4C2SA

Crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta p156l mutant) in complex with udp and deoxy-h-antigen acceptor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
291
structure length
291
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HISTO-BLOOD GROUP ABO SYSTEM TRANSFERASE
publication title Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Posessing the Pro156Leu Mutation
rcsb
source organism Homo sapiens
total genus 91
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4c2sA00
1H5TB 2ZU9A 3EE5A 4EEMA 2V0LA 1GQ9A 4E1KA 3CKNA 1WT1A 1YP3A 4FCUA 3GUEA 3K8EA 5FYEA 1VZXA 3FWWA 5AJPA 3V0PA 1WT3A 1G97A 4MYBA 3OC9A 3DUVA 4G3QA 1LL2A 2VS4A 2FYAA 1O0RA 4DE7A 5CMHA 1W57A 2ZU7A 4B4MA 2O1HA 2VS5A 4KC2A 2UX8A 2NXVA 1MP4A 3V0QA 1VH1A 1H5SC 4ASYA 2X5ZA 1H5RA 3CKQA 2PX7A 1GWWA 4KC1A 2OEFA 4IRQA 3V0OA 4FRMA 5C3AA 4EEOA 3N9WA 2AM3A 5EJZA 4D11C 1H5SB 2RJ4A 5L6SA 1H5TA 3O3PA 2FYDB 2RJ0A 4ZDQA 2AM4A 1ZCVA 4KC4A 2CU2A 2RJ9A 3ST8A 4FRAA 4IRPA 1OQMB 2X65A 2BO4A 3OH4A 2YQSA 2Z86A 1WT2A 1HV9A 4P00A 1HM0A 3V0LA 2XWNA 3CU0A 2RJ5A 3Q80A 2VFZA 5C49A 1H3MA 2BO8A 2QGIA 3SXBA 3ZF8A 3D8VA 4Y7UA 1ZJ3A 2O1FA 2VSHA 4XWIA 2P73A 4NAIA 3CKOA 4LW3A 1H7TA 5L6VA 1WSZA 5CQPA 2PGYA 4D11A 2V0KA 5C1GA 1R82A 2YQHA 4KQLA 4FRLA 1ZJPA 3R3IA 2Y4JA 3CKJA 2O1GA 1LL0A 2VXMA 5IDTA 2VSIA 4KNRA 4DDZA 1G3LA 3RMVA 5CMGX 2AM5A 4Y6NA 3U0YA 4K6RA 5DDTA 5JQQA 3U2WA 3CKVA 1VGUA 2Z87A 3I0EA 2Y4KA 5IFYA 1G23A 4HO8A 2V0IA 5HS2A 2FFUA 3I0KA 1G1LA 4HO3A 4HO4A 3SXEA 2FYBA 1FR8A 4Y7TA 2AESA 4FRHA 3U2XA 5C1HA 1VPAA 4B2WA 3PNNA 1E5KA 3USRA 1JYLA 3ZLKA 1FGXA 5C38A 5C36A 3T7OA 1G2VA 2GGOA 1I52A 1TZFA 2V0HA 2OI5A 4Y64A 2XMEA 5C3BA 1G8OA 3SX3A 1XZ6A 1IIMA 1GWVA 1VGTA 1ZJ1A 4EEGA 2QH5A 1GX0A 2BO7A 2PA4A 1QGQA 1YP4A 2V0JA 1JYKA 1GA8A 5C4CA 1WVCA 3Q7UA 2FYCB 1H7FA 4GBPA 2E8BA 4HO0A 2RJ8A 3PKPA 1ZI5A 1HJLA 2Y4LA 3F1CA 4Y9XA 3OH0A 2RIYA 1KWSA 1ZI4A 1H5SD 1PZTA 1NMMB 3SXDA 1H7EA 1HJJA 4B4BA 2E3DA 4KPXA 4MNDA 5C4DA 2AE7A 4D0TA 1JVDA 1V84A 3T7NA 1H7LA 5CQNX 2WVKA 2YCMA 2FFVA 2P72A 1VM8A 3I0FA 3BCVA 3OH2A 1H4DA 1ZHJA 1OMXA 4CJCA 2BO6A 5C1LA 4LW6A 2WE9A 4D48A 1ZI3A 4ASJA 1NKHB 1LVWA 1FR9A 3OH3A 4G87A 4HCQA 2PGVA 2YC5A 2RJ1A 5AJNA 1TVYA 2D7RA 2Q4JA 4Y63A 1S4PA 2W0WA 3JTJA 4EE5A 2RIZA 5BXCA 1ON6A 1R7UA 1GX4A 1MP5A 2I5KA 3NGWA 3V90A 2JCLA 2ICXA 3IOJA 4B4GA 3I0GA 5FU8A 1INIA 1FGGA 1ZDGA 4EEAA 3RSBA 5C4BA 2AECA 4KT7A 4B3UA 1ZJOA 1FWYA 3OGZA 4Y62A 1R7TA 5FU0A 4NAKA 1EYRA 2OI7A 4KNXA 2WEEA 4ECMA 1LZ7A 4L41C 1O7QA 5CQMX 4D0ZA 2XMHA 5EIYA 2YQJA 1GQCA 2QKXA 1LZIA 2DPWA 2XWMA 5FTSA 4YS8A 1FG5N 2YESA 1H7GA 3OKRA 1SS9A 2APCA 5FV9A 3SPTA 2I5EA 4Y7VA 1TW5A 3V0MA 2X60A 4KRVA 1OMZA 1W77A 2JCJA 4Y6UA 2RJ7A 3IOIA 1Z90A 3E26A 4FRQA 4EE3A 5C4EA 3U2VA 3ZGFA 2ZU8A 4CVHA 1O7OA 4FRDA 1H4CA 4Y7GA 2VD4A 1ON8A 4FCEA 2W0VA 2AGDA 4EE4A 5C48A 3SXCA 3DK5A 4Y7FA 3JUJA 2RIXA 1G0RA 4AYLA 2YQCA 4UEGA 2Y7AA 1K4VA 5CMIA 2AH9A 1ZDFA 4JISA 1V83A 1IINA 1NHEB 2OI6A 3V8ZA 1ZCUA 1VH3A 3CGXA 3FOQA 4FRPA 2Y6PA 3JUKA 4M4KA 1MP3A 1MC3A 2MZBA 3I0DA 3USQA 3TQDA 1LZJA 3D98A 2VS3A 1FXOA 3QVBA 3R2WA 4FQWA 3SX7A 3TZTA 1FXJA 1FRWA 4M2AA 1R7XA 3V8YA 1ZCYA 4P02A 4DECA 1QWJA 5DDVA 1XHBA 1FZWA 4M28A 4BQHA 3SX8A 1WT0A 4G3PA 2FY7A 4HG6A 2JCOA 1S4NA 3I0CA 4HO6A 3V0NA 2RJ6A 2ICYA 3T7MA 1PZYB 2OEGA 3V91A 1FO8A 1H4EA 5CMJA 4HOCA 1YP2A 1VICA 1W55A 4AAWA 4HO5A 2A8UA 2WVLA 4JD0A 1FOAA 3KIAA 4J18A 4EVWA 1H7QA 4BMAA 1R7YA 2WVMA 3Q4SA 1NWGB 4AYJA 5C47A 4M2BA 1JV3A 1JV1A 1ZJ2A 2D0JA 3PKQA 3SXAA 4FRBA 3ZGGA 3F1YA 1HM9A 2WAWA 1G93A 4HO2A 