 2AE7A 1INIA 2X5SA 3SX8A 1S4OA 1S4PA 2FYAA 2AECA 1W55A 2APCA 1HM9A 5CQOA 2E8BA 4FRDA 2GGQA 4FREA 1G9RA 5C4FA 1PZYB 3JTJA 3SX3A 1GQCA 5EIYA 2YC5A 4JD0A 2Y4LA 1VGUA 3JUJA 3V8ZA 1E5KA 1H5SC 3RSBA 3DJ4A 4FCEA 4FRPA 3V0MA 1LL3A 2PGYA 5IFYA 3NGWA 1FZWA 1ZI4A 4KXOA 1V83A 4ZDQA 1V82A 5C36A 2VFZA 2AH9A 4HO9A 3FWWA 2A8WA 4KC2A 4HO2A 2Y4KA 1FG5N 1YP3A 1VZXA 1H7QA 1G2VA 4KT7A 1VZTA 4EE5A 2Y4MA 1ON6A 2YESA 1ZCVA 4Y7UA 3D5NA 1YP2A 4IRQA 1FO9A 1R7UA 3I0FA 4Y7VA 1R7XA 2AESA 2RJ1A 3IOJA 1OMZA 3OGZA 5C1HA 3O3PA 5C1GA 1W77A 2I5KA 3GUEA 1FXJA 5CQPA 1SS9A 1WT2A 3QVBA 1ZCYA 1H4DA 1VM8A 1G3LA 1VH1A 1O7QA 1VGTA 3KIAA 4Y7GA 1O23B 3T7MA 4B42A 4FRQA 3V8YA 1JVGA 2YCMA 3N9WA 4KC4A 3PNNA 4HOCA 4AAWA 3TZTA 4AC3A 1QGQA 2RIZA 4Y6UA 1R81A 4Y6NA 1FO8A 4G87A 2QH5A 3HL3A 3U2WA 4FROA 2AM4A 4FCUA 1H7LA 3OKRA 3RMWA 3V0OA 4M2AA 1ZIZA 1VPAA 1FRWA 2PA4A 1INJA 3PKQA 2VD4A 4FRAA 1PZTA 2O1FA 3U0XA 2AM5A 2Z87A 5C47A 1G23A 3CKNA 1WT3A 2BO6A 3ZLLA 2GGOA 1KWSA 2FFVA
chains in the Genus database with same CATH superfamily
4FRHA 1H4CA 4O6NA 4HO5A 2Z86A 3OAMA 5FYEA 4MYBA 4IRPA 2FYCB 2XMEA 3I0JA 1GA8A 2W0VA 5CQMX 1ZJ1A 5C48A 4B4GA 4D0TA 4DE7A 5FUHA 3SPTA 2OEGA 5L6SA 1S4NA 1LZ7A 1MP3A 3I0GA 1HM8A 2WVLA 1TW1A 2RJ9A 2YQJA 5I1FA 2WGZA 1G93A 2FFUA 1VZUA 1WT0A 2D0JA 1R7YA 4B2XA 1EZIA 4Y7TA 3I0EA 2V0JA 3CKVA 2JCKA 2BO4A 1FXOA 2P73A 3SXEA 1O0RA 3JUKA 4KNXA 1MP4A 1XHBA 1ZCUA 4M28A 1H7HA 4L41C 1HJLA 4UEGA 1ZJPA 4BQHA 4DDZA 1O7OA 1H5TB 3V0LA 3OH1A 4D11A 2QKXA 4FQWA 3U2UA 4J18A 3ZF8A 3Q80A 1H7TA 5IDTA 4E1KA 3I0LA 4M2BA 2WEEA 2P72A 3OC9A 1G0RA 4NANA 1H7EA 1QWJA 1TZFA 2MZBA 1LZ0A 1MP5A 2J0BA 3E26A 2X5ZA 2JCJA 4EE4A 4EEMA 1NF5B 4CJBA 3D8VA 5EJ1A 1HV9A 5CMIA 1YROB 4Y63A 1LL2A 1R7TA 2RJ8A 4NALA 3RMVA 4LW6A 4NAKA 1H5SB 2ZU8A 2VS5A 4B4MA 4KNRA 1LVWA 5C38A 1ZDGA 1NWGB 4G3PA 4P02A 4DECA 4K6RA 3SXGA 1FGGA 4GBPA 1FGXA 3IOHA 4Y7FA 3SX5A 3R2WA 1G97A 5DDVA 4EEAA 4EE3A 3OH3A 2V0HA 4NAIA 2JCOA 2WVKA 3T7OA 2C0NA 5BXCA 4HO8A 1FWYA 3ZGFA 3SXDA 1HM0A 1JV3A 3V90A 1H7GA 1G8OA 1JYKA 1ZJ3A 2VS4A 3F1CA 3USQA 4Y9XA 2W0WA 3I0IX 3SXCA 5C4EA 2O1GA 3DUVA 1FOAA 1NQIB 3F1YA 5CQLX 2XWLA 5C4BA 5HS2A 1R7VA 3U2TA 1ZJ0A 3I0CA 4LW3A 4HO0A 2E3DA 4HO6A 4HG6A 3K8DA 3OH2A 5L6VA 2D7IA 4KQLA 3D98A 2WAWA 3USRA 2AM3A 1G1LA 4D11C 2VXLA 2CU2A 1TW5A 5J49A 5C4CA 2WVMA 4Y64A 1HJJA 2FYDB 2V0KA 2ZU7A 1H5RB 1NHEB 3E25A 2XMHA 1IINA 1ZHJA 4FIXA 5FTVA 4B3UA 3I0HA 2X65A 2UX8A 2Y6PA 2FY7A 2RITA 3Q4SA 5AJNA 4EEGA 3SXBA 1FR8A 4ECMA 2BO8A 3TQDA 4Q7CA 2RIXA 1TVYA 3CU0A 5C3DA 1K4VA 2I7BA 2ICYA 5EJZA 1JYLA 2J0AA 2YQHA 2RIYA 3I0DA 2QGIA 2FYBA 4YS8A 1WVCA 1Z90A 5CMFX 4JISA 2VS3A 1XZ6A 2Y4JA 3CGXA 1QG8A 5AJPA 1H4EA 1ZJOA 4ASJA 5DDTA 2OI6A 1H5RA 2O1HA 4G3QA 3FOQA 4M4KA 1LZJA 1JV1A 3PKPA 2ICXA 2DPWA 2YQSA 3CKOA 1QGSA 1R80A 4FRLA 4CJCA 2A8UA 4AYJA 3U0YA 1GQ9A 2I5EA 1ZI3A 2OEFA 3ZGGA 1V84A 2OI5A 4B2WA 2V0IA 5FV9A 2VSHA 3DK5A 5FU8A 5CMJA 1NKHB 2OI7A 4KRVA 2BO7A 3OH4A 5C4DA 3SX7A 5CMGX 4CVHA 4MIXA 2D7RA 4KC1A 4C2SA 3CKJA 4AYLA 2RJ6A 1H3MA 2X60A 2YC3A 3Q7UA 1I52A 1NMMB 3V0PA 4XWIA 1VICA 1H5TA 4EEOA 2RJ0A 1ZCTA 1G95A 4KPXA 4G3SA 1OMXA 1EYRA 1W57A 5CMHA 1H5SD 2RJ4A 3LW6A 4CJ8A 1GX4A 