4C2SA

Crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta p156l mutant) in complex with udp and deoxy-h-antigen acceptor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
291
structure length
291
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTO-BLOOD GROUP ABO SYSTEM TRANSFERASE
publication title Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Posessing the Pro156Leu Mutation
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4c2sA00
1R7XA 1Z90A 3USRA 2VXMA 3CU0A 4Y7FA 4FRAA 4HG6A 4KNXA 1GWVA 1I52A 1S4NA 1S4PA 5C3DA 3DJ4A 4FRBA 1JVGA 1O7QA 2Y4MA 4IRPA 1OQMB 2OI7A 1NHEB 2VD4A 1FGGA 1ZDFA 5L6SA 1E5KA 4D0ZA 3RMVA 3LW6A 5CQNX 3OH1A 3V8YA 2AH9A 1LZ7A 4HOCA 3CKNA 4B5BA 1JYKA 1NQIB 3E26A 1ZCTA 1VH3A 3I0DA 2RJ8A 4HCQA 1R7UA 2VSIA 2MZBA 1XHBA 3I0HA 4LW6A 1H4DA 2E8BA 2V0HA 2UX8A 1NKHB 2V0IA 1WT0A 4R7PA 3ZGFA 3I0LA 3OKRA 1H7HA 1ZJ3A 5CQMX 1MP3A 2YQSA 1VGZA 3CKJA 3V91A 3V0OA 5C3BA 5IFYA 4ECMA 3V8ZA 1LL3A 1GQCA 2V0LA 1ZJ0A 2D7RA 1H5SB 2FYCB 4KT7A 1VICA 4Y6NA 2Y7AA 5JQQA 4E1KA 3POLA 1GA8A 1PZYB 2FYAA 3E25A 1V84A 1ON6A 2QH5A 1G2VA 4B4MA 3I0IX 2FYDB 1HM8A 2ICYA 1LZ0A 4FCUA 5C4CA 2GGQA 4KPXA 5C48A 4G3QA 3QVBA 2BO7A 2YQCA 2I5KA 3D5NA 1LZJA 3V0NA 3V0LA 3ST8A 2XMEA 1G93A 3IOHA 4ZDQA 1FG5N 5FTSA 2ICXA 4G87A 2NXVA 5DDVA 2RJ7A 5FYEA 4EEGA 3V0PA 1ZJOA 4Y7UA 2AM3A 1R82A 3SXAA 2CU2A 3Q80A 2QKXA 3BCVA 3FWWA 5AJNA 3T7OA 3HL3A 3OGZA 3JUJA 4B2XA 1G1LA 4FRLA 5FTVA 1FR9A 1QGQA 1ZHJA 2RJ6A 4NAKA 3OH4A 4IRQA 1QGSA 3Q7UA 5CMFX 4NALA 2OEGA 5BXCA 2AE7A 4B2WA 1JYLA 1YROB 2VFZA 5I1FA 1G95A 2RJ1A 1FR8A 3RSBA 1ZJPA 2RJ0A 1WT2A 1H7LA 1VZXA 4MYBA 4ASYA 3F1CA 4D48A 1OMZA 2WAWA 1H5RB 1HJJA 1TVYA 5FV9A 1YP3A 2BO4A 2BO8A 1INJA 4XWIA 3OH3A 5C1HA 1IIMA 1H7QA 4JISA 1HM9A 1R7TA 2VS5A 4B4GA 5C49A 1G0RA 4HO9A 1MP5A 1WT3A 1ZI4A 3I0FA 5CQPA 2AM5A 2OEFA 2A8WA 1EYRA 1R81A 2VS3A 2ZU9A 1NWGB 2YESA 1JVDA 3T7MA 4D0TA 2WEEA 2XWNA 2FFVA 1TW5A 1TZFA 2WE9A 3ZGGA 1ZCVA 1S4OA 4Y64A 4CVHA 1R7YA 2O1FA 3GUEA 3U0XA 5L6VA 3TQDA 3N9WA 4K6RA 5C38A 2AESA 5HS2A 4AYJA 1H5TA 2YQJA 4D11A 4Y7GA 4DDZA 2WVMA 4ASJA 1HV9A 4B3UA 4ARWA 4HO2A 4DE7A 3JUKA 3SXGA 1LVWA 4AAWA 2VXLA 2XMHA 1WT1A 4J18A 4EE3A 4KRVA 4HO3A 2A8UA 1VPAA 4HO5A 2VS4A 2Y4LA 3SXDA 1VM8A 4AYLA 1H4CA 2YC3A 4FRDA 5EJ1A 1ZI5A 2JCLA 2JCOA 1V83A 2DPWA 1H5TB 2BO6A 1SS9A 2W0WA 4P02A 2W0VA 4FREA 3SX8A 5IDTA 4CJCA 2WVLA 2Y6PA 3O3PA 3IOIA 4KPZA 2X5ZA 4KC4A 4M2BA 2RIYA 3K8EA 4BMAA 1LL2A 3PNNA 2RJ5A 1FGXA 3U2UA 1GQ9A 4P00A 4B4BA 1H5SD 1O7OA 5CQOA 5C4FA 2E3DA 3OAMA 3F1YA 4B42A 4KQLA 1ZCYA 2Z87A 4D11C 5CQLX 1ZIZA 1FWYA 4M2AA 1JV3A 1VH1A 1ZJ1A 2FYBA 3I0EA 1YP4A 4HO6A 3ZLKA 3PKQA 1H7GA 4MNDA 3KIAA 2XWLA 4EEOA 1H4EA 1JV1A 1O23B 2QGIA 4L41C 1VZUA 4Y6UA 4EE5A 4NANA 5AJOA 5EIYA 2RITA 3D8VA 4Y7VA 3ZF8A 2Y4KA 2X60A 3I0JA 3USQA 1G3LA 2FFUA 4LW3A 2YC5A 5DDTA 3U2TA 2X5SA 2YCMA 3JTJA 3R2WA 5C4BA 1ZCUA 5C3AA 3EE5A 4FQWA 1ZJ2A 5AJPA 1R7VA 5CMIA 5FU8A 2AGDA 1VZTA 2I7BA 5IDSA 1INIA 1ON8A 4YS8A 1R80A 1GWWA 2PA4A 2Q4JA 2D0JA 2PGYA 2PGVA 1OMXA 3CKVA 4KC2A 2ZU8A 1K4VA 1W55A 2V0JA 3SXEA 2FY7A 1HM0A 3PKPA 3V90A 1NMMB 5CMHA 4G3SA 5J49A 3I0CA 