5FTVA 3I0HA 4HO9A 1FO9A 1ZJ0A 1ZCTA 3U0XA 2RITA 2X5SA 3I0JA 3POLA 1TW1A 5AJOA 1VZUA 1G9RA 2A8WA 1NQIB 3RMWA 3D5NA 3SX5A 5EJ1A 1ZI1A 1H5SA 1EZIA 5C3DA 4AC3A 5IDSA 1R80A 3U2TA 1VGZA 1JVGA 2P6WA 3SXGA 2GGQA 4NANA 3ZLLA 3DJ4A 1YROB 2D7IA 4B2XA 5C4FA 5I1FA 1LZ0A 3I0LA 5C8RA 1V82A 1LL3A 5FUHA 1QG8A 2YC3A 5CQOA 3E25A 1G95A 4KXOA 3I0IX 4NALA 4FREA 2Y4MA 3LW6A 2WGZA 1VZTA 3HL3A 5CQLX 4C2SA 1O23B 1NF5B 3IOHA 4ARWA 4FROA 2I7BA 4R7PA 4B5BA 1INJA 3OAMA 3OH1A 1H7HA 1R7VA 3U2UA 4G3SA 2XWLA 2JCKA 4CJ8A 3BRKX 5CMFX 1QGSA 4KPZA 1R81A 1H5RB 3K8DA 1HM8A 1S4OA 1ZIZA 4B42A 5J49A 2VXLA 4CJBA 1VGWA
chains in the Genus database with same CATH superfamily
1H5TB 2ZU9A 3EE5A 4EEMA 2V0LA 1GQ9A 4E1KA 3CKNA 1WT1A 1YP3A 4FCUA 3GUEA 3K8EA 5FYEA 1VZXA 3FWWA 5AJPA 3V0PA 1WT3A 1G97A 4MYBA 3OC9A 3DUVA 4G3QA 2VK9A 1LL2A 2VS4A 2FYAA 1O0RA 4DE7A 5CMHA 1W57A 2ZU7A 4B4MA 2O1HA 2VS5A 4KC2A 2UX8A 2NXVA 1MP4A 3V0QA 1VH1A 1H5SC 4ASYA 2X5ZA 1H5RA 3CKQA 2PX7A 1GWWA 4KC1A 2OEFA 4IRQA 3V0OA 4FRMA 5C3AA 4EEOA 3N9WA 2AM3A 5EJZA 4D11C 1H5SB 2RJ4A 5L6SA 1H5TA 3O3PA 2FYDB 2RJ0A 4ZDQA 2AM4A 1ZCVA 4KC4A 2CU2A 2RJ9A 3ST8A 4FRAA 4IRPA 1OQMB 2X65A 2BO4A 3OH4A 2YQSA 2Z86A 1WT2A 1HV9A 4P00A 1HM0A 3V0LA 2XWNA 3CU0A 2RJ5A 3Q80A 2VFZA 5C49A 1H3MA 2BO8A 2QGIA 5D92A 3SXBA 3ZF8A 3D8VA 4Y7UA 1ZJ3A 2O1FA 2VSHA 4XWIA 2P73A 4NAIA 3CKOA 4LW3A 1H7TA 5L6VA 1WSZA 5CQPA 2PGYA 4D11A 2V0KA 5C1GA 1R82A 2YQHA 4KQLA 4FRLA 1ZJPA 3R3IA 2Y4JA 3CKJA 4FIXA 2O1GA 1LL0A 2VXMA 5IDTA 2VSIA 4KNRA 4DDZA 1G3LA 3RMVA 5CMGX 2AM5A 4Y6NA 3U0YA 4K6RA 5DDTA 2J0BA 5JQQA 3U2WA 3CKVA 1VGUA 2Z87A 3I0EA 2Y4KA 5IFYA 1G23A 4HO8A 2V0IA 5HS2A 2FFUA 3I0KA 1G1LA 4HO3A 4HO4A 3SXEA 2FYBA 1FR8A 4Y7TA 2AESA 4FRHA 3U2XA 5C1HA 1VPAA 4B2WA 3PNNA 1E5KA 3USRA 1JYLA 3ZLKA 1FGXA 5C38A 5C36A 3T7OA 1G2VA 2GGOA 1I52A 1TZFA 2V0HA 2OI5A 4Y64A 2XMEA 5C3BA 1G8OA 3SX3A 1XZ6A 1IIMA 1GWVA 1VGTA 1ZJ1A 4EEGA 2QH5A 1GX0A 2BO7A 2PA4A 1QGQA 1YP4A 2V0JA 1JYKA 1GA8A 5C4CA 1WVCA 3Q7UA 2FYCB 1H7FA 4GBPA 2E8BA 4HO0A 2RJ8A 3PKPA 1ZI5A 1HJLA 2Y4LA 3F1CA 4Y9XA 3OH0A 2RIYA 1KWSA 1ZI4A 1H5SD 1PZTA 1NMMB 3SXDA 1H7EA 1HJJA 4B4BA 2E3DA 4KPXA 4MNDA 5C4DA 2AE7A 4D0TA 1JVDA 1V84A 3T7NA 1H7LA 2C0NA 5CQNX 2WVKA 2YCMA 2FFVA 2P72A 1VM8A 3I0FA 3BCVA 3OH2A 1H4DA 1ZHJA 1OMXA 4CJCA 2BO6A 5C1LA 4LW6A 2WE9A 4D48A 1ZI3A 4ASJA 1NKHB 1LVWA 1FR9A 3OH3A 4G87A 4HCQA 2PGVA 2YC5A 2RJ1A 5AJNA 1TVYA 2D7RA 2Q4JA 4Y63A 1S4PA 2W0WA 3JTJA 4O6NA 4EE5A 2RIZA 5BXCA 1ON6A 1R7UA 1GX4A 1MP5A 2I5KA 3NGWA 3V90A 2JCLA 2ICXA 3IOJA 4B4GA 3I0GA 5FU8A 1INIA 1FGGA 1ZDGA 4EEAA 3RSBA 5C4BA 2AECA 4KT7A 4B3UA 5D91A 1ZJOA 1FWYA 3OGZA 4Y62A 1R7TA 5FU0A 4NAKA 1EYRA 2OI7A 4KNXA 2WEEA 4ECMA 1LZ7A 4L41C 1O7QA 5CQMX 4D0ZA 2XMHA 5EIYA 2YQJA 1GQCA 2QKXA 1LZIA 2DPWA 2XWMA 5FTSA 4YS8A 1FG5N 2YESA 1H7GA 3OKRA 1SS9A 2APCA 5FV9A 3SPTA 2I5EA 4Y7VA 1TW5A 3V0MA 2X60A 4KRVA 1OMZA 1W77A 2JCJA 4Y6UA 2RJ7A 3IOIA 1Z90A 3E26A 4FRQA 4EE3A 5C4EA 3U2VA 3ZGFA 2ZU8A 4CVHA 1O7OA 4FRDA 1H4CA 4Y7GA 2VD4A 1ON8A 4FCEA 2W0VA 2AGDA 4EE4A 5C48A 3SXCA 4O6MA 3DK5A 4Y7FA 3JUJA 2RIXA 1G0RA 4AYLA 2YQCA 4UEGA 2Y7AA 1K4VA 5CMIA 2AH9A 1ZDFA 4JISA 1V83A 1IINA 1NHEB 2J0AA 2OI6A 3V8ZA 1ZCUA 1VH3A 3CGXA 3FOQA 4FRPA 2Y6PA 3JUKA 4M4KA 1MP3A 1MC3A 2MZBA 3I0DA 3USQA 3TQDA 1LZJA 3D98A 2VS3A 1FXOA 3QVBA 3R2WA 4FQWA 3SX7A 3TZTA 1FXJA 1FRWA 4M2AA 1R7XA 4FIYA 4Q7CA 3V8YA 1ZCYA 4P02A 4DECA 1QWJA 5DDVA 1XHBA 1FZWA 4M28A 4BQHA 3SX8A 1WT0A 4G3PA 2FY7A 4HG6A 2JCOA 1S4NA 3I0CA 4HO6A 3V0NA 2RJ6A 2ICYA 3T7MA 1PZYB 2OEGA 3V91A 1FO8A 1H4EA 5CMJA 4HOCA 1YP2A 1VICA 1W55A 