1GWWA 5C8RA 1R82A 3EE5A 2YQCA 5C3AA 4R7PA 2WE9A 4BMAA 4D48A 2RJ7A 4Y62A 1VGZA 2Y7AA 3BCVA 1ON8A 4HCQA 1H5SA 5C3BA 1IIMA 2VK9A 1FR9A 4MNDA 3T7NA 5FTSA 4KPZA 3OH0A 3V0QA 4ARWA 1WT1A 1GWVA 2RJ5A 2VSIA 3BRKX 1LZIA 4EVWA 1OQMB 5C49A 2AGDA 1VH3A 1LL0A 1VGWA 1WSZA 5AJOA 2NXVA 2Q4JA 3SXAA 1ZI1A 4B4BA 2JCLA 3POLA 4B5BA 3CKQA 5FU0A 3ST8A 3R3IA 4HO3A 2P6WA 2ZU9A 3K8EA 1ZI5A 2PGVA 1YP4A 1GX0A 5C1LA 4FRMA 4HO4A 4ASYA 3I0KA 3V0NA 2VXMA 4FRBA 5CQNX 1JVDA 5JQQA 3V91A 3U2VA 4D0ZA 2XWNA 3IOIA 5IDSA 1MC3A 1ZJ2A 2V0LA 3U2XA 1ZDFA 2PX7A 3ZLKA 4P00A 2XWMA 1H7FA 2AE7A 1INIA 2X5SA 3SX8A 1S4OA 5D92A 1S4PA 2FYAA 2AECA 1W55A 2APCA 1HM9A 5CQOA 2E8BA 4FRDA 2GGQA 4FREA 1G9RA 5C4FA 1PZYB 3JTJA 3SX3A 1GQCA 5EIYA 2YC5A 4JD0A 2Y4LA 1VGUA 3JUJA 3V8ZA 1E5KA 1H5SC 3RSBA 3DJ4A 4FCEA 4FRPA 3V0MA 1LL3A 2PGYA 5IFYA 3NGWA 1FZWA 1ZI4A 4KXOA 1V83A 4ZDQA 1V82A 5C36A 2VFZA 2AH9A 4HO9A 3FWWA 2A8WA 4KC2A 4O6MA 4HO2A 2Y4KA 1FG5N 1YP3A 1VZXA 1H7QA 1G2VA 4KT7A 1VZTA 4EE5A 2Y4MA 1ON6A 2YESA 1ZCVA 4Y7UA 4FIYA 3D5NA 1YP2A 4IRQA 1FO9A 1R7UA 3I0FA 4Y7VA 1R7XA 2AESA 2RJ1A 3IOJA 1OMZA 3OGZA 5C1HA 3O3PA 5C1GA 1W77A 2I5KA 3GUEA 1FXJA 5CQPA 1SS9A 1WT2A 3QVBA 1ZCYA 1H4DA 1VM8A 1G3LA 1VH1A 1O7QA 1VGTA 3KIAA 4Y7GA 1O23B 3T7MA 4B42A 4FRQA 3V8YA 1JVGA 2YCMA 3N9WA 4KC4A 3PNNA 4HOCA 4AAWA 3TZTA 4AC3A 1QGQA 2RIZA 4Y6UA 1R81A 4Y6NA 1FO8A 4G87A 2QH5A 3HL3A 3U2WA 4FROA 2AM4A 4FCUA 1H7LA 3OKRA 3RMWA 3V0OA 4M2AA 1ZIZA 1VPAA 1FRWA 2PA4A 1INJA 3PKQA 2VD4A 4FRAA 5D91A 1PZTA 2O1FA 3U0XA 2AM5A 2Z87A 5C47A 1G23A 3CKNA 1WT3A 2BO6A 3ZLLA 2GGOA 1KWSA 2FFVA
chains in the Genus database with same CATH topology
4FRHA 1H4CA 4O6NA 4HO5A 2Z86A 3OAMA 5FYEA 4MYBA 4IRPA 2FYCB 2XMEA 3I0JA 1GA8A 2W0VA 5CQMX 1ZJ1A 5C48A 4B4GA 4D0TA 4DE7A 5FUHA 3SPTA 2OEGA 5L6SA 1S4NA 1LZ7A 1MP3A 3I0GA 1HM8A 2WVLA 1TW1A 2RJ9A 2YQJA 5I1FA 2WGZA 1G93A 2FFUA 1VZUA 1WT0A 2D0JA 1R7YA 4B2XA 1EZIA 4Y7TA 3I0EA 2V0JA 3CKVA 2JCKA 2BO4A 1FXOA 2P73A 3SXEA 1O0RA 3JUKA 4KNXA 1MP4A 1XHBA 1ZCUA 4M28A 1H7HA 4L41C 1HJLA 4UEGA 1ZJPA 4BQHA 4DDZA 1O7OA 1H5TB 3V0LA 3OH1A 4D11A 2QKXA 4FQWA 3U2UA 4J18A 3ZF8A 3Q80A 1H7TA 5IDTA 4E1KA 3I0LA 4M2BA 2WEEA 2P72A 3OC9A 1G0RA 4NANA 1H7EA 1QWJA 1TZFA 2MZBA 1LZ0A 1MP5A 2J0BA 3E26A 2X5ZA 2JCJA 4EE4A 4EEMA 1NF5B 4CJBA 3D8VA 5EJ1A 1HV9A 5CMIA 1YROB 4Y63A 1LL2A 1R7TA 2RJ8A 4NALA 3RMVA 4LW6A 4NAKA 1H5SB 2ZU8A 2VS5A 4B4MA 4KNRA 1LVWA 5C38A 1ZDGA 1NWGB 4G3PA 4P02A 4DECA 4K6RA 3SXGA 1FGGA 4GBPA 1FGXA 3IOHA 4Y7FA 3SX5A 3R2WA 1G97A 5DDVA 4EEAA 4EE3A 3OH3A 2V0HA 4NAIA 2JCOA 2WVKA 3T7OA 2C0NA 5BXCA 4HO8A 1FWYA 3ZGFA 3SXDA 1HM0A 1JV3A 3V90A 1H7GA 1G8OA 1JYKA 1ZJ3A 2VS4A 3F1CA 3USQA 4Y9XA 2W0WA 3I0IX 3SXCA 5C4EA 2O1GA 3DUVA 1FOAA 1NQIB 3F1YA 5CQLX 2XWLA 5C4BA 5HS2A 1R7VA 3U2TA 1ZJ0A 3I0CA 4LW3A 4HO0A 2E3DA 4HO6A 4HG6A 3K8DA 3OH2A 5L6VA 2D7IA 4KQLA 3D98A 2WAWA 3USRA 2AM3A 1G1LA 4D11C 2VXLA 2CU2A 1TW5A 5J49A 5C4CA 2WVMA 4Y64A 1HJJA 2FYDB 2V0KA 2ZU7A 1H5RB 1NHEB 3E25A 2XMHA 1IINA 1ZHJA 4FIXA 5FTVA 4B3UA 3I0HA 2X65A 2UX8A 2Y6PA 2FY7A 2RITA 3Q4SA 5AJNA 4EEGA 3SXBA 1FR8A 4ECMA 2BO8A 3TQDA 4Q7CA 2RIXA 1TVYA 3CU0A 5C3DA 1K4VA 2I7BA 2ICYA 5EJZA 1JYLA 2J0AA 