3DK5A 3I0KA 2P6WA 2RJ9A 3I0GA 2JCKA 5C4DA 1FO9A 2OI5A 4GBPA 2X65A 4EEAA 2Y4JA 3U2XA 4UEGA 1H5SA 2AM4A 3SX7A 2XWMA 4FRQA 2ZU7A 1ZI1A 5C1GA 1FO8A 2Z86A 5FUHA 4Y62A 4CJBA 2P73A 4FRHA 1QWJA 2OI6A 3U2VA 2PX7A 3SXBA 3R3IA 3BRKX 1WVCA 1GX4A 3V0MA 1H7EA 3U0YA 4AC3A 5C8RA 4HO0A 1H7TA 3SX3A 1G8OA 1LL0A 3U2WA 3OH0A 1O0RA 1EZIA 4FRMA 5C47A 4KXOA 5CMJA 1VGUA 1G9RA 1VGWA 3OC9A 1ZDGA 2RJ4A 5C4EA 4BQHA 2O1GA 4FCEA 1V82A 4EE4A 2RIZA 2RIXA 4FROA 5C1LA 3SX5A 1H7FA 2WVKA 4FRPA 5C36A 1FRWA 4HO8A 4Y9XA 1FOAA 3SXCA 3CKQA 4DECA 1H5SC 4HO4A 4Y63A 1FZWA 1VGTA 1MC3A 1HJLA 2JCJA 4M28A 3DUVA 5EJZA 2AECA 3T7NA 3IOJA 2D7IA 2APCA 1H3MA 1XZ6A 4JD0A 1NF5B 3D98A 1WSZA 1YP2A 2VSHA 4NAIA 4KNRA 2I5EA 4EEMA 4EVWA 1H5RA 3FOQA 1MP4A 1FXJA 3ZLLA 4M4KA 1W57A 5CMGX 1TW1A 2P72A 1KWSA 4CJ8A 3SPTA 3TZTA 4G3PA 3Q4SA 2V0KA 3CKOA 3CGXA 4C2SA 1G23A 2GGOA 4KC1A 1IINA 3K8DA 2YQHA 3OH2A 1ZI3A 5FU0A 3NGWA 3V0QA 1GX0A 1FXOA 4Y7TA 3RMWA 1QG8A 1W77A 1PZTA 1G97A 2O1HA 1LZIA 2WGZA
chains in the Genus database with same CATH superfamily
1R7XA 1Z90A 3USRA 2VXMA 3CU0A 4Y7FA 4FRAA 4HG6A 4KNXA 1GWVA 1I52A 1S4NA 1S4PA 4O6NA 5C3DA 3DJ4A 4FRBA 1JVGA 1O7QA 2Y4MA 4IRPA 1OQMB 2OI7A 1NHEB 2VD4A 1FGGA 1ZDFA 5L6SA 1E5KA 4D0ZA 3RMVA 3LW6A 5CQNX 3OH1A 3V8YA 2AH9A 1LZ7A 4HOCA 3CKNA 4B5BA 1JYKA 1NQIB 3E26A 1ZCTA 1VH3A 3I0DA 2RJ8A 4HCQA 1R7UA 2VSIA 2MZBA 1XHBA 3I0HA 4LW6A 1H4DA 2E8BA 2V0HA 2UX8A 1NKHB 2V0IA 1WT0A 4R7PA 3ZGFA 3I0LA 3OKRA 1H7HA 1ZJ3A 5CQMX 1MP3A 2YQSA 1VGZA 3CKJA 3V91A 3V0OA 5C3BA 5IFYA 4ECMA 3V8ZA 1LL3A 1GQCA 2V0LA 1ZJ0A 2D7RA 4Q7CA 1H5SB 2FYCB 4KT7A 1VICA 4Y6NA 2Y7AA 5JQQA 4E1KA 3POLA 1GA8A 1PZYB 2FYAA 3E25A 1V84A 1ON6A 2QH5A 1G2VA 4B4MA 3I0IX 2FYDB 1HM8A 2ICYA 1LZ0A 4FCUA 5C4CA 2GGQA 4KPXA 5C48A 4G3QA 3QVBA 2BO7A 2YQCA 2I5KA 3D5NA 1LZJA 3V0NA 3V0LA 3ST8A 2XMEA 1G93A 3IOHA 4ZDQA 1FG5N 5FTSA 2ICXA 4G87A 2NXVA 5DDVA 2RJ7A 5FYEA 4EEGA 3V0PA 1ZJOA 4Y7UA 2AM3A 1R82A 3SXAA 2CU2A 3Q80A 2QKXA 3BCVA 3FWWA 5AJNA 3T7OA 3HL3A 3OGZA 3JUJA 4B2XA 1G1LA 4FRLA 5FTVA 1FR9A 1QGQA 1ZHJA 2RJ6A 4NAKA 3OH4A 4IRQA 1QGSA 3Q7UA 5CMFX 4NALA 2OEGA 5BXCA 2AE7A 4B2WA 1JYLA 1YROB 2VFZA 5I1FA 1G95A 2RJ1A 1FR8A 3RSBA 1ZJPA 2RJ0A 1WT2A 1H7LA 1VZXA 4MYBA 4ASYA 3F1CA 4D48A 1OMZA 2WAWA 1H5RB 1HJJA 1TVYA 5FV9A 1YP3A 2BO4A 2BO8A 1INJA 4XWIA 3OH3A 5C1HA 1IIMA 1H7QA 4JISA 1HM9A 1R7TA 2VS5A 4B4GA 5C49A 1G0RA 4HO9A 1MP5A 1WT3A 1ZI4A 3I0FA 5CQPA 2AM5A 2OEFA 2VK9A 2A8WA 1EYRA 1R81A 2VS3A 2ZU9A 1NWGB 2YESA 4FIXA 1JVDA 3T7MA 4D0TA 2WEEA 2XWNA 2FFVA 1TW5A 1TZFA 2WE9A 3ZGGA 1ZCVA 1S4OA 4Y64A 4CVHA 1R7YA 2O1FA 3GUEA 3U0XA 5L6VA 2J0BA 3N9WA 3TQDA 4K6RA 5C38A 2AESA 5HS2A 4AYJA 1H5TA 2YQJA 4D11A 4Y7GA 4DDZA 2WVMA 4ASJA 1HV9A 4B3UA 4ARWA 4HO2A 4DE7A 3JUKA 3SXGA 1LVWA 4AAWA 2VXLA 2XMHA 1WT1A 4J18A 4EE3A 4KRVA 4HO3A 2A8UA 1VPAA 4HO5A 2VS4A 2Y4LA 3SXDA 1VM8A 4AYLA 1H4CA 2YC3A 4FRDA 5EJ1A 1ZI5A 2JCLA 2JCOA 1V83A 2DPWA 1H5TB 2BO6A 1SS9A 2W0WA 4P02A 2W0VA 4FREA 3SX8A 5IDTA 4CJCA 2WVLA 2Y6PA 3O3PA 3IOIA 4KPZA 2X5ZA 4KC4A 4M2BA 2RIYA 3K8EA 4BMAA 1LL2A 3PNNA 2RJ5A 1FGXA 3U2UA 1GQ9A 4P00A 4B4BA 1H5SD 1O7OA 5CQOA 5C4FA 2E3DA 3OAMA 3F1YA 