4AAWA 4HO5A 2A8UA 4MIXA 2WVLA 4JD0A 1FOAA 3KIAA 4J18A 4EVWA 1H7QA 4BMAA 1R7YA 2WVMA 3Q4SA 1NWGB 4AYJA 5C47A 4M2BA 1JV3A 1JV1A 1ZJ2A 2D0JA 3PKQA 3SXAA 4FRBA 3ZGGA 3F1YA 1HM9A 2WAWA 1G93A 4HO2A 5FTVA 3I0HA 4HO9A 1FO9A 1ZJ0A 1ZCTA 3U0XA 2RITA 2X5SA 3I0JA 3POLA 1TW1A 5AJOA 1VZUA 1G9RA 2A8WA 1NQIB 3RMWA 3D5NA 3SX5A 5EJ1A 1ZI1A 1H5SA 1EZIA 5C3DA 4AC3A 5IDSA 1R80A 3U2TA 1VGZA 1JVGA 2P6WA 3SXGA 2GGQA 4NANA 3ZLLA 3DJ4A 1YROB 2D7IA 4B2XA 5C4FA 5I1FA 1LZ0A 3I0LA 5C8RA 1V82A 1LL3A 5FUHA 1QG8A 2YC3A 5CQOA 3E25A 1G95A 4KXOA 3I0IX 4NALA 4FREA 2Y4MA 3LW6A 2WGZA 1VZTA 3HL3A 5CQLX 4C2SA 1O23B 1NF5B 3IOHA 4ARWA 4FROA 2I7BA 4R7PA 4B5BA 1INJA 3OAMA 3OH1A 1H7HA 1R7VA 3U2UA 4G3SA 2XWLA 2JCKA 4CJ8A 3BRKX 5CMFX 1QGSA 4KPZA 1R81A 1H5RB 3K8DA 1HM8A 1S4OA 1ZIZA 4B42A 5J49A 2VXLA 4CJBA 1VGWA
chains in the Genus database with same CATH topology
1H5TB 2ZU9A 3EE5A 4EEMA 2V0LA 1GQ9A 4E1KA 3CKNA 1WT1A 1YP3A 4FCUA 3GUEA 3K8EA 5FYEA 1VZXA 3FWWA 5AJPA 3V0PA 1WT3A 1G97A 4MYBA 3OC9A 3DUVA 4G3QA 2VK9A 1LL2A 2VS4A 2FYAA 1O0RA 4DE7A 5CMHA 1W57A 2ZU7A 4B4MA 2O1HA 2VS5A 4KC2A 2UX8A 2NXVA 1MP4A 3V0QA 1VH1A 1H5SC 4ASYA 2X5ZA 1H5RA 3CKQA 2PX7A 1GWWA 4KC1A 2OEFA 4IRQA 3V0OA 4FRMA 5C3AA 4EEOA 3N9WA 2AM3A 5EJZA 4D11C 1H5SB 2RJ4A 5L6SA 1H5TA 3O3PA 2FYDB 2RJ0A 4ZDQA 2AM4A 1ZCVA 4KC4A 2CU2A 2RJ9A 3ST8A 4FRAA 4IRPA 1OQMB 2X65A 2BO4A 3OH4A 2YQSA 2Z86A 1WT2A 1HV9A 4P00A 1HM0A 3V0LA 2XWNA 3CU0A 2RJ5A 3Q80A 2VFZA 5C49A 1H3MA 2BO8A 2QGIA 5D92A 3SXBA 3ZF8A 3D8VA 4Y7UA 1ZJ3A 2O1FA 2VSHA 4XWIA 2P73A 4NAIA 3CKOA 4LW3A 1H7TA 5L6VA 1WSZA 5CQPA 2PGYA 4D11A 2V0KA 5C1GA 1R82A 2YQHA 4KQLA 4FRLA 1ZJPA 3R3IA 2Y4JA 3CKJA 4FIXA 2O1GA 1LL0A 2VXMA 5IDTA 2VSIA 4KNRA 4DDZA 1G3LA 3RMVA 5CMGX 2AM5A 4Y6NA 3U0YA 4K6RA 5DDTA 2J0BA 5JQQA 3U2WA 3CKVA 1VGUA 2Z87A 3I0EA 2Y4KA 5IFYA 1G23A 4HO8A 2V0IA 5HS2A 2FFUA 3I0KA 1G1LA 4HO3A 4HO4A 3SXEA 2FYBA 1FR8A 4Y7TA 2AESA 4FRHA 3U2XA 5C1HA 1VPAA 4B2WA 3PNNA 1E5KA 3USRA 1JYLA 3ZLKA 1FGXA 5C38A 5C36A 3T7OA 1G2VA 2GGOA 1I52A 1TZFA 2V0HA 2OI5A 4Y64A 2XMEA 5C3BA 1G8OA 3SX3A 1XZ6A 1IIMA 1GWVA 1VGTA 1ZJ1A 4EEGA 2QH5A 1GX0A 2BO7A 2PA4A 1QGQA 1YP4A 2V0JA 1JYKA 1GA8A 5C4CA 1WVCA 3Q7UA 2FYCB 1H7FA 4GBPA 2E8BA 4HO0A 2RJ8A 3PKPA 1ZI5A 1HJLA 2Y4LA 3F1CA 4Y9XA 3OH0A 2RIYA 1KWSA 1ZI4A 1H5SD 1PZTA 1NMMB 3SXDA 1H7EA 1HJJA 4B4BA 2E3DA 4KPXA 4MNDA 5C4DA 2AE7A 4D0TA 1JVDA 1V84A 3T7NA 1H7LA 2C0NA 5CQNX 2WVKA 2YCMA 2FFVA 2P72A 1VM8A 3I0FA 3BCVA 3OH2A 1H4DA 1ZHJA 1OMXA 4CJCA 2BO6A 5C1LA 4LW6A 2WE9A 4D48A 1ZI3A 4ASJA 1NKHB 1LVWA 1FR9A 3OH3A 4G87A 4HCQA 2PGVA 2YC5A 2RJ1A 5AJNA 1TVYA 2D7RA 2Q4JA 4Y63A 1S4PA 2W0WA 3JTJA 4O6NA 4EE5A 2RIZA 5BXCA 1ON6A 1R7UA 1GX4A 1MP5A 2I5KA 3NGWA 3V90A 2JCLA 2ICXA 3IOJA 4B4GA 3I0GA 5FU8A 1INIA 1FGGA 1ZDGA 4EEAA 3RSBA 5C4BA 2AECA 4KT7A 4B3UA 5D91A 1ZJOA 1FWYA 3OGZA 4Y62A 1R7TA 5FU0A 4NAKA 1EYRA 2OI7A 4KNXA 2WEEA 4ECMA 1LZ7A 4L41C 1O7QA 5CQMX 4D0ZA 2XMHA 5EIYA 2YQJA 1GQCA 2QKXA 1LZIA 2DPWA 2XWMA 5FTSA 4YS8A 1FG5N 2YESA 1H7GA 3OKRA 1SS9A 2APCA 5FV9A 3SPTA 2I5EA 4Y7VA 1TW5A 3V0MA 2X60A 4KRVA 1OMZA 1W77A 2JCJA 4Y6UA 2RJ7A 3IOIA 1Z90A 3E26A 4FRQA 4EE3A 5C4EA 3U2VA 3ZGFA 2ZU8A 4CVHA 1O7OA 4FRDA 1H4CA 4Y7GA 2VD4A 1ON8A 4FCEA 2W0VA 2AGDA 4EE4A 5C48A 3SXCA 4O6MA 3DK5A 4Y7FA 3JUJA 2RIXA 1G0RA 4AYLA 2YQCA 4UEGA 2Y7AA 1K4VA 5CMIA 2AH9A 1ZDFA 4JISA 1V83A 1IINA 1NHEB 2J0AA 2OI6A 3V8ZA 1ZCUA 1VH3A 3CGXA 3FOQA 4FRPA 2Y6PA 3JUKA 4M4KA 1MP3A 1MC3A 2MZBA 3I0DA 3USQA 3TQDA 1LZJA 3D98A 2VS3A 1FXOA 3QVBA 3R2WA 4FQWA 3SX7A 3TZTA 1FXJA 1FRWA 4M2AA 1R7XA 4FIYA 4Q7CA 3V8YA 