2YQHA 2RIYA 3I0DA 2QGIA 2FYBA 4YS8A 1WVCA 1Z90A 5CMFX 4JISA 2VS3A 1XZ6A 2Y4JA 3CGXA 1QG8A 5AJPA 1H4EA 1ZJOA 4ASJA 5DDTA 2OI6A 1H5RA 2O1HA 4G3QA 3FOQA 4M4KA 1LZJA 1JV1A 3PKPA 2ICXA 2DPWA 2YQSA 3CKOA 1QGSA 1R80A 4FRLA 4CJCA 2A8UA 4AYJA 3U0YA 1GQ9A 2I5EA 1ZI3A 2OEFA 3ZGGA 1V84A 2OI5A 4B2WA 2V0IA 5FV9A 2VSHA 3DK5A 5FU8A 5CMJA 1NKHB 2OI7A 4KRVA 2BO7A 3OH4A 5C4DA 3SX7A 5CMGX 4CVHA 4MIXA 2D7RA 4KC1A 4C2SA 3CKJA 4AYLA 2RJ6A 1H3MA 2X60A 2YC3A 3Q7UA 1I52A 1NMMB 3V0PA 4XWIA 1VICA 1H5TA 4EEOA 2RJ0A 1ZCTA 1G95A 4KPXA 4G3SA 1OMXA 1EYRA 1W57A 5CMHA 1H5SD 2RJ4A 3LW6A 4CJ8A 1GX4A 1GWWA 5C8RA 1R82A 3EE5A 2YQCA 5C3AA 4R7PA 2WE9A 4BMAA 4D48A 2RJ7A 4Y62A 1VGZA 2Y7AA 3BCVA 1ON8A 4HCQA 1H5SA 5C3BA 1IIMA 2VK9A 1FR9A 4MNDA 3T7NA 5FTSA 4KPZA 3OH0A 3V0QA 4ARWA 1WT1A 1GWVA 2RJ5A 2VSIA 3BRKX 1LZIA 4EVWA 1OQMB 5C49A 2AGDA 1VH3A 1LL0A 1VGWA 1WSZA 5AJOA 2NXVA 2Q4JA 3SXAA 1ZI1A 4B4BA 2JCLA 3POLA 4B5BA 3CKQA 5FU0A 3ST8A 3R3IA 4HO3A 2P6WA 2ZU9A 3K8EA 1ZI5A 2PGVA 1YP4A 1GX0A 5C1LA 4FRMA 4HO4A 4ASYA 3I0KA 3V0NA 2VXMA 4FRBA 5CQNX 1JVDA 5JQQA 3V91A 3U2VA 4D0ZA 2XWNA 3IOIA 5IDSA 1MC3A 1ZJ2A 2V0LA 3U2XA 1ZDFA 2PX7A 3ZLKA 4P00A 2XWMA 1H7FA 2AE7A 1INIA 2X5SA 3SX8A 1S4OA 5D92A 1S4PA 2FYAA 2AECA 1W55A 2APCA 1HM9A 5CQOA 2E8BA 4FRDA 2GGQA 4FREA 1G9RA 5C4FA 1PZYB 3JTJA 3SX3A 1GQCA 5EIYA 2YC5A 4JD0A 2Y4LA 1VGUA 3JUJA 3V8ZA 1E5KA 1H5SC 3RSBA 3DJ4A 4FCEA 4FRPA 3V0MA 1LL3A 2PGYA 5IFYA 3NGWA 1FZWA 1ZI4A 4KXOA 1V83A 4ZDQA 1V82A 5C36A 2VFZA 2AH9A 4HO9A 3FWWA 2A8WA 4KC2A 4O6MA 4HO2A 2Y4KA 1FG5N 1YP3A 1VZXA 1H7QA 1G2VA 4KT7A 1VZTA 4EE5A 2Y4MA 1ON6A 2YESA 1ZCVA 4Y7UA 4FIYA 3D5NA 1YP2A 4IRQA 1FO9A 1R7UA 3I0FA 4Y7VA 1R7XA 2AESA 2RJ1A 3IOJA 1OMZA 3OGZA 5C1HA 3O3PA 5C1GA 1W77A 2I5KA 3GUEA 1FXJA 5CQPA 1SS9A 1WT2A 3QVBA 1ZCYA 1H4DA 1VM8A 1G3LA 1VH1A 1O7QA 1VGTA 3KIAA 4Y7GA 1O23B 3T7MA 4B42A 4FRQA 3V8YA 1JVGA 2YCMA 3N9WA 4KC4A 3PNNA 4HOCA 4AAWA 3TZTA 4AC3A 1QGQA 2RIZA 4Y6UA 1R81A 4Y6NA 1FO8A 4G87A 2QH5A 3HL3A 3U2WA 4FROA 2AM4A 4FCUA 1H7LA 3OKRA 3RMWA 3V0OA 4M2AA 1ZIZA 1VPAA 1FRWA 2PA4A 1INJA 3PKQA 2VD4A 4FRAA 5D91A 1PZTA 2O1FA 3U0XA 2AM5A 2Z87A 5C47A 1G23A 3CKNA 1WT3A 2BO6A 3ZLLA 2GGOA 1KWSA 2FFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRH A;  1H4C A;  4HO5 A;  2Z86 A;  3OAM A;  5FYE A;  4MYB A;  4IRP A;  2FYC B;  2XME A;  3I0J A;  1GA8 A;  2W0V A;  5CQM X;  1ZJ1 A;  5C48 A;  4B4G A;  4D0T A;  4DE7 A;  5FUH A;  3SPT A;  2OEG A;  5L6S A;  1S4N A;  1LZ7 A;  1MP3 A;  3I0G A;  1HM8 A;  2WVL A;  1TW1 A;  2RJ9 A;  2YQJ A;  5I1F A;  2WGZ A;  1G93 A;  2FFU A;  1VZU A;  1WT0 A;  2D0J A;  1R7Y A;  4B2X A;  1EZI A;  4Y7T A;  3I0E A;  2V0J A;  3CKV A;  2JCK A;  2BO4 A;  1FXO A;  2P73 A;  3SXE A;  1O0R A;  3JUK A;  4KNX A;  1MP4 A;  1XHB A;  1ZCU A;  4M28 A;  1H7H A;  4L41 C;  1HJL A;  4UEG A;  1ZJP A;  4BQH A;  4DDZ A;  1O7O A;  1H5T B;  3V0L A;  3OH1 A;  4D11 A;  2QKX A;  4FQW A;  3U2U A;  4J18 A;  3ZF8 A;  3Q80 A;  1H7T A;  5IDT A;  4E1K A;  3I0L A;  4M2B A;  2WEE A;  2P72 A;  3OC9 A;  1G0R A;  4NAN A;  1H7E A;  1QWJ A;  1TZF A;  2MZB A;  1LZ0 A;  1MP5 A;  3E26 A;  4EE4 A;  2X5Z A;  2JCJ A;  4EEM A;  