4B42A 4KQLA 1ZCYA 2Z87A 4D11C 5CQLX 1ZIZA 1FWYA 4M2AA 1JV3A 1VH1A 1ZJ1A 2FYBA 3I0EA 1YP4A 4HO6A 3ZLKA 3PKQA 1H7GA 4MNDA 3KIAA 2XWLA 4EEOA 1H4EA 1JV1A 1O23B 2QGIA 4L41C 1VZUA 4Y6UA 4EE5A 4NANA 5AJOA 5EIYA 2RITA 3D8VA 4FIYA 4Y7VA 3ZF8A 2Y4KA 2X60A 3I0JA 3USQA 1G3LA 2FFUA 4LW3A 2YC5A 5DDTA 3U2TA 2X5SA 2YCMA 3JTJA 3R2WA 5C4BA 1ZCUA 5C3AA 3EE5A 4FQWA 1ZJ2A 5AJPA 1R7VA 5CMIA 5FU8A 2AGDA 1VZTA 2I7BA 5IDSA 1INIA 1ON8A 4YS8A 1R80A 1GWWA 2PA4A 2Q4JA 2D0JA 2PGYA 2PGVA 1OMXA 3CKVA 4KC2A 2ZU8A 1K4VA 1W55A 2V0JA 3SXEA 2FY7A 1HM0A 2J0AA 3PKPA 3V90A 1NMMB 5CMHA 4G3SA 5J49A 3I0CA 3DK5A 3I0KA 2P6WA 2RJ9A 3I0GA 2JCKA 5C4DA 1FO9A 2OI5A 4GBPA 2X65A 4EEAA 2Y4JA 3U2XA 4UEGA 1H5SA 2AM4A 3SX7A 2XWMA 4FRQA 2ZU7A 1ZI1A 5C1GA 1FO8A 2Z86A 5FUHA 4Y62A 4CJBA 2P73A 4FRHA 5D92A 1QWJA 2OI6A 3U2VA 2PX7A 4MIXA 3SXBA 3R3IA 3BRKX 1WVCA 1GX4A 3V0MA 1H7EA 3U0YA 4AC3A 5C8RA 4HO0A 1H7TA 3SX3A 1G8OA 1LL0A 3U2WA 3OH0A 1O0RA 1EZIA 4FRMA 5C47A 4KXOA 5CMJA 1VGUA 1G9RA 1VGWA 3OC9A 1ZDGA 2RJ4A 5C4EA 4BQHA 2O1GA 4FCEA 1V82A 4EE4A 2RIZA 2RIXA 4FROA 5C1LA 3SX5A 1H7FA 4O6MA 2WVKA 4FRPA 5C36A 1FRWA 4HO8A 4Y9XA 1FOAA 3SXCA 3CKQA 4DECA 1H5SC 4HO4A 4Y63A 1FZWA 1VGTA 1MC3A 1HJLA 2JCJA 4M28A 3DUVA 5EJZA 2AECA 3T7NA 3IOJA 2D7IA 2APCA 1H3MA 1XZ6A 2C0NA 4JD0A 1NF5B 3D98A 1WSZA 1YP2A 2VSHA 4NAIA 4KNRA 2I5EA 4EEMA 4EVWA 1H5RA 3FOQA 1MP4A 1FXJA 3ZLLA 4M4KA 1W57A 5CMGX 1TW1A 2P72A 1KWSA 4CJ8A 3SPTA 5D91A 3TZTA 4G3PA 3Q4SA 2V0KA 3CKOA 3CGXA 4C2SA 1G23A 2GGOA 4KC1A 1IINA 3K8DA 2YQHA 3OH2A 1ZI3A 5FU0A 3NGWA 3V0QA 1GX0A 1FXOA 4Y7TA 3RMWA 1QG8A 1W77A 1PZTA 1G97A 2O1HA 1LZIA 2WGZA
chains in the Genus database with same CATH topology
1R7XA 1Z90A 3USRA 2VXMA 3CU0A 4Y7FA 4FRAA 4HG6A 4KNXA 1GWVA 1I52A 1S4NA 1S4PA 4O6NA 5C3DA 3DJ4A 4FRBA 1JVGA 1O7QA 2Y4MA 4IRPA 1OQMB 2OI7A 1NHEB 2VD4A 1FGGA 1ZDFA 5L6SA 1E5KA 4D0ZA 3RMVA 3LW6A 5CQNX 3OH1A 3V8YA 2AH9A 1LZ7A 4HOCA 3CKNA 4B5BA 1JYKA 1NQIB 3E26A 1ZCTA 1VH3A 3I0DA 2RJ8A 4HCQA 1R7UA 2VSIA 2MZBA 1XHBA 3I0HA 4LW6A 1H4DA 2E8BA 2V0HA 2UX8A 1NKHB 2V0IA 1WT0A 4R7PA 3ZGFA 3I0LA 3OKRA 1H7HA 1ZJ3A 5CQMX 1MP3A 2YQSA 1VGZA 3CKJA 3V91A 3V0OA 5C3BA 5IFYA 4ECMA 3V8ZA 1LL3A 1GQCA 2V0LA 1ZJ0A 2D7RA 4Q7CA 1H5SB 2FYCB 4KT7A 1VICA 4Y6NA 2Y7AA 5JQQA 4E1KA 3POLA 1GA8A 1PZYB 2FYAA 3E25A 1V84A 1ON6A 2QH5A 1G2VA 4B4MA 3I0IX 2FYDB 1HM8A 2ICYA 1LZ0A 4FCUA 5C4CA 2GGQA 4KPXA 5C48A 4G3QA 3QVBA 2BO7A 2YQCA 2I5KA 3D5NA 1LZJA 3V0NA 3V0LA 3ST8A 2XMEA 1G93A 3IOHA 4ZDQA 1FG5N 5FTSA 2ICXA 4G87A 2NXVA 5DDVA 2RJ7A 5FYEA 4EEGA 3V0PA 1ZJOA 4Y7UA 2AM3A 1R82A 3SXAA 2CU2A 3Q80A 2QKXA 3BCVA 3FWWA 5AJNA 3T7OA 3HL3A 3OGZA 3JUJA 4B2XA 1G1LA 4FRLA 5FTVA 1FR9A 1QGQA 1ZHJA 2RJ6A 4NAKA 3OH4A 4IRQA 1QGSA 3Q7UA 5CMFX 4NALA 2OEGA 5BXCA 2AE7A 4B2WA 1JYLA 1YROB 2VFZA 5I1FA 1G95A 2RJ1A 1FR8A 3RSBA 1ZJPA 2RJ0A 1WT2A 1H7LA 1VZXA 4MYBA 4ASYA 3F1CA 4D48A 1OMZA 2WAWA 1H5RB 1HJJA 1TVYA 5FV9A 1YP3A 2BO4A 2BO8A 1INJA 4XWIA 3OH3A 5C1HA 1IIMA 1H7QA 4JISA 1HM9A 1R7TA 2VS5A 4B4GA 5C49A 1G0RA 4HO9A 1MP5A 1WT3A 1ZI4A 3I0FA 5CQPA 2AM5A 2OEFA 2VK9A 2A8WA 1EYRA 1R81A 2VS3A 2ZU9A 1NWGB 2YESA 4FIXA 1JVDA 3T7MA 4D0TA 