1ZCYA 4P02A 4DECA 1QWJA 5DDVA 1XHBA 1FZWA 4M28A 4BQHA 3SX8A 1WT0A 4G3PA 2FY7A 4HG6A 2JCOA 1S4NA 3I0CA 4HO6A 3V0NA 2RJ6A 2ICYA 3T7MA 1PZYB 2OEGA 3V91A 1FO8A 1H4EA 5CMJA 4HOCA 1YP2A 1VICA 1W55A 4AAWA 4HO5A 2A8UA 4MIXA 2WVLA 4JD0A 1FOAA 3KIAA 4J18A 4EVWA 1H7QA 4BMAA 1R7YA 2WVMA 3Q4SA 1NWGB 4AYJA 5C47A 4M2BA 1JV3A 1JV1A 1ZJ2A 2D0JA 3PKQA 3SXAA 4FRBA 3ZGGA 3F1YA 1HM9A 2WAWA 1G93A 4HO2A 5FTVA 3I0HA 4HO9A 1FO9A 1ZJ0A 1ZCTA 3U0XA 2RITA 2X5SA 3I0JA 3POLA 1TW1A 5AJOA 1VZUA 1G9RA 2A8WA 1NQIB 3RMWA 3D5NA 3SX5A 5EJ1A 1ZI1A 1H5SA 1EZIA 5C3DA 4AC3A 5IDSA 1R80A 3U2TA 1VGZA 1JVGA 2P6WA 3SXGA 2GGQA 4NANA 3ZLLA 3DJ4A 1YROB 2D7IA 4B2XA 5C4FA 5I1FA 1LZ0A 3I0LA 5C8RA 1V82A 1LL3A 5FUHA 1QG8A 2YC3A 5CQOA 3E25A 1G95A 4KXOA 3I0IX 4NALA 4FREA 2Y4MA 3LW6A 2WGZA 1VZTA 3HL3A 5CQLX 4C2SA 1O23B 1NF5B 3IOHA 4ARWA 4FROA 2I7BA 4R7PA 4B5BA 1INJA 3OAMA 3OH1A 1H7HA 1R7VA 3U2UA 4G3SA 2XWLA 2JCKA 4CJ8A 3BRKX 5CMFX 1QGSA 4KPZA 1R81A 1H5RB 3K8DA 1HM8A 1S4OA 1ZIZA 4B42A 5J49A 2VXLA 4CJBA 1VGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5T B;  2ZU9 A;  3EE5 A;  4EEM A;  2V0L A;  1GQ9 A;  4E1K A;  3CKN A;  1WT1 A;  1YP3 A;  4FCU A;  3GUE A;  3K8E A;  5FYE A;  1VZX A;  3FWW A;  5AJP A;  3V0P A;  1WT3 A;  1G97 A;  4MYB A;  3OC9 A;  3DUV A;  4G3Q A;  1LL2 A;  2VS4 A;  2FYA A;  1O0R A;  4DE7 A;  5CMH A;  1W57 A;  2ZU7 A;  4B4M A;  2O1H A;  2VS5 A;  4KC2 A;  2UX8 A;  2NXV A;  1MP4 A;  3V0Q A;  1VH1 A;  1H5S C;  4ASY A;  2X5Z A;  1H5R A;  3CKQ A;  2PX7 A;  1GWW A;  4KC1 A;  2OEF A;  4IRQ A;  3V0O A;  4FRM A;  5C3A A;  4EEO A;  3N9W A;  2AM3 A;  5EJZ A;  4D11 C;  1H5S B;  2RJ4 A;  5L6S A;  1H5T A;  3O3P A;  2FYD B;  2RJ0 A;  4ZDQ A;  2AM4 A;  1ZCV A;  4KC4 A;  2CU2 A;  2RJ9 A;  3ST8 A;  4FRA A;  4IRP A;  1OQM B;  2X65 A;  2BO4 A;  3OH4 A;  2YQS A;  2Z86 A;  1WT2 A;  1HV9 A;  4P00 A;  1HM0 A;  3V0L A;  2XWN A;  3CU0 A;  2RJ5 A;  3Q80 A;  2VFZ A;  5C49 A;  1H3M A;  2BO8 A;  2QGI A;  3SXB A;  3ZF8 A;  3D8V A;  4Y7U A;  1ZJ3 A;  2O1F A;  2VSH A;  4XWI A;  2P73 A;  4NAI A;  3CKO A;  4LW3 A;  1H7T A;  5L6V A;  1WSZ A;  5CQP A;  2PGY A;  4D11 A;  2V0K A;  5C1G A;  1R82 A;  2YQH A;  4KQL A;  4FRL A;  1ZJP A;  3R3I A;  2Y4J A;  3CKJ A;  2O1G A;  1LL0 A;  2VXM A;  5IDT A;  2VSI A;  4KNR A;  4DDZ A;  1G3L A;  3RMV A;  5CMG X;  2AM5 A;  4Y6N A;  3U0Y A;  4K6R A;  5DDT A;  5JQQ A;  3U2W A;  3CKV A;  1VGU A;  2Z87 A;  3I0E A;  2Y4K A;  5IFY A;  1G23 A;  4HO8 A;  2V0I A;  5HS2 A;  2FFU A;  3I0K A;  1G1L A;  4HO3 A;  4HO4 A;  3SXE A;  2FYB A;  1FR8 A;  4Y7T A;  2AES A;  4FRH A;  3U2X A;  5C1H A;  1VPA A;  4B2W A;  3PNN A;  1E5K A;  3USR A;  1JYL A;  3ZLK A;  1FGX A;  5C38 A;  5C36 A;  3T7O A;  1G2V A;  2GGO A;  1I52 A;  1TZF A;  2V0H A;  2OI5 A;  4Y64 A;  2XME A;  5C3B A;  1G8O A;  3SX3 A;  1XZ6 A;  1IIM A;  1GWV A;  1VGT A;  1ZJ1 A;  4EEG A;  2QH5 A;  1GX0 A;  2BO7 A;  2PA4 A;  1QGQ A;  1YP4 A;  2V0J A;  1JYK A;  1GA8 A;  5C4C A;  1WVC A;  3Q7U A;  2FYC B;  1H7F A;  4GBP A;  2E8B A;  4HO0 A;  2RJ8 A;  3PKP A;  1ZI5 A;  1HJL A;  2Y4L A;  3F1C A;  4Y9X A;  3OH0 A;  2RIY A;  1KWS A;  1ZI4 A;  1H5S D;  1PZT A;  1NMM B;  3SXD A;  1H7E A;  1HJJ A;  4B4B A;  2E3D A;  4KPX A;  4MND A;  5C4D A;  2AE7 A;  4D0T A;  1JVD A;  1V84 A;  3T7N A;  1H7L A;  5CQN X;  2WVK A;  2YCM A;  2FFV A;  2P72 A;  1VM8 A;  3I0F A;  3BCV A;  3OH2 A;  1H4D A;  1ZHJ A;  1OMX A;  4CJC A;  2BO6 A;  5C1L A;  4LW6 A;  2WE9 A;  4D48 A;  1ZI3 A;  4ASJ A;  1NKH B;  1LVW A;  1FR9 A;  3OH3 A;  4G87 A;  4HCQ A;  