1NF5 B;  4CJB A;  3D8V A;  5EJ1 A;  1HV9 A;  5CMI A;  1YRO B;  4Y63 A;  1LL2 A;  1R7T A;  2RJ8 A;  4NAL A;  3RMV A;  4LW6 A;  4NAK A;  1H5S B;  2ZU8 A;  2VS5 A;  4B4M A;  4KNR A;  1LVW A;  5C38 A;  1ZDG A;  1NWG B;  4G3P A;  4P02 A;  4DEC A;  4K6R A;  3SXG A;  1FGG A;  4GBP A;  1FGX A;  3IOH A;  4Y7F A;  3SX5 A;  3R2W A;  1G97 A;  5DDV A;  4EEA A;  4EE3 A;  3OH3 A;  2V0H A;  4NAI A;  2JCO A;  2WVK A;  3T7O A;  5BXC A;  4HO8 A;  1FWY A;  3ZGF A;  3SXD A;  1HM0 A;  1JV3 A;  3V90 A;  1H7G A;  1G8O A;  1JYK A;  1ZJ3 A;  2VS4 A;  3F1C A;  3USQ A;  4Y9X A;  2W0W A;  3I0I X;  3SXC A;  5C4E A;  2O1G A;  3DUV A;  1FOA A;  1NQI B;  3F1Y A;  5CQL X;  2XWL A;  5C4B A;  5HS2 A;  1R7V A;  3U2T A;  1ZJ0 A;  3I0C A;  4LW3 A;  4HO0 A;  2E3D A;  4HO6 A;  4HG6 A;  3K8D A;  3OH2 A;  5L6V A;  2D7I A;  4KQL A;  3D98 A;  2WAW A;  3USR A;  2AM3 A;  1G1L A;  4D11 C;  2VXL A;  2CU2 A;  1TW5 A;  5J49 A;  5C4C A;  2WVM A;  4Y64 A;  1HJJ A;  2FYD B;  2V0K A;  2ZU7 A;  1H5R B;  1NHE B;  3E25 A;  2XMH A;  1IIN A;  1ZHJ A;  5FTV A;  4B3U A;  3I0H A;  2X65 A;  2UX8 A;  2Y6P A;  2FY7 A;  2RIT A;  3Q4S A;  5AJN A;  4EEG A;  3SXB A;  1FR8 A;  4ECM A;  2BO8 A;  3TQD A;  2RIX A;  1TVY A;  3CU0 A;  5C3D A;  1K4V A;  2I7B A;  2ICY A;  5EJZ A;  1JYL A;  2YQH A;  2RIY A;  3I0D A;  2QGI A;  2FYB A;  4YS8 A;  1WVC A;  1Z90 A;  5CMF X;  4JIS A;  2VS3 A;  1XZ6 A;  2Y4J A;  3CGX A;  1QG8 A;  5AJP A;  1H4E A;  1ZJO A;  4ASJ A;  5DDT A;  2OI6 A;  1H5R A;  2O1H A;  4G3Q A;  3FOQ A;  4M4K A;  1LZJ A;  1JV1 A;  3PKP A;  2ICX A;  2DPW A;  2YQS A;  3CKO A;  1QGS A;  1R80 A;  4FRL A;  4CJC A;  2A8U A;  4AYJ A;  3U0Y A;  1GQ9 A;  2I5E A;  1ZI3 A;  2OEF A;  3ZGG A;  1V84 A;  2OI5 A;  4B2W A;  2V0I A;  5FV9 A;  2VSH A;  3DK5 A;  5FU8 A;  5CMJ A;  1NKH B;  2OI7 A;  4KRV A;  2BO7 A;  3OH4 A;  5C4D A;  3SX7 A;  5CMG X;  4CVH A;  2D7R A;  4KC1 A;  4C2S A;  3CKJ A;  4AYL A;  2RJ6 A;  1H3M A;  2X60 A;  2YC3 A;  3Q7U A;  1I52 A;  1NMM B;  3V0P A;  4XWI A;  1VIC A;  1H5T A;  4EEO A;  2RJ0 A;  1ZCT A;  1G95 A;  4KPX A;  4G3S A;  1OMX A;  1EYR A;  1W57 A;  5CMH A;  1H5S D;  2RJ4 A;  3LW6 A;  4CJ8 A;  1GX4 A;  1GWW A;  5C8R A;  1R82 A;  3EE5 A;  2YQC A;  5C3A A;  4R7P A;  2WE9 A;  4BMA A;  4D48 A;  2RJ7 A;  4Y62 A;  1VGZ A;  2Y7A A;  3BCV A;  1ON8 A;  4HCQ A;  1H5S A;  5C3B A;  1IIM A;  1FR9 A;  4MND A;  3T7N A;  5FTS A;  4KPZ A;  3OH0 A;  3V0Q A;  4ARW A;  1WT1 A;  1GWV A;  2RJ5 A;  2VSI A;  3BRK X;  1LZI A;  4EVW A;  1OQM B;  5C49 A;  2AGD A;  1VH3 A;  1LL0 A;  1VGW A;  1WSZ A;  5AJO A;  2NXV A;  2Q4J A;  3SXA A;  1ZI1 A;  4B4B A;  2JCL A;  3POL A;  4B5B A;  3CKQ A;  5FU0 A;  3ST8 A;  3R3I A;  4HO3 A;  2P6W A;  2ZU9 A;  3K8E A;  1ZI5 A;  2PGV A;  1YP4 A;  1GX0 A;  5C1L A;  4FRM A;  4HO4 A;  4ASY A;  3I0K A;  3V0N A;  2VXM A;  4FRB A;  5CQN X;  1JVD A;  5JQQ A;  3V91 A;  3U2V A;  4D0Z A;  2XWN A;  3IOI A;  5IDS A;  1MC3 A;  1ZJ2 A;  2V0L A;  3U2X A;  1ZDF A;  2PX7 A;  3ZLK A;  4P00 A;  2XWM A;  1H7F A;  2AE7 A;  1INI A;  2X5S A;  3SX8 A;  1S4O A;  1S4P A;  2FYA A;  2AEC A;  1W55 A;  2APC A;  1HM9 A;  5CQO A;  