2WEEA 2XWNA 2FFVA 1TW5A 1TZFA 2WE9A 3ZGGA 1ZCVA 1S4OA 4Y64A 4CVHA 1R7YA 2O1FA 3GUEA 3U0XA 5L6VA 2J0BA 3N9WA 3TQDA 4K6RA 5C38A 2AESA 5HS2A 4AYJA 1H5TA 2YQJA 4D11A 4Y7GA 4DDZA 2WVMA 4ASJA 1HV9A 4B3UA 4ARWA 4HO2A 4DE7A 3JUKA 3SXGA 1LVWA 4AAWA 2VXLA 2XMHA 1WT1A 4J18A 4EE3A 4KRVA 4HO3A 2A8UA 1VPAA 4HO5A 2VS4A 2Y4LA 3SXDA 1VM8A 4AYLA 1H4CA 2YC3A 4FRDA 5EJ1A 1ZI5A 2JCLA 2JCOA 1V83A 2DPWA 1H5TB 2BO6A 1SS9A 2W0WA 4P02A 2W0VA 4FREA 3SX8A 5IDTA 4CJCA 2WVLA 2Y6PA 3O3PA 3IOIA 4KPZA 2X5ZA 4KC4A 4M2BA 2RIYA 3K8EA 4BMAA 1LL2A 3PNNA 2RJ5A 1FGXA 3U2UA 1GQ9A 4P00A 4B4BA 1H5SD 1O7OA 5CQOA 5C4FA 2E3DA 3OAMA 3F1YA 4B42A 4KQLA 1ZCYA 2Z87A 4D11C 5CQLX 1ZIZA 1FWYA 4M2AA 1JV3A 1VH1A 1ZJ1A 2FYBA 3I0EA 1YP4A 4HO6A 3ZLKA 3PKQA 1H7GA 4MNDA 3KIAA 2XWLA 4EEOA 1H4EA 1JV1A 1O23B 2QGIA 4L41C 1VZUA 4Y6UA 4EE5A 4NANA 5AJOA 5EIYA 2RITA 3D8VA 4FIYA 4Y7VA 3ZF8A 2Y4KA 2X60A 3I0JA 3USQA 1G3LA 2FFUA 4LW3A 2YC5A 5DDTA 3U2TA 2X5SA 2YCMA 3JTJA 3R2WA 5C4BA 1ZCUA 5C3AA 3EE5A 4FQWA 1ZJ2A 5AJPA 1R7VA 5CMIA 5FU8A 2AGDA 1VZTA 2I7BA 5IDSA 1INIA 1ON8A 4YS8A 1R80A 1GWWA 2PA4A 2Q4JA 2D0JA 2PGYA 2PGVA 1OMXA 3CKVA 4KC2A 2ZU8A 1K4VA 1W55A 2V0JA 3SXEA 2FY7A 1HM0A 2J0AA 3PKPA 3V90A 1NMMB 5CMHA 4G3SA 5J49A 3I0CA 3DK5A 3I0KA 2P6WA 2RJ9A 3I0GA 2JCKA 5C4DA 1FO9A 2OI5A 4GBPA 2X65A 4EEAA 2Y4JA 3U2XA 4UEGA 1H5SA 2AM4A 3SX7A 2XWMA 4FRQA 2ZU7A 1ZI1A 5C1GA 1FO8A 2Z86A 5FUHA 4Y62A 4CJBA 2P73A 4FRHA 5D92A 1QWJA 2OI6A 3U2VA 2PX7A 4MIXA 3SXBA 3R3IA 3BRKX 1WVCA 1GX4A 3V0MA 1H7EA 3U0YA 4AC3A 5C8RA 4HO0A 1H7TA 3SX3A 1G8OA 1LL0A 3U2WA 3OH0A 1O0RA 1EZIA 4FRMA 5C47A 4KXOA 5CMJA 1VGUA 1G9RA 1VGWA 3OC9A 1ZDGA 2RJ4A 5C4EA 4BQHA 2O1GA 4FCEA 1V82A 4EE4A 2RIZA 2RIXA 4FROA 5C1LA 3SX5A 1H7FA 4O6MA 2WVKA 4FRPA 5C36A 1FRWA 4HO8A 4Y9XA 1FOAA 3SXCA 3CKQA 4DECA 1H5SC 4HO4A 4Y63A 1FZWA 1VGTA 1MC3A 1HJLA 2JCJA 4M28A 3DUVA 5EJZA 2AECA 3T7NA 3IOJA 2D7IA 2APCA 1H3MA 1XZ6A 2C0NA 4JD0A 1NF5B 3D98A 1WSZA 1YP2A 2VSHA 4NAIA 4KNRA 2I5EA 4EEMA 4EVWA 1H5RA 3FOQA 1MP4A 1FXJA 3ZLLA 4M4KA 1W57A 5CMGX 1TW1A 2P72A 1KWSA 4CJ8A 3SPTA 5D91A 3TZTA 4G3PA 3Q4SA 2V0KA 3CKOA 3CGXA 4C2SA 1G23A 2GGOA 4KC1A 1IINA 3K8DA 2YQHA 3OH2A 1ZI3A 5FU0A 3NGWA 3V0QA 1GX0A 1FXOA 4Y7TA 3RMWA 1QG8A 1W77A 1PZTA 1G97A 2O1HA 1LZIA 2WGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7X A;  1Z90 A;  3USR A;  2VXM A;  3CU0 A;  4Y7F A;  4FRA A;  4HG6 A;  4KNX A;  1GWV A;  1I52 A;  1S4N A;  1S4P A;  5C3D A;  3DJ4 A;  4FRB A;  1JVG A;  1O7Q A;  2Y4M A;  4IRP A;  1OQM B;  2OI7 A;  1NHE B;  2VD4 A;  1FGG A;  1ZDF A;  5L6S A;  1E5K A;  4D0Z A;  3RMV A;  3LW6 A;  5CQN X;  3OH1 A;  3V8Y A;  2AH9 A;  1LZ7 A;  4HOC A;  3CKN A;  4B5B A;  1JYK A;  1NQI B;  3E26 A;  1ZCT A;  1VH3 A;  3I0D A;  2RJ8 A;  4HCQ A;  1R7U A;  2VSI A;  2MZB A;  1XHB A;  3I0H A;  4LW6 A;  1H4D A;  2E8B A;  2V0H A;  2UX8 A;  1NKH B;  2V0I A;  1WT0 A;  4R7P A;  3ZGF A;  3I0L A;  3OKR A;  1H7H A;  1ZJ3 A;  5CQM X;  1MP3 A;  2YQS A;  1VGZ A;  3CKJ A;  3V91 A;  3V0O A;  5C3B A;  5IFY A;  4ECM A;  3V8Z A;  1LL3 A;  1GQC A;  2V0L A;  1ZJ0 A;  2D7R A;  1H5S B;  2FYC B;  4KT7 A;  1VIC A;  4Y6N