2PGV A;  2YC5 A;  2RJ1 A;  5AJN A;  1TVY A;  2D7R A;  2Q4J A;  4Y63 A;  1S4P A;  2W0W A;  3JTJ A;  4EE5 A;  2RIZ A;  5BXC A;  1ON6 A;  1R7U A;  1GX4 A;  1MP5 A;  2I5K A;  3NGW A;  3V90 A;  2JCL A;  2ICX A;  3IOJ A;  4B4G A;  3I0G A;  5FU8 A;  1INI A;  1FGG A;  1ZDG A;  4EEA A;  3RSB A;  5C4B A;  2AEC A;  4KT7 A;  4B3U A;  1ZJO A;  1FWY A;  3OGZ A;  4Y62 A;  1R7T A;  5FU0 A;  4NAK A;  1EYR A;  2OI7 A;  4KNX A;  2WEE A;  4ECM A;  1LZ7 A;  4L41 C;  1O7Q A;  5CQM X;  4D0Z A;  2XMH A;  5EIY A;  2YQJ A;  1GQC A;  2QKX A;  1LZI A;  2DPW A;  2XWM A;  5FTS A;  4YS8 A;  1FG5 N;  2YES A;  1H7G A;  3OKR A;  1SS9 A;  2APC A;  5FV9 A;  3SPT A;  2I5E A;  4Y7V A;  1TW5 A;  3V0M A;  2X60 A;  4KRV A;  1OMZ A;  1W77 A;  2JCJ A;  4Y6U A;  2RJ7 A;  3IOI A;  1Z90 A;  3E26 A;  4FRQ A;  4EE3 A;  5C4E A;  3U2V A;  3ZGF A;  2ZU8 A;  4CVH A;  1O7O A;  4FRD A;  1H4C A;  4Y7G A;  2VD4 A;  1ON8 A;  4FCE A;  2W0V A;  2AGD A;  4EE4 A;  5C48 A;  3SXC A;  3DK5 A;  4Y7F A;  3JUJ A;  2RIX A;  1G0R A;  4AYL A;  2YQC A;  4UEG A;  2Y7A A;  1K4V A;  5CMI A;  2AH9 A;  1ZDF A;  4JIS A;  1V83 A;  1IIN A;  1NHE B;  2OI6 A;  3V8Z A;  1ZCU A;  1VH3 A;  3CGX A;  3FOQ A;  4FRP A;  2Y6P A;  3JUK A;  4M4K A;  1MP3 A;  1MC3 A;  2MZB A;  3I0D A;  3USQ A;  3TQD A;  1LZJ A;  3D98 A;  2VS3 A;  1FXO A;  3QVB A;  3R2W A;  4FQW A;  3SX7 A;  3TZT A;  1FXJ A;  1FRW A;  4M2A A;  1R7X A;  3V8Y A;  1ZCY A;  4P02 A;  4DEC A;  1QWJ A;  5DDV A;  1XHB A;  1FZW A;  4M28 A;  4BQH A;  3SX8 A;  1WT0 A;  4G3P A;  2FY7 A;  4HG6 A;  2JCO A;  1S4N A;  3I0C A;  4HO6 A;  3V0N A;  2RJ6 A;  2ICY A;  3T7M A;  1PZY B;  2OEG A;  3V91 A;  1FO8 A;  1H4E A;  5CMJ A;  4HOC A;  1YP2 A;  1VIC A;  1W55 A;  4AAW A;  4HO5 A;  2A8U A;  2WVL A;  4JD0 A;  1FOA A;  3KIA A;  4J18 A;  4EVW A;  1H7Q A;  4BMA A;  1R7Y A;  2WVM A;  3Q4S A;  1NWG B;  4AYJ A;  5C47 A;  4M2B A;  1JV3 A;  1JV1 A;  1ZJ2 A;  2D0J A;  3PKQ A;  3SXA A;  4FRB A;  3ZGG A;  3F1Y A;  1HM9 A;  2WAW A;  1G93 A;  4HO2 A;  5FTV A;  3I0H A;  4HO9 A;  1FO9 A;  1ZJ0 A;  1ZCT A;  3U0X A;  2RIT A;  2X5S A;  3I0J A;  3POL A;  1TW1 A;  5AJO A;  1VZU A;  1G9R A;  2A8W A;  1NQI B;  3RMW A;  3D5N A;  3SX5 A;  5EJ1 A;  1ZI1 A;  1H5S A;  1EZI A;  5C3D A;  4AC3 A;  5IDS A;  1R80 A;  3U2T A;  1VGZ A;  1JVG A;  2P6W A;  3SXG A;  2GGQ A;  4NAN A;  3ZLL A;  3DJ4 A;  1YRO B;  2D7I A;  4B2X A;  5C4F A;  5I1F A;  1LZ0 A;  3I0L A;  5C8R A;  1V82 A;  1LL3 A;  5FUH A;  1QG8 A;  2YC3 A;  5CQO A;  3E25 A;  1G95 A;  4KXO A;  3I0I X;  4NAL A;  4FRE A;  2Y4M A;  3LW6 A;  2WGZ A;  1VZT A;  3HL3 A;  5CQL X;  4C2S A;  1O23 B;  1NF5 B;  3IOH A;  4ARW A;  4FRO A;  2I7B A;  4R7P A;  4B5B A;  1INJ A;  3OAM A;  3OH1 A;  1H7H A;  1R7V A;  3U2U A;  4G3S A;  2XWL A;  2JCK A;  4CJ8 A;  3BRK X;  5CMF X;  1QGS A;  4KPZ A;  1R81 A;  1H5R B;  3K8D A;  1HM8 A;  1S4O A;  1ZIZ A;  4B42 A;  5J49 A;  2VXL A;  4CJB A;  1VGW A; 
#chains in the Genus database with same CATH topology
 1H5T B;  2ZU9 A;  3EE5 A;  4EEM A;  2V0L A;  1GQ9 A;  4E1K A;  3CKN A;  1WT1 A;  1YP3 A;  4FCU A;  3GUE A;  3K8E A;  5FYE A;  1VZX A;  3FWW A;  5AJP A;  3V0P A;  1WT3 A;  1G97 A;  4MYB A;  3OC9 A;  3DUV A;  4G3Q A;  2VK9 A;  1LL2 A;  2VS4 A;  2FYA A;  1O0R A;  4DE7 A;  5CMH A;  1W57 A;  2ZU7 A;  4B4M A;  2O1H A;  2VS5 A;  4KC2 A;  2UX8 A;  2NXV A;  1MP4 A;  3V0Q A;  1VH1 A;  1H5S C;  4ASY A;  2X5Z A;  1H5R A;  3CKQ A;  2PX7 A;  1GWW A;  4KC1 A;  2OEF A;  4IRQ A;  3V0O A;  4FRM A;  5C3A A;  4EEO A;  3N9W A;  2AM3 