2E8B A;  4FRD A;  2GGQ A;  4FRE A;  1G9R A;  5C4F A;  1PZY B;  3JTJ A;  3SX3 A;  1GQC A;  5EIY A;  2YC5 A;  4JD0 A;  2Y4L A;  1VGU A;  3JUJ A;  3V8Z A;  1E5K A;  1H5S C;  3RSB A;  3DJ4 A;  4FCE A;  4FRP A;  3V0M A;  1LL3 A;  2PGY A;  5IFY A;  3NGW A;  1FZW A;  1ZI4 A;  4KXO A;  1V83 A;  4ZDQ A;  1V82 A;  5C36 A;  2VFZ A;  2AH9 A;  4HO9 A;  3FWW A;  2A8W A;  4KC2 A;  4HO2 A;  2Y4K A;  1FG5 N;  1YP3 A;  1VZX A;  1H7Q A;  1G2V A;  4KT7 A;  1VZT A;  4EE5 A;  2Y4M A;  1ON6 A;  2YES A;  1ZCV A;  4Y7U A;  3D5N A;  1YP2 A;  4IRQ A;  1FO9 A;  1R7U A;  3I0F A;  4Y7V A;  1R7X A;  2AES A;  2RJ1 A;  3IOJ A;  1OMZ A;  3OGZ A;  5C1H A;  3O3P A;  5C1G A;  1W77 A;  2I5K A;  3GUE A;  1FXJ A;  5CQP A;  1SS9 A;  1WT2 A;  3QVB A;  1ZCY A;  1H4D A;  1VM8 A;  1G3L A;  1VH1 A;  1O7Q A;  1VGT A;  3KIA A;  4Y7G A;  1O23 B;  3T7M A;  4B42 A;  4FRQ A;  3V8Y A;  1JVG A;  2YCM A;  3N9W A;  4KC4 A;  3PNN A;  4HOC A;  4AAW A;  3TZT A;  4AC3 A;  1QGQ A;  2RIZ A;  4Y6U A;  1R81 A;  4Y6N A;  1FO8 A;  4G87 A;  2QH5 A;  3HL3 A;  3U2W A;  4FRO A;  2AM4 A;  4FCU A;  1H7L A;  3OKR A;  3RMW A;  3V0O A;  4M2A A;  1ZIZ A;  1VPA A;  1FRW A;  2PA4 A;  1INJ A;  3PKQ A;  2VD4 A;  4FRA A;  1PZT A;  2O1F A;  3U0X A;  2AM5 A;  2Z87 A;  5C47 A;  1G23 A;  3CKN A;  1WT3 A;  2BO6 A;  3ZLL A;  2GGO A;  1KWS A;  2FFV A; 
#chains in the Genus database with same CATH topology
 4FRH A;  1H4C A;  4O6N A;  4HO5 A;  2Z86 A;  3OAM A;  5FYE A;  4MYB A;  4IRP A;  2FYC B;  2XME A;  3I0J A;  1GA8 A;  2W0V A;  5CQM X;  1ZJ1 A;  5C48 A;  4B4G A;  4D0T A;  4DE7 A;  5FUH A;  3SPT A;  2OEG A;  5L6S A;  1S4N A;  1LZ7 A;  1MP3 A;  3I0G A;  1HM8 A;  2WVL A;  1TW1 A;  2RJ9 A;  2YQJ A;  5I1F A;  2WGZ A;  1G93 A;  2FFU A;  1VZU A;  1WT0 A;  2D0J A;  1R7Y A;  4B2X A;  1EZI A;  4Y7T A;  3I0E A;  2V0J A;  3CKV A;  2JCK A;  2BO4 A;  1FXO A;  2P73 A;  3SXE A;  1O0R A;  3JUK A;  4KNX A;  1MP4 A;  1XHB A;  1ZCU A;  4M28 A;  1H7H A;  4L41 C;  1HJL A;  4UEG A;  1ZJP A;  4BQH A;  4DDZ A;  1O7O A;  1H5T B;  3V0L A;  3OH1 A;  4D11 A;  2QKX A;  4FQW A;  3U2U A;  4J18 A;  3ZF8 A;  3Q80 A;  1H7T A;  5IDT A;  4E1K A;  3I0L A;  4M2B A;  2WEE A;  2P72 A;  3OC9 A;  1G0R A;  4NAN A;  1H7E A;  1QWJ A;  1TZF A;  2MZB A;  1LZ0 A;  1MP5 A;  2J0B A;  3E26 A;  2X5Z A;  2JCJ A;  4EE4 A;  4EEM A;  1NF5 B;  4CJB A;  3D8V A;  5EJ1 A;  1HV9 A;  5CMI A;  1YRO B;  4Y63 A;  1LL2 A;  1R7T A;  2RJ8 A;  4NAL A;  3RMV A;  4LW6 A;  4NAK A;  1H5S B;  2ZU8 A;  2VS5 A;  4B4M A;  4KNR A;  1LVW A;  5C38 A;  1ZDG A;  1NWG B;  4G3P A;  4P02 A;  4DEC A;  4K6R A;  3SXG A;  1FGG A;  4GBP A;  1FGX A;  3IOH A;  4Y7F A;  3SX5 A;  3R2W A;  1G97 A;  5DDV A;  4EEA A;  4EE3 A;  3OH3 A;  2V0H A;  4NAI A;  2JCO A;  2WVK A;  3T7O A;  2C0N A;  5BXC A;  4HO8 A;  1FWY A;  3ZGF A;  3SXD A;  1HM0 A;  1JV3 A;  3V90 A;  1H7G A;  1G8O A;  1JYK A;  1ZJ3 A;  2VS4 A;  3F1C A;  3USQ A;  4Y9X A;  2W0W A;  3I0I X;  3SXC A;  5C4E A;  2O1G A;  3DUV A;  1FOA A;  1NQI B;  3F1Y A;  5CQL X;  2XWL A;  5C4B A;  5HS2 A;  1R7V A;  3U2T A;  1ZJ0 A;  3I0C A;  4LW3 A;  4HO0 A;  2E3D A;  4HO6 A;  4HG6 