A;  2Y7A A;  5JQQ A;  4E1K A;  3POL A;  1GA8 A;  1PZY B;  2FYA A;  3E25 A;  1V84 A;  1ON6 A;  2QH5 A;  1G2V A;  4B4M A;  3I0I X;  2FYD B;  1HM8 A;  2ICY A;  1LZ0 A;  4FCU A;  5C4C A;  2GGQ A;  4KPX A;  5C48 A;  4G3Q A;  3QVB A;  2BO7 A;  2YQC A;  2I5K A;  3D5N A;  1LZJ A;  3V0N A;  3V0L A;  3ST8 A;  2XME A;  1G93 A;  3IOH A;  4ZDQ A;  1FG5 N;  5FTS A;  2ICX A;  4G87 A;  2NXV A;  5DDV A;  2RJ7 A;  5FYE A;  4EEG A;  3V0P A;  1ZJO A;  4Y7U A;  2AM3 A;  1R82 A;  3SXA A;  2CU2 A;  3Q80 A;  2QKX A;  3BCV A;  3FWW A;  5AJN A;  3T7O A;  3HL3 A;  3OGZ A;  3JUJ A;  4B2X A;  1G1L A;  4FRL A;  5FTV A;  1FR9 A;  1QGQ A;  1ZHJ A;  2RJ6 A;  4NAK A;  3OH4 A;  4IRQ A;  1QGS A;  3Q7U A;  5CMF X;  4NAL A;  2OEG A;  5BXC A;  2AE7 A;  4B2W A;  1JYL A;  1YRO B;  2VFZ A;  5I1F A;  1G95 A;  2RJ1 A;  1FR8 A;  3RSB A;  1ZJP A;  2RJ0 A;  1WT2 A;  1H7L A;  1VZX A;  4MYB A;  4ASY A;  3F1C A;  4D48 A;  1OMZ A;  2WAW A;  1H5R B;  1HJJ A;  1TVY A;  5FV9 A;  1YP3 A;  2BO4 A;  2BO8 A;  1INJ A;  4XWI A;  3OH3 A;  5C1H A;  1IIM A;  1H7Q A;  4JIS A;  1HM9 A;  1R7T A;  2VS5 A;  4B4G A;  5C49 A;  1G0R A;  4HO9 A;  1MP5 A;  1WT3 A;  1ZI4 A;  3I0F A;  5CQP A;  2AM5 A;  2OEF A;  2A8W A;  1EYR A;  1R81 A;  2VS3 A;  2ZU9 A;  1NWG B;  2YES A;  1JVD A;  3T7M A;  4D0T A;  2WEE A;  2XWN A;  2FFV A;  1TW5 A;  1TZF A;  2WE9 A;  3ZGG A;  1ZCV A;  1S4O A;  4Y64 A;  4CVH A;  1R7Y A;  2O1F A;  3GUE A;  3U0X A;  5L6V A;  3TQD A;  3N9W A;  4K6R A;  5C38 A;  2AES A;  5HS2 A;  4AYJ A;  1H5T A;  2YQJ A;  4D11 A;  4Y7G A;  4DDZ A;  2WVM A;  4ASJ A;  1HV9 A;  4B3U A;  4ARW A;  4HO2 A;  4DE7 A;  3JUK A;  3SXG A;  1LVW A;  4AAW A;  2VXL A;  2XMH A;  1WT1 A;  4J18 A;  4EE3 A;  4KRV A;  4HO3 A;  2A8U A;  1VPA A;  4HO5 A;  2VS4 A;  2Y4L A;  3SXD A;  1VM8 A;  4AYL A;  1H4C A;  2YC3 A;  4FRD A;  5EJ1 A;  1ZI5 A;  2JCL A;  2JCO A;  1V83 A;  2DPW A;  1H5T B;  2BO6 A;  1SS9 A;  2W0W A;  4P02 A;  2W0V A;  4FRE A;  3SX8 A;  5IDT A;  4CJC A;  2WVL A;  2Y6P A;  3O3P A;  3IOI A;  4KPZ A;  2X5Z A;  4KC4 A;  4M2B A;  2RIY A;  3K8E A;  4BMA A;  1LL2 A;  3PNN A;  2RJ5 A;  1FGX A;  3U2U A;  1GQ9 A;  4P00 A;  4B4B A;  1H5S D;  1O7O A;  5CQO A;  5C4F A;  2E3D A;  3OAM A;  3F1Y A;  4B42 A;  4KQL A;  1ZCY A;  2Z87 A;  4D11 C;  5CQL X;  1ZIZ A;  1FWY A;  4M2A A;  1JV3 A;  1VH1 A;  1ZJ1 A;  2FYB A;  3I0E A;  1YP4 A;  4HO6 A;  3ZLK A;  3PKQ A;  1H7G A;  4MND A;  3KIA A;  2XWL A;  4EEO A;  1H4E A;  1JV1 A;  1O23 B;  2QGI A;  4L41 C;  1VZU A;  4Y6U A;  4EE5 A;  4NAN A;  5AJO A;  5EIY A;  2RIT A;  3D8V A;  4Y7V A;  3ZF8 A;  2Y4K A;  2X60 A;  3I0J A;  3USQ A;  1G3L A;  2FFU A;  4LW3 A;  2YC5 A;  5DDT A;  3U2T A;  2X5S A;  2YCM A;  3JTJ A;  3R2W A;  5C4B A;  1ZCU A;  5C3A A;  3EE5 A;  4FQW A;  1ZJ2 A;  5AJP A;  1R7V A;  5CMI A;  5FU8 A;  2AGD A;  1VZT A;  2I7B A;  5IDS A;  1INI A;  1ON8 A;  4YS8 A;  1R80 A;  1GWW A;  2PA4 A;  2Q4J A;  2D0J A;  2PGY A;  2PGV A;  1OMX A;  3CKV A;  4KC2 A;  2ZU8 A;  1K4V A;  1W55 A;  2V0J A;  3SXE A;  2FY7 A;  1HM0 A;  3PKP A;  3V90 A;  1NMM B;  5CMH A;  4G3S A;  5J49 A;  