A;  5EJZ A;  4D11 C;  1H5S B;  2RJ4 A;  5L6S A;  1H5T A;  3O3P A;  2FYD B;  2RJ0 A;  4ZDQ A;  2AM4 A;  1ZCV A;  4KC4 A;  2CU2 A;  2RJ9 A;  3ST8 A;  4FRA A;  4IRP A;  1OQM B;  2X65 A;  2BO4 A;  3OH4 A;  2YQS A;  2Z86 A;  1WT2 A;  1HV9 A;  4P00 A;  1HM0 A;  3V0L A;  2XWN A;  3CU0 A;  2RJ5 A;  3Q80 A;  2VFZ A;  5C49 A;  1H3M A;  2BO8 A;  2QGI A;  5D92 A;  3SXB A;  3ZF8 A;  3D8V A;  4Y7U A;  1ZJ3 A;  2O1F A;  2VSH A;  4XWI A;  2P73 A;  4NAI A;  3CKO A;  4LW3 A;  1H7T A;  5L6V A;  1WSZ A;  5CQP A;  2PGY A;  4D11 A;  2V0K A;  5C1G A;  1R82 A;  2YQH A;  4KQL A;  4FRL A;  1ZJP A;  3R3I A;  2Y4J A;  3CKJ A;  4FIX A;  2O1G A;  1LL0 A;  2VXM A;  5IDT A;  2VSI A;  4KNR A;  4DDZ A;  1G3L A;  3RMV A;  5CMG X;  2AM5 A;  4Y6N A;  3U0Y A;  4K6R A;  5DDT A;  2J0B A;  5JQQ A;  3U2W A;  3CKV A;  1VGU A;  2Z87 A;  3I0E A;  2Y4K A;  5IFY A;  1G23 A;  4HO8 A;  2V0I A;  5HS2 A;  2FFU A;  3I0K A;  1G1L A;  4HO3 A;  4HO4 A;  3SXE A;  2FYB A;  1FR8 A;  4Y7T A;  2AES A;  4FRH A;  3U2X A;  5C1H A;  1VPA A;  4B2W A;  3PNN A;  1E5K A;  3USR A;  1JYL A;  3ZLK A;  1FGX A;  5C38 A;  5C36 A;  3T7O A;  1G2V A;  2GGO A;  1I52 A;  1TZF A;  2V0H A;  2OI5 A;  4Y64 A;  2XME A;  5C3B A;  1G8O A;  3SX3 A;  1XZ6 A;  1IIM A;  1GWV A;  1VGT A;  1ZJ1 A;  4EEG A;  2QH5 A;  1GX0 A;  2BO7 A;  2PA4 A;  1QGQ A;  1YP4 A;  2V0J A;  1JYK A;  1GA8 A;  5C4C A;  1WVC A;  3Q7U A;  2FYC B;  1H7F A;  4GBP A;  2E8B A;  4HO0 A;  2RJ8 A;  3PKP A;  1ZI5 A;  1HJL A;  2Y4L A;  3F1C A;  4Y9X A;  3OH0 A;  2RIY A;  1KWS A;  1ZI4 A;  1H5S D;  1PZT A;  1NMM B;  3SXD A;  1H7E A;  1HJJ A;  4B4B A;  2E3D A;  4KPX A;  4MND A;  5C4D A;  2AE7 A;  4D0T A;  1JVD A;  1V84 A;  3T7N A;  1H7L A;  2C0N A;  5CQN X;  2WVK A;  2YCM A;  2FFV A;  2P72 A;  1VM8 A;  3I0F A;  3BCV A;  3OH2 A;  1H4D A;  1ZHJ A;  1OMX A;  4CJC A;  2BO6 A;  5C1L A;  4LW6 A;  2WE9 A;  4D48 A;  1ZI3 A;  4ASJ A;  1NKH B;  1LVW A;  1FR9 A;  3OH3 A;  4G87 A;  4HCQ A;  2PGV A;  2YC5 A;  2RJ1 A;  5AJN A;  1TVY A;  2D7R A;  2Q4J A;  4Y63 A;  1S4P A;  2W0W A;  3JTJ A;  4O6N A;  4EE5 A;  2RIZ A;  5BXC A;  1ON6 A;  1R7U A;  1GX4 A;  1MP5 A;  2I5K A;  3NGW A;  3V90 A;  2JCL A;  2ICX A;  3IOJ A;  4B4G A;  3I0G A;  5FU8 A;  1INI A;  1FGG A;  1ZDG A;  4EEA A;  3RSB A;  5C4B A;  2AEC A;  4KT7 A;  4B3U A;  5D91 A;  1ZJO A;  1FWY A;  3OGZ A;  4Y62 A;  1R7T A;  5FU0 A;  4NAK A;  1EYR A;  2OI7 A;  4KNX A;  2WEE A;  4ECM A;  1LZ7 A;  4L41 C;  1O7Q A;  5CQM X;  4D0Z A;  2XMH A;  5EIY A;  2YQJ A;  1GQC A;  2QKX A;  1LZI A;  2DPW A;  2XWM A;  5FTS A;  4YS8 A;  1FG5 N;  2YES A;  1H7G A;  3OKR A;  1SS9 A;  2APC A;  5FV9 A;  3SPT A;  2I5E A;  4Y7V A;  1TW5 A;  3V0M A;  2X60 A;  4KRV A;  1OMZ A;  1W77 A;  2JCJ A;  4Y6U A;  2RJ7 A;  3IOI A;  1Z90 A;  3E26 A;  4FRQ A;  4EE3 A;  5C4E A;  3U2V A;  3ZGF A;  2ZU8 A;  4CVH A;  1O7O A;  4FRD A;  1H4C A;  4Y7G A;  2VD4 A;  1ON8 A;  4FCE A;  2W0V A;  2AGD A;  4EE4 A;  5C48 A;  3SXC A;  4O6M A;  3DK5 A;  4Y7F A;  3JUJ A;  2RIX A;  1G0R A;  4AYL A;  2YQC A;  4UEG A;  2Y7A A;  1K4V A;  5CMI A;  2AH9 A;  1ZDF A;  4JIS A;  1V83 A;  1IIN A;  1NHE B;  2J0A A;  2OI6 A;  3V8Z A;  1ZCU A;  1VH3 A;  3CGX A;  3FOQ A;  4FRP A;  2Y6P A;  3JUK A;  4M4K A;  1MP3 A;  1MC3 A;  2MZB A;  3I0D A;  3USQ A;  3TQD A;  1LZJ A;  3D98 A;  2VS3 A;  1FXO A;  3QVB A;  3R2W A;  4FQW A;  3SX7 A;  3TZT A;  1FXJ A;  1FRW A;  4M2A A;  1R7X A;  4FIY A;  4Q7C A;  3V8Y A;  1ZCY A;  4P02 A;  4DEC A;  1QWJ A;  5DDV A;  1XHB A;  1FZW A;  4M28 A;  4BQH