A;  3K8D A;  3OH2 A;  5L6V A;  2D7I A;  4KQL A;  3D98 A;  2WAW A;  3USR A;  2AM3 A;  1G1L A;  4D11 C;  2VXL A;  2CU2 A;  1TW5 A;  5J49 A;  5C4C A;  2WVM A;  4Y64 A;  1HJJ A;  2FYD B;  2V0K A;  2ZU7 A;  1H5R B;  1NHE B;  3E25 A;  2XMH A;  1IIN A;  1ZHJ A;  4FIX A;  5FTV A;  4B3U A;  3I0H A;  2X65 A;  2UX8 A;  2Y6P A;  2FY7 A;  2RIT A;  3Q4S A;  5AJN A;  4EEG A;  3SXB A;  1FR8 A;  4ECM A;  2BO8 A;  3TQD A;  4Q7C A;  2RIX A;  1TVY A;  3CU0 A;  5C3D A;  1K4V A;  2I7B A;  2ICY A;  5EJZ A;  1JYL A;  2J0A A;  2YQH A;  2RIY A;  3I0D A;  2QGI A;  2FYB A;  4YS8 A;  1WVC A;  1Z90 A;  5CMF X;  4JIS A;  2VS3 A;  1XZ6 A;  2Y4J A;  3CGX A;  1QG8 A;  5AJP A;  1H4E A;  1ZJO A;  4ASJ A;  5DDT A;  2OI6 A;  1H5R A;  2O1H A;  4G3Q A;  3FOQ A;  4M4K A;  1LZJ A;  1JV1 A;  3PKP A;  2ICX A;  2DPW A;  2YQS A;  3CKO A;  1QGS A;  1R80 A;  4FRL A;  4CJC A;  2A8U A;  4AYJ A;  3U0Y A;  1GQ9 A;  2I5E A;  1ZI3 A;  2OEF A;  3ZGG A;  1V84 A;  2OI5 A;  4B2W A;  2V0I A;  5FV9 A;  2VSH A;  3DK5 A;  5FU8 A;  5CMJ A;  1NKH B;  2OI7 A;  4KRV A;  2BO7 A;  3OH4 A;  5C4D A;  3SX7 A;  5CMG X;  4CVH A;  4MIX A;  2D7R A;  4KC1 A;  4C2S A;  3CKJ A;  4AYL A;  2RJ6 A;  1H3M A;  2X60 A;  2YC3 A;  3Q7U A;  1I52 A;  1NMM B;  3V0P A;  4XWI A;  1VIC A;  1H5T A;  4EEO A;  2RJ0 A;  1ZCT A;  1G95 A;  4KPX A;  4G3S A;  1OMX A;  1EYR A;  1W57 A;  5CMH A;  1H5S D;  2RJ4 A;  3LW6 A;  4CJ8 A;  1GX4 A;  1GWW A;  5C8R A;  1R82 A;  3EE5 A;  2YQC A;  5C3A A;  4R7P A;  2WE9 A;  4BMA A;  4D48 A;  2RJ7 A;  4Y62 A;  1VGZ A;  2Y7A A;  3BCV A;  1ON8 A;  4HCQ A;  1H5S A;  5C3B A;  1IIM A;  2VK9 A;  1FR9 A;  4MND A;  3T7N A;  5FTS A;  4KPZ A;  3OH0 A;  3V0Q A;  4ARW A;  1WT1 A;  1GWV A;  2RJ5 A;  2VSI A;  3BRK X;  1LZI A;  4EVW A;  1OQM B;  5C49 A;  2AGD A;  1VH3 A;  1LL0 A;  1VGW A;  1WSZ A;  5AJO A;  2NXV A;  2Q4J A;  3SXA A;  1ZI1 A;  4B4B A;  2JCL A;  3POL A;  4B5B A;  3CKQ A;  5FU0 A;  3ST8 A;  3R3I A;  4HO3 A;  2P6W A;  2ZU9 A;  3K8E A;  1ZI5 A;  2PGV A;  1YP4 A;  1GX0 A;  5C1L A;  4FRM A;  4HO4 A;  4ASY A;  3I0K A;  3V0N A;  2VXM A;  4FRB A;  5CQN X;  1JVD A;  5JQQ A;  3V91 A;  3U2V A;  4D0Z A;  2XWN A;  3IOI A;  5IDS A;  1MC3 A;  1ZJ2 A;  2V0L A;  3U2X A;  1ZDF A;  2PX7 A;  3ZLK A;  4P00 A;  2XWM A;  1H7F A;  2AE7 A;  1INI A;  2X5S A;  3SX8 A;  1S4O A;  5D92 A;  1S4P A;  2FYA A;  2AEC A;  1W55 A;  2APC A;  1HM9 A;  5CQO A;  2E8B A;  4FRD A;  2GGQ A;  4FRE A;  1G9R A;  5C4F A;  1PZY B;  3JTJ A;  3SX3 A;  1GQC A;  5EIY A;  2YC5 A;  4JD0 A;  2Y4L A;  1VGU A;  3JUJ A;  3V8Z A;  1E5K A;  1H5S C;  3RSB A;  3DJ4 A;  4FCE A;  4FRP A;  3V0M A;  1LL3 A;  2PGY A;  5IFY A;  3NGW A;  1FZW A;  1ZI4 A;  4KXO A;  1V83 A;  4ZDQ A;  1V82 A;  5C36 A;  2VFZ A;  2AH9 A;  4HO9 A;  3FWW A;  2A8W A;  4KC2 A;  4O6M A;  4HO2 A;  2Y4K A;  1FG5 N;  1YP3 A;  1VZX A;  1H7Q A;  1G2V A;  4KT7 A;  1VZT A;  4EE5 A;  2Y4M A;  1ON6 A;  2YES A;  1ZCV A;  4Y7U A;  4FIY A;  3D5N A;  1YP2 A;  4IRQ A;  1FO9 A;  1R7U A;  3I0F A;  4Y7V A;  1R7X A;  2AES A;  2RJ1 A;  3IOJ A;  1OMZ A;  3OGZ A;  5C1H A;  3O3P A;  5C1G A;  1W77 A;  2I5K A;  3GUE A;  