3I0C A;  3DK5 A;  3I0K A;  2P6W A;  2RJ9 A;  3I0G A;  2JCK A;  5C4D A;  1FO9 A;  2OI5 A;  4GBP A;  2X65 A;  4EEA A;  2Y4J A;  3U2X A;  4UEG A;  1H5S A;  2AM4 A;  3SX7 A;  2XWM A;  4FRQ A;  2ZU7 A;  1ZI1 A;  5C1G A;  1FO8 A;  2Z86 A;  5FUH A;  4Y62 A;  4CJB A;  2P73 A;  4FRH A;  1QWJ A;  2OI6 A;  3U2V A;  2PX7 A;  3SXB A;  3R3I A;  3BRK X;  1WVC A;  1GX4 A;  3V0M A;  1H7E A;  3U0Y A;  4AC3 A;  5C8R A;  4HO0 A;  1H7T A;  3SX3 A;  1G8O A;  1LL0 A;  3U2W A;  3OH0 A;  1O0R A;  1EZI A;  4FRM A;  5C47 A;  4KXO A;  5CMJ A;  1VGU A;  1G9R A;  1VGW A;  3OC9 A;  1ZDG A;  2RJ4 A;  5C4E A;  4BQH A;  2O1G A;  4FCE A;  1V82 A;  4EE4 A;  2RIZ A;  2RIX A;  4FRO A;  5C1L A;  3SX5 A;  1H7F A;  2WVK A;  4FRP A;  5C36 A;  1FRW A;  4HO8 A;  4Y9X A;  1FOA A;  3SXC A;  3CKQ A;  4DEC A;  1H5S C;  4HO4 A;  4Y63 A;  1FZW A;  1VGT A;  1MC3 A;  1HJL A;  2JCJ A;  4M28 A;  3DUV A;  5EJZ A;  2AEC A;  3T7N A;  3IOJ A;  2D7I A;  2APC A;  1H3M A;  1XZ6 A;  4JD0 A;  1NF5 B;  3D98 A;  1WSZ A;  1YP2 A;  2VSH A;  4NAI A;  4KNR A;  2I5E A;  4EEM A;  4EVW A;  1H5R A;  3FOQ A;  1MP4 A;  1FXJ A;  3ZLL A;  4M4K A;  1W57 A;  5CMG X;  1TW1 A;  2P72 A;  1KWS A;  4CJ8 A;  3SPT A;  3TZT A;  4G3P A;  3Q4S A;  2V0K A;  3CKO A;  3CGX A;  4C2S A;  1G23 A;  2GGO A;  4KC1 A;  1IIN A;  3K8D A;  2YQH A;  3OH2 A;  1ZI3 A;  5FU0 A;  3NGW A;  3V0Q A;  1GX0 A;  1FXO A;  4Y7T A;  3RMW A;  1QG8 A;  1W77 A;  1PZT A;  1G97 A;  2O1H A;  1LZI A;  2WGZ A; 
#chains in the Genus database with same CATH topology
 1R7X A;  1Z90 A;  3USR A;  2VXM A;  3CU0 A;  4Y7F A;  4FRA A;  4HG6 A;  4KNX A;  1GWV A;  1I52 A;  1S4N A;  1S4P A;  4O6N A;  5C3D A;  3DJ4 A;  4FRB A;  1JVG A;  1O7Q A;  2Y4M A;  4IRP A;  1OQM B;  2OI7 A;  1NHE B;  2VD4 A;  1FGG A;  1ZDF A;  5L6S A;  1E5K A;  4D0Z A;  3RMV A;  3LW6 A;  5CQN X;  3OH1 A;  3V8Y A;  2AH9 A;  1LZ7 A;  4HOC A;  3CKN A;  4B5B A;  1JYK A;  1NQI B;  3E26 A;  1ZCT A;  1VH3 A;  3I0D A;  2RJ8 A;  4HCQ A;  1R7U A;  2VSI A;  2MZB A;  1XHB A;  3I0H A;  4LW6 A;  1H4D A;  2E8B A;  2V0H A;  2UX8 A;  1NKH B;  2V0I A;  1WT0 A;  4R7P A;  3ZGF A;  3I0L A;  3OKR A;  1H7H A;  1ZJ3 A;  5CQM X;  1MP3 A;  2YQS A;  1VGZ A;  3CKJ A;  3V91 A;  3V0O A;  5C3B A;  5IFY A;  4ECM A;  3V8Z A;  1LL3 A;  1GQC A;  2V0L A;  1ZJ0 A;  2D7R A;  4Q7C A;  1H5S B;  2FYC B;  4KT7 A;  1VIC A;  4Y6N A;  2Y7A A;  5JQQ A;  4E1K A;  3POL A;  1GA8 A;  1PZY B;  2FYA A;  3E25 A;  1V84 A;  1ON6 A;  2QH5 A;  1G2V A;  4B4M A;  3I0I X;  2FYD B;  1HM8 A;  2ICY A;  1LZ0 A;  4FCU A;  5C4C A;  2GGQ A;  4KPX A;  5C48 A;  4G3Q A;  3QVB A;  2BO7 A;  2YQC A;  2I5K A;  3D5N A;  1LZJ A;  3V0N A;  3V0L A;  3ST8 A;  2XME A;  1G93 A;  3IOH A;  4ZDQ A;  1FG5 N;  5FTS A;  2ICX A;  4G87 A;  2NXV A;  5DDV A;  2RJ7 A;  5FYE A;  4EEG A;  3V0P A;  1ZJO A;  4Y7U A;  2AM3 A;  1R82 A;  3SXA A;  2CU2 A;  3Q80 A;  2QKX A;  3BCV A;  3FWW A;  5AJN A;  3T7O A;  3HL3 A;  3OGZ A;  3JUJ A;  4B2X A;  1G1L A;  4FRL A;  5FTV A;  1FR9 A;  1QGQ A;  1ZHJ A;  2RJ6 A;  4NAK A;  3OH4 A;  4IRQ A;  1QGS A;  3Q7U A;  5CMF X;  4NAL A;  