A;  3SX8 A;  1WT0 A;  4G3P A;  2FY7 A;  4HG6 A;  2JCO A;  1S4N A;  3I0C A;  4HO6 A;  3V0N A;  2RJ6 A;  2ICY A;  3T7M A;  1PZY B;  2OEG A;  3V91 A;  1FO8 A;  1H4E A;  5CMJ A;  4HOC A;  1YP2 A;  1VIC A;  1W55 A;  4AAW A;  4HO5 A;  2A8U A;  4MIX A;  2WVL A;  4JD0 A;  1FOA A;  3KIA A;  4J18 A;  4EVW A;  1H7Q A;  4BMA A;  1R7Y A;  2WVM A;  3Q4S A;  1NWG B;  4AYJ A;  5C47 A;  4M2B A;  1JV3 A;  1JV1 A;  1ZJ2 A;  2D0J A;  3PKQ A;  3SXA A;  4FRB A;  3ZGG A;  3F1Y A;  1HM9 A;  2WAW A;  1G93 A;  4HO2 A;  5FTV A;  3I0H A;  4HO9 A;  1FO9 A;  1ZJ0 A;  1ZCT A;  3U0X A;  2RIT A;  2X5S A;  3I0J A;  3POL A;  1TW1 A;  5AJO A;  1VZU A;  1G9R A;  2A8W A;  1NQI B;  3RMW A;  3D5N A;  3SX5 A;  5EJ1 A;  1ZI1 A;  1H5S A;  1EZI A;  5C3D A;  4AC3 A;  5IDS A;  1R80 A;  3U2T A;  1VGZ A;  1JVG A;  2P6W A;  3SXG A;  2GGQ A;  4NAN A;  3ZLL A;  3DJ4 A;  1YRO B;  2D7I A;  4B2X A;  5C4F A;  5I1F A;  1LZ0 A;  3I0L A;  5C8R A;  1V82 A;  1LL3 A;  5FUH A;  1QG8 A;  2YC3 A;  5CQO A;  3E25 A;  1G95 A;  4KXO A;  3I0I X;  4NAL A;  4FRE A;  2Y4M A;  3LW6 A;  2WGZ A;  1VZT A;  3HL3 A;  5CQL X;  4C2S A;  1O23 B;  1NF5 B;  3IOH A;  4ARW A;  4FRO A;  2I7B A;  4R7P A;  4B5B A;  1INJ A;  3OAM A;  3OH1 A;  1H7H A;  1R7V A;  3U2U A;  4G3S A;  2XWL A;  2JCK A;  4CJ8 A;  3BRK X;  5CMF X;  1QGS A;  4KPZ A;  1R81 A;  1H5R B;  3K8D A;  1HM8 A;  1S4O A;  1ZIZ A;  4B42 A;  5J49 A;  2VXL A;  4CJB A;  1VGW A; 
#chains in the Genus database with same CATH homology
 1H5T B;  2ZU9 A;  3EE5 A;  4EEM A;  2V0L A;  1GQ9 A;  4E1K A;  3CKN A;  1WT1 A;  1YP3 A;  4FCU A;  3GUE A;  3K8E A;  5FYE A;  1VZX A;  3FWW A;  5AJP A;  3V0P A;  1WT3 A;  1G97 A;  4MYB A;  3OC9 A;  3DUV A;  4G3Q A;  2VK9 A;  1LL2 A;  2VS4 A;  2FYA A;  1O0R A;  4DE7 A;  5CMH A;  1W57 A;  2ZU7 A;  4B4M A;  2O1H A;  2VS5 A;  4KC2 A;  2UX8 A;  2NXV A;  1MP4 A;  3V0Q A;  1VH1 A;  1H5S C;  4ASY A;  2X5Z A;  1H5R A;  3CKQ A;  2PX7 A;  1GWW A;  4KC1 A;  2OEF A;  4IRQ A;  3V0O A;  4FRM A;  5C3A A;  4EEO A;  3N9W A;  2AM3 A;  5EJZ A;  4D11 C;  1H5S B;  2RJ4 A;  5L6S A;  1H5T A;  3O3P A;  2FYD B;  2RJ0 A;  4ZDQ A;  2AM4 A;  1ZCV A;  4KC4 A;  2CU2 A;  2RJ9 A;  3ST8 A;  4FRA A;  4IRP A;  1OQM B;  2X65 A;  2BO4 A;  3OH4 A;  2YQS A;  2Z86 A;  1WT2 A;  1HV9 A;  4P00 A;  1HM0 A;  3V0L A;  2XWN A;  3CU0 A;  2RJ5 A;  3Q80 A;  2VFZ A;  5C49 A;  1H3M A;  2BO8 A;  2QGI A;  5D92 A;  3SXB A;  3ZF8 A;  3D8V A;  4Y7U A;  1ZJ3 A;  2O1F A;  2VSH A;  4XWI A;  2P73 A;  4NAI A;  3CKO A;  4LW3 A;  1H7T A;  5L6V A;  1WSZ A;  5CQP A;  2PGY A;  4D11 A;  2V0K A;  5C1G A;  1R82 A;  2YQH A;  4KQL A;  4FRL A;  1ZJP A;  3R3I A;  2Y4J A;  3CKJ A;  4FIX A;  2O1G A;  1LL0 A;  2VXM A;  5IDT A;  2VSI A;  4KNR A;  4DDZ A;  1G3L A;  3RMV A;  5CMG X;  2AM5 A;  4Y6N A;  3U0Y A;  4K6R A;  5DDT A;  2J0B A;  5JQQ A;  3U2W A;  3CKV A;  1VGU A;  2Z87 A;  3I0E A;  2Y4K A;  5IFY A;  1G23 A;  4HO8 A;  2V0I A;  5HS2 A;  2FFU A;  3I0K A;  1G1L A;  4HO3 A;  4HO4 A;  3SXE A;  2FYB A;  1FR8 A;  4Y7T A;  2AES A;  4FRH A;  3U2X A;  5C1H A;  1VPA A;  4B2W A;  3PNN A;  1E5K A;  3USR A;  1JYL A;  3ZLK A;  1FGX A;  5C38 A;  5C36 A;  3T7O A;  1G2V A;  2GGO A;  1I52 A;  1TZF A;  2V0H A;  2OI5 A;  4Y64 A;  2XME A;  5C3B A;  1G8O A;  3SX3 A;  1XZ6 A;  1IIM A;  1GWV A;  1VGT A;  1ZJ1 A;  4EEG A;  2QH5 A;  1GX0 A;  2BO7 A;  2PA4 A;  1QGQ A;  1YP4 A;  2V0J A;  1JYK A;  1GA8 A;  5C4C A;  1WVC A;  3Q7U A;  2FYC B;  1H7F A;  4GBP A;  2E8B A;  4HO0 A;  2RJ8 A;  3PKP A;  1ZI5 A;  1HJL A;  