1FXJ A;  5CQP A;  1SS9 A;  1WT2 A;  3QVB A;  1ZCY A;  1H4D A;  1VM8 A;  1G3L A;  1VH1 A;  1O7Q A;  1VGT A;  3KIA A;  4Y7G A;  1O23 B;  3T7M A;  4B42 A;  4FRQ A;  3V8Y A;  1JVG A;  2YCM A;  3N9W A;  4KC4 A;  3PNN A;  4HOC A;  4AAW A;  3TZT A;  4AC3 A;  1QGQ A;  2RIZ A;  4Y6U A;  1R81 A;  4Y6N A;  1FO8 A;  4G87 A;  2QH5 A;  3HL3 A;  3U2W A;  4FRO A;  2AM4 A;  4FCU A;  1H7L A;  3OKR A;  3RMW A;  3V0O A;  4M2A A;  1ZIZ A;  1VPA A;  1FRW A;  2PA4 A;  1INJ A;  3PKQ A;  2VD4 A;  4FRA A;  5D91 A;  1PZT A;  2O1F A;  3U0X A;  2AM5 A;  2Z87 A;  5C47 A;  1G23 A;  3CKN A;  1WT3 A;  2BO6 A;  3ZLL A;  2GGO A;  1KWS A;  2FFV A; 
#chains in the Genus database with same CATH homology
 4FRH A;  1H4C A;  4O6N A;  4HO5 A;  2Z86 A;  3OAM A;  5FYE A;  4MYB A;  4IRP A;  2FYC B;  2XME A;  3I0J A;  1GA8 A;  2W0V A;  5CQM X;  1ZJ1 A;  5C48 A;  4B4G A;  4D0T A;  4DE7 A;  5FUH A;  3SPT A;  2OEG A;  5L6S A;  1S4N A;  1LZ7 A;  1MP3 A;  3I0G A;  1HM8 A;  2WVL A;  1TW1 A;  2RJ9 A;  2YQJ A;  5I1F A;  2WGZ A;  1G93 A;  2FFU A;  1VZU A;  1WT0 A;  2D0J A;  1R7Y A;  4B2X A;  1EZI A;  4Y7T A;  3I0E A;  2V0J A;  3CKV A;  2JCK A;  2BO4 A;  1FXO A;  2P73 A;  3SXE A;  1O0R A;  3JUK A;  4KNX A;  1MP4 A;  1XHB A;  1ZCU A;  4M28 A;  1H7H A;  4L41 C;  1HJL A;  4UEG A;  1ZJP A;  4BQH A;  4DDZ A;  1O7O A;  1H5T B;  3V0L A;  3OH1 A;  4D11 A;  2QKX A;  4FQW A;  3U2U A;  4J18 A;  3ZF8 A;  3Q80 A;  1H7T A;  5IDT A;  4E1K A;  3I0L A;  4M2B A;  2WEE A;  2P72 A;  3OC9 A;  1G0R A;  4NAN A;  1H7E A;  1QWJ A;  1TZF A;  2MZB A;  1LZ0 A;  1MP5 A;  2J0B A;  3E26 A;  2X5Z A;  2JCJ A;  4EE4 A;  4EEM A;  1NF5 B;  4CJB A;  3D8V A;  5EJ1 A;  1HV9 A;  5CMI A;  1YRO B;  4Y63 A;  1LL2 A;  1R7T A;  2RJ8 A;  4NAL A;  3RMV A;  4LW6 A;  4NAK A;  1H5S B;  2ZU8 A;  2VS5 A;  4B4M A;  4KNR A;  1LVW A;  5C38 A;  1ZDG A;  1NWG B;  4G3P A;  4P02 A;  4DEC A;  4K6R A;  3SXG A;  1FGG A;  4GBP A;  1FGX A;  3IOH A;  4Y7F A;  3SX5 A;  3R2W A;  1G97 A;  5DDV A;  4EEA A;  4EE3 A;  3OH3 A;  2V0H A;  4NAI A;  2JCO A;  2WVK A;  3T7O A;  2C0N A;  5BXC A;  4HO8 A;  1FWY A;  3ZGF A;  3SXD A;  1HM0 A;  1JV3 A;  3V90 A;  1H7G A;  1G8O A;  1JYK A;  1ZJ3 A;  2VS4 A;  3F1C A;  3USQ A;  4Y9X A;  2W0W A;  3I0I X;  3SXC A;  5C4E A;  2O1G A;  3DUV A;  1FOA A;  1NQI B;  3F1Y A;  5CQL X;  2XWL A;  5C4B A;  5HS2 A;  1R7V A;  3U2T A;  1ZJ0 A;  3I0C A;  4LW3 A;  4HO0 A;  2E3D A;  4HO6 A;  4HG6 A;  3K8D A;  3OH2 A;  5L6V A;  2D7I A;  4KQL A;  3D98 A;  2WAW A;  3USR A;  2AM3 A;  1G1L A;  4D11 C;  2VXL A;  2CU2 A;  1TW5 A;  5J49 A;  5C4C A;  2WVM A;  4Y64 A;  1HJJ A;  2FYD B;  2V0K A;  2ZU7 A;  1H5R B;  1NHE B;  3E25 A;  2XMH A;  1IIN A;  1ZHJ A;  4FIX A;  5FTV A;  4B3U A;  3I0H A;  2X65 A;  2UX8 A;  2Y6P A;  2FY7 A;  2RIT A;  3Q4S A;  5AJN A;  4EEG A;  3SXB A;  1FR8 A;  4ECM A;  2BO8 A;  3TQD A;  4Q7C A;  2RIX A;  1TVY A;  3CU0 A;  5C3D A;  1K4V A;  2I7B A;  2ICY A;  5EJZ A;  1JYL A;  2J0A A;  2YQH A;  2RIY A;  3I0D A;  2QGI A;  2FYB A;  4YS8 A;  1WVC A;  1Z90 A;  5CMF X;  4JIS A;  2VS3 A;  1XZ6 A;  2Y4J A;  3CGX A;  1QG8 A;  5AJP A;  1H4E A;  1ZJO A;  4ASJ A;  5DDT A;  2OI6 A;  1H5R A;  2O1H A;  4G3Q A;  3FOQ A;  4M4K A;  1LZJ A;  1JV1 A;  3PKP A;  2ICX A;  2DPW A;  2YQS A;  3CKO A;  1QGS A;  1R80 A;  4FRL A;  4CJC A;  2A8U A;  4AYJ A;  3U0Y A;  1GQ9 A;  2I5E A;  1ZI3 A;  2OEF A;  3ZGG A;  1V84 A;  2OI5 A;  4B2W A;  2V0I A;  5FV9 A;  2VSH A;  3DK5 A;  5FU8 A;  5CMJ A;  1NKH B;  2OI7 A;  4KRV A;  2BO7 A;  3OH4 A;  5C4D A;  3SX7 A;  5CMG X;  4CVH A;  4MIX A;  2D7R A;  4KC1 A;  4C2S A;  3CKJ A;  4AYL A;  2RJ6 A;  1H3M A;  2X60 A;  2YC3 A;  3Q7U A;  1I52 A;  1NMM B;  3V0P A;  4XWI A;  1VIC A;  1H5T A;  4EEO A;  2RJ0 A;  1ZCT A;  1G95 A;  4KPX A;  4G3S A;  1OMX A;  1EYR A;  1W57 A;  5CMH A;  1H5S D;  2RJ4 A;  3LW6 A;  4CJ8 A;  1GX4 A;  1GWW A;  5C8R A;  1R82 A;  3EE5 A;  2YQC A;  5C3A A;  4R7P A;  2WE9 A;  4BMA A;  4D48 A;  2RJ7 A;  4Y62 A;  1VGZ A;  2Y7A A;  3BCV A;  1ON8 A;  4HCQ A;  1H5S A;  5C3B A;  1IIM A;  2VK9 A;  1FR9 A;  4MND A;  3T7N A;  5FTS A;  4KPZ A;  3OH0 A;  3V0Q A;  4ARW A;  1WT1 A;  1GWV A;  2RJ5 A;  2VSI A;  3BRK X;  1LZI A;  4EVW A;  1OQM B;  5C49 A;  2AGD A;  1VH3 A;  1LL0 A;  1VGW A;  1WSZ A;  5AJO A;  2NXV A;  2Q4J A;  3SXA A;  1ZI1 A;  4B4B A;  2JCL A;  3POL A;  4B5B A;  3CKQ A;  5FU0 A;  3ST8 A;  3R3I A;  4HO3 A;  2P6W A;  2ZU9 A;  3K8E A;  1ZI5 A;  2PGV A;  1YP4 A;  1GX0 A;  5C1L A;  4FRM A;  4HO4 A;  4ASY A;  3I0K A;  3V0N A;  2VXM A;  4FRB A;  5CQN X;  1JVD A;  5JQQ A;  3V91 A;  3U2V A;  4D0Z A;  2XWN A;  3IOI A;  5IDS A;  1MC3 A;  1ZJ2 A;  2V0L A;  3U2X A;  1ZDF A;  2PX7 A;  3ZLK A;  4P00 A;  2XWM A;  1H7F A;  2AE7 A;  1INI A;  2X5S A;  3SX8 A;  1S4O A;  5D92 A;  1S4P A;  2FYA A;  2AEC A;  1W55 A;  2APC A;  1HM9 A;  5CQO A;  2E8B A;  4FRD A;  2GGQ A;  4FRE A;  1G9R A;  5C4F A;  1PZY B;  3JTJ A;  3SX3 A;  1GQC A;  5EIY A;  2YC5 A;  4JD0 A;  2Y4L A;  1VGU A;  3JUJ A;  3V8Z A;  1E5K A;  1H5S C;  3RSB A;  3DJ4 A;  4FCE A;  4FRP A;  3V0M A;  1LL3 A;  2PGY A;  5IFY A;  3NGW A;  1FZW A;  1ZI4 A;  4KXO A;  1V83 A;  4ZDQ A;  1V82 A;  5C36 A;  2VFZ A;  2AH9 A;  4HO9 A;  3FWW A;  2A8W A;  4KC2 A;  4O6M A;  4HO2 A;  2Y4K A;  1FG5 N;  1YP3 A;  1VZX A;  1H7Q A;  1G2V A;  4KT7 A;  1VZT A;  4EE5 A;  2Y4M A;  1ON6 A;  2YES A;  1ZCV A;  4Y7U A;  4FIY A;  3D5N A;  1YP2 A;  4IRQ A;  1FO9 A;  1R7U A;  3I0F A;  4Y7V A;  1R7X A;  2AES A;  2RJ1 A;  3IOJ A;  1OMZ A;  3OGZ A;  5C1H A;  3O3P A;  5C1G A;  1W77 A;  2I5K A;  3GUE A;  1FXJ A;  5CQP A;  1SS9 A;  1WT2 A;  3QVB A;  1ZCY A;  1H4D A;  1VM8 A;  1G3L A;  1VH1 A;  1O7Q A;  1VGT A;  3KIA A;  4Y7G A;  1O23 B;  3T7M A;  4B42 A;  4FRQ A;  3V8Y A;  1JVG A;  2YCM A;  3N9W A;  4KC4 A;  3PNN A;  4HOC A;  4AAW A;  3TZT A;  4AC3 A;  1QGQ A;  2RIZ A;  4Y6U A;  1R81 A;  4Y6N A;  1FO8 A;  4G87 A;  2QH5 A;  3HL3 A;  3U2W A;  4FRO A;  2AM4 A;  4FCU A;  1H7L A;  3OKR A;  3RMW A;  3V0O A;  4M2A A;  1ZIZ A;  1VPA A;  1FRW A;  2PA4 A;  1INJ A;  3PKQ A;  2VD4 A;  4FRA A;  5D91 A;  1PZT A;  2O1F A;  3U0X A;  2AM5 A;  2Z87 A;  5C47 A;  1G23 A;  3CKN A;  1WT3 A;  2BO6 A;  3ZLL A;  2GGO A;  1KWS A;  2FFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...