2OEG A;  5BXC A;  2AE7 A;  4B2W A;  1JYL A;  1YRO B;  2VFZ A;  5I1F A;  1G95 A;  2RJ1 A;  1FR8 A;  3RSB A;  1ZJP A;  2RJ0 A;  1WT2 A;  1H7L A;  1VZX A;  4MYB A;  4ASY A;  3F1C A;  4D48 A;  1OMZ A;  2WAW A;  1H5R B;  1HJJ A;  1TVY A;  5FV9 A;  1YP3 A;  2BO4 A;  2BO8 A;  1INJ A;  4XWI A;  3OH3 A;  5C1H A;  1IIM A;  1H7Q A;  4JIS A;  1HM9 A;  1R7T A;  2VS5 A;  4B4G A;  5C49 A;  1G0R A;  4HO9 A;  1MP5 A;  1WT3 A;  1ZI4 A;  3I0F A;  5CQP A;  2AM5 A;  2OEF A;  2VK9 A;  2A8W A;  1EYR A;  1R81 A;  2VS3 A;  2ZU9 A;  1NWG B;  2YES A;  4FIX A;  1JVD A;  3T7M A;  4D0T A;  2WEE A;  2XWN A;  2FFV A;  1TW5 A;  1TZF A;  2WE9 A;  3ZGG A;  1ZCV A;  1S4O A;  4Y64 A;  4CVH A;  1R7Y A;  2O1F A;  3GUE A;  3U0X A;  5L6V A;  2J0B A;  3N9W A;  3TQD A;  4K6R A;  5C38 A;  2AES A;  5HS2 A;  4AYJ A;  1H5T A;  2YQJ A;  4D11 A;  4Y7G A;  4DDZ A;  2WVM A;  4ASJ A;  1HV9 A;  4B3U A;  4ARW A;  4HO2 A;  4DE7 A;  3JUK A;  3SXG A;  1LVW A;  4AAW A;  2VXL A;  2XMH A;  1WT1 A;  4J18 A;  4EE3 A;  4KRV A;  4HO3 A;  2A8U A;  1VPA A;  4HO5 A;  2VS4 A;  2Y4L A;  3SXD A;  1VM8 A;  4AYL A;  1H4C A;  2YC3 A;  4FRD A;  5EJ1 A;  1ZI5 A;  2JCL A;  2JCO A;  1V83 A;  2DPW A;  1H5T B;  2BO6 A;  1SS9 A;  2W0W A;  4P02 A;  2W0V A;  4FRE A;  3SX8 A;  5IDT A;  4CJC A;  2WVL A;  2Y6P A;  3O3P A;  3IOI A;  4KPZ A;  2X5Z A;  4KC4 A;  4M2B A;  2RIY A;  3K8E A;  4BMA A;  1LL2 A;  3PNN A;  2RJ5 A;  1FGX A;  3U2U A;  1GQ9 A;  4P00 A;  4B4B A;  1H5S D;  1O7O A;  5CQO A;  5C4F A;  2E3D A;  3OAM A;  3F1Y A;  4B42 A;  4KQL A;  1ZCY A;  2Z87 A;  4D11 C;  5CQL X;  1ZIZ A;  1FWY A;  4M2A A;  1JV3 A;  1VH1 A;  1ZJ1 A;  2FYB A;  3I0E A;  1YP4 A;  4HO6 A;  3ZLK A;  3PKQ A;  1H7G A;  4MND A;  3KIA A;  2XWL A;  4EEO A;  1H4E A;  1JV1 A;  1O23 B;  2QGI A;  4L41 C;  1VZU A;  4Y6U A;  4EE5 A;  4NAN A;  5AJO A;  5EIY A;  2RIT A;  3D8V A;  4FIY A;  4Y7V A;  3ZF8 A;  2Y4K A;  2X60 A;  3I0J A;  3USQ A;  1G3L A;  2FFU A;  4LW3 A;  2YC5 A;  5DDT A;  3U2T A;  2X5S A;  2YCM A;  3JTJ A;  3R2W A;  5C4B A;  1ZCU A;  5C3A A;  3EE5 A;  4FQW A;  1ZJ2 A;  5AJP A;  1R7V A;  5CMI A;  5FU8 A;  2AGD A;  1VZT A;  2I7B A;  5IDS A;  1INI A;  1ON8 A;  4YS8 A;  1R80 A;  1GWW A;  2PA4 A;  2Q4J A;  2D0J A;  2PGY A;  2PGV A;  1OMX A;  3CKV A;  4KC2 A;  2ZU8 A;  1K4V A;  1W55 A;  2V0J A;  3SXE A;  2FY7 A;  1HM0 A;  2J0A A;  3PKP A;  3V90 A;  1NMM B;  5CMH A;  4G3S A;  5J49 A;  3I0C A;  3DK5 A;  3I0K A;  2P6W A;  2RJ9 A;  3I0G A;  2JCK A;  5C4D A;  1FO9 A;  2OI5 A;  4GBP A;  2X65 A;  4EEA A;  2Y4J A;  3U2X A;  4UEG A;  1H5S A;  2AM4 A;  3SX7 A;  2XWM A;  4FRQ A;  2ZU7 A;  1ZI1 A;  5C1G A;  1FO8 A;  2Z86 A;  5FUH A;  4Y62 A;  4CJB A;  2P73 A;  4FRH A;  5D92 A;  1QWJ A;  2OI6 A;  3U2V A;  2PX7 A;  4MIX A;  3SXB A;  3R3I A;  3BRK X;  1WVC A;  1GX4 A;  3V0M A;  1H7E A;  3U0Y A;  4AC3 A;  5C8R A;  4HO0 A;  1H7T A;  3SX3 A;  1G8O A;  1LL0 A;  3U2W A;  3OH0 A;  1O0R A;  1EZI A;  4FRM A;  5C47 A;  4KXO A;  5CMJ A;  1VGU A;  1G9R A;  1VGW A;  3OC9 A;  1ZDG A;  2RJ4 A;  5C4E A;  4BQH A;  2O1G A;  4FCE A;  1V82 A;  4EE4 A;  2RIZ A;  2RIX A;  4FRO A;  5C1L A;  3SX5 A;  1H7F A;  4O6M A;  2WVK A;  4FRP A;  5C36 A;  1FRW A;  4HO8 A;  4Y9X A;  1FOA A;  3SXC A;  3CKQ A;  4DEC A;  1H5S C;  4HO4 A;  4Y63 A;  1FZW A;  1VGT A;  1MC3 A;  1HJL A;  2JCJ A;  4M28 A;  3DUV A;  5EJZ A;  2AEC A;  3T7N A;  3IOJ A;  2D7I A;  2APC A;  1H3M A;  1XZ6 A;  2C0N A;  4JD0 A;  1NF5 B;  3D98 A;  1WSZ A;  1YP2 A;  2VSH A;  4NAI A;  4KNR A;  2I5E A;  4EEM A;  4EVW A;  1H5R A;  3FOQ A;  1MP4 A;  1FXJ A;  3ZLL A;  4M4K A;  1W57 A;  5CMG X;  1TW1 A;  2P72 A;  1KWS A;  4CJ8 A;  3SPT A;  5D91 A;  3TZT A;  4G3P A;  3Q4S A;  2V0K A;  3CKO A;  3CGX A;  4C2S A;  1G23 A;  2GGO A;  4KC1 A;  1IIN A;  3K8D A;  2YQH A;  3OH2 A;  1ZI3 A;  5FU0 A;  3NGW A;  3V0Q A;  1GX0 A;  1FXO A;  4Y7T A;  3RMW A;  1QG8 A;  1W77 A;  1PZT A;  1G97 A;  2O1H A;  1LZI A;  2WGZ A; 
#chains in the Genus database with same CATH homology
 1R7X A;  1Z90 A;  3USR A;  2VXM A;  3CU0 A;  4Y7F A;  4FRA A;  4HG6 A;  4KNX A;  1GWV A;  1I52 A;  1S4N A;  1S4P A;  4O6N A;  5C3D A;  3DJ4 A;  4FRB A;  1JVG A;  1O7Q A;  2Y4M A;  4IRP A;  1OQM B;  2OI7 A;  1NHE B;  2VD4 A;  1FGG A;  1ZDF A;  5L6S A;  1E5K A;  4D0Z A;  3RMV A;  3LW6 A;  5CQN X;  3OH1 A;  3V8Y A;  2AH9 A;  1LZ7 A;  4HOC A;  3CKN A;  4B5B A;  1JYK A;  1NQI B;  3E26 A;  1ZCT A;  1VH3 A;  3I0D A;  2RJ8 A;  4HCQ A;  1R7U A;  2VSI A;  2MZB A;  1XHB A;  3I0H A;  4LW6 A;  1H4D A;  2E8B A;  2V0H A;  2UX8 A;  1NKH B;  2V0I A;  1WT0 A;  4R7P A;  3ZGF A;  3I0L A;  3OKR A;  1H7H A;  1ZJ3 A;  5CQM X;  1MP3 A;  2YQS A;  1VGZ A;  3CKJ A;  3V91 A;  3V0O A;  5C3B A;  5IFY A;  4ECM A;  3V8Z A;  1LL3 A;  1GQC A;  2V0L A;  1ZJ0 A;  2D7R A;  4Q7C A;  1H5S B;  2FYC B;  4KT7 A;  1VIC A;  4Y6N A;  2Y7A A;  5JQQ A;  4E1K A;  3POL A;  1GA8 A;  1PZY B;  2FYA A;  3E25 A;  1V84 A;  1ON6 A;  2QH5 A;  1G2V A;  4B4M A;  3I0I X;  2FYD B;  1HM8 A;  2ICY A;  1LZ0 A;  4FCU A;  5C4C A;  2GGQ A;  4KPX A;  5C48 A;  4G3Q A;  3QVB A;  2BO7 A;  2YQC A;  2I5K A;  3D5N A;  1LZJ A;  3V0N A;  3V0L A;  3ST8 A;  2XME A;  1G93 A;  3IOH A;  4ZDQ A;  1FG5 N;  5FTS A;  2ICX A;  4G87 A;  2NXV A;  5DDV A;  2RJ7 A;  5FYE A;  4EEG A;  3V0P A;  1ZJO A;  4Y7U A;  2AM3 A;  1R82 A;  3SXA A;  2CU2 A;  3Q80 A;  2QKX A;  3BCV A;  3FWW A;  5AJN A;  3T7O A;  3HL3 A;  3OGZ A;  3JUJ A;  4B2X A;  1G1L A;  4FRL A;  5FTV A;  1FR9 A;  1QGQ A;  1ZHJ A;  2RJ6 A;  4NAK A;  3OH4 A;  4IRQ A;  1QGS A;  3Q7U A;  5CMF X;  4NAL A;  2OEG A;  5BXC A;  2AE7 A;  4B2W A;  1JYL A;  1YRO B;  2VFZ A;  5I1F A;  1G95 A;  2RJ1 A;  1FR8 A;  3RSB A;  1ZJP A;  2RJ0 A;  1WT2 A;  1H7L A;  1VZX A;  4MYB A;  4ASY A;  3F1C A;  4D48 A;  1OMZ A;  2WAW A;  1H5R B;  1HJJ A;  1TVY A;  5FV9 A;  1YP3 A;  2BO4 A;  2BO8 A;  1INJ A;  4XWI A;  3OH3 A;  5C1H A;  1IIM A;  1H7Q A;  4JIS A;  1HM9 A;  1R7T A;  2VS5 A;  4B4G A;  5C49 A;  1G0R A;  4HO9 A;  1MP5 A;  1WT3 A;  1ZI4 A;  3I0F A;  5CQP A;  2AM5 A;  2OEF A;  2VK9 A;  2A8W A;  1EYR A;  1R81 A;  2VS3 A;  2ZU9 A;  1NWG B;  2YES A;  4FIX A;  1JVD A;  3T7M A;  4D0T A;  2WEE A;  2XWN A;  2FFV A;  1TW5 A;  1TZF A;