2Y4L A;  3F1C A;  4Y9X A;  3OH0 A;  2RIY A;  1KWS A;  1ZI4 A;  1H5S D;  1PZT A;  1NMM B;  3SXD A;  1H7E A;  1HJJ A;  4B4B A;  2E3D A;  4KPX A;  4MND A;  5C4D A;  2AE7 A;  4D0T A;  1JVD A;  1V84 A;  3T7N A;  1H7L A;  2C0N A;  5CQN X;  2WVK A;  2YCM A;  2FFV A;  2P72 A;  1VM8 A;  3I0F A;  3BCV A;  3OH2 A;  1H4D A;  1ZHJ A;  1OMX A;  4CJC A;  2BO6 A;  5C1L A;  4LW6 A;  2WE9 A;  4D48 A;  1ZI3 A;  4ASJ A;  1NKH B;  1LVW A;  1FR9 A;  3OH3 A;  4G87 A;  4HCQ A;  2PGV A;  2YC5 A;  2RJ1 A;  5AJN A;  1TVY A;  2D7R A;  2Q4J A;  4Y63 A;  1S4P A;  2W0W A;  3JTJ A;  4O6N A;  4EE5 A;  2RIZ A;  5BXC A;  1ON6 A;  1R7U A;  1GX4 A;  1MP5 A;  2I5K A;  3NGW A;  3V90 A;  2JCL A;  2ICX A;  3IOJ A;  4B4G A;  3I0G A;  5FU8 A;  1INI A;  1FGG A;  1ZDG A;  4EEA A;  3RSB A;  5C4B A;  2AEC A;  4KT7 A;  4B3U A;  5D91 A;  1ZJO A;  1FWY A;  3OGZ A;  4Y62 A;  1R7T A;  5FU0 A;  4NAK A;  1EYR A;  2OI7 A;  4KNX A;  2WEE A;  4ECM A;  1LZ7 A;  4L41 C;  1O7Q A;  5CQM X;  4D0Z A;  2XMH A;  5EIY A;  2YQJ A;  1GQC A;  2QKX A;  1LZI A;  2DPW A;  2XWM A;  5FTS A;  4YS8 A;  1FG5 N;  2YES A;  1H7G A;  3OKR A;  1SS9 A;  2APC A;  5FV9 A;  3SPT A;  2I5E A;  4Y7V A;  1TW5 A;  3V0M A;  2X60 A;  4KRV A;  1OMZ A;  1W77 A;  2JCJ A;  4Y6U A;  2RJ7 A;  3IOI A;  1Z90 A;  3E26 A;  4FRQ A;  4EE3 A;  5C4E A;  3U2V A;  3ZGF A;  2ZU8 A;  4CVH A;  1O7O A;  4FRD A;  1H4C A;  4Y7G A;  2VD4 A;  1ON8 A;  4FCE A;  2W0V A;  2AGD A;  4EE4 A;  5C48 A;  3SXC A;  4O6M A;  3DK5 A;  4Y7F A;  3JUJ A;  2RIX A;  1G0R A;  4AYL A;  2YQC A;  4UEG A;  2Y7A A;  1K4V A;  5CMI A;  2AH9 A;  1ZDF A;  4JIS A;  1V83 A;  1IIN A;  1NHE B;  2J0A A;  2OI6 A;  3V8Z A;  1ZCU A;  1VH3 A;  3CGX A;  3FOQ A;  4FRP A;  2Y6P A;  3JUK A;  4M4K A;  1MP3 A;  1MC3 A;  2MZB A;  3I0D A;  3USQ A;  3TQD A;  1LZJ A;  3D98 A;  2VS3 A;  1FXO A;  3QVB A;  3R2W A;  4FQW A;  3SX7 A;  3TZT A;  1FXJ A;  1FRW A;  4M2A A;  1R7X A;  4FIY A;  4Q7C A;  3V8Y A;  1ZCY A;  4P02 A;  4DEC A;  1QWJ A;  5DDV A;  1XHB A;  1FZW A;  4M28 A;  4BQH A;  3SX8 A;  1WT0 A;  4G3P A;  2FY7 A;  4HG6 A;  2JCO A;  1S4N A;  3I0C A;  4HO6 A;  3V0N A;  2RJ6 A;  2ICY A;  3T7M A;  1PZY B;  2OEG A;  3V91 A;  1FO8 A;  1H4E A;  5CMJ A;  4HOC A;  1YP2 A;  1VIC A;  1W55 A;  4AAW A;  4HO5 A;  2A8U A;  4MIX A;  2WVL A;  4JD0 A;  1FOA A;  3KIA A;  4J18 A;  4EVW A;  1H7Q A;  4BMA A;  1R7Y A;  2WVM A;  3Q4S A;  1NWG B;  4AYJ A;  5C47 A;  4M2B A;  1JV3 A;  1JV1 A;  1ZJ2 A;  2D0J A;  3PKQ A;  3SXA A;  4FRB A;  3ZGG A;  3F1Y A;  1HM9 A;  2WAW A;  1G93 A;  4HO2 A;  5FTV A;  3I0H A;  4HO9 A;  1FO9 A;  1ZJ0 A;  1ZCT A;  3U0X A;  2RIT A;  2X5S A;  3I0J A;  3POL A;  1TW1 A;  5AJO A;  1VZU A;  1G9R A;  2A8W A;  1NQI B;  3RMW A;  3D5N A;  3SX5 A;  5EJ1 A;  1ZI1 A;  1H5S A;  1EZI A;  5C3D A;  4AC3 A;  5IDS A;  1R80 A;  3U2T A;  1VGZ A;  1JVG A;  2P6W A;  3SXG A;  2GGQ A;  4NAN A;  3ZLL A;  3DJ4 A;  1YRO B;  2D7I A;  4B2X A;  5C4F A;  5I1F A;  1LZ0 A;  3I0L A;  5C8R A;  1V82 A;  1LL3 A;  5FUH A;  1QG8 A;  2YC3 A;  5CQO A;  3E25 A;  1G95 A;  4KXO A;  3I0I X;  4NAL A;  4FRE A;  2Y4M A;  3LW6 A;  2WGZ A;  1VZT A;  3HL3 A;  5CQL X;  4C2S A;  1O23 B;  1NF5 B;  3IOH A;  4ARW A;  4FRO A;  2I7B A;  4R7P A;  4B5B A;  1INJ A;  3OAM A;  3OH1 A;  1H7H A;  1R7V A;  3U2U A;  4G3S A;  2XWL A;  2JCK A;  4CJ8 A;  3BRK X;  5CMF X;  1QGS A;  4KPZ A;  1R81 A;  1H5R B;  3K8D A;  1HM8 A;  1S4O A;  1ZIZ A;  4B42 A;  5J49 A;  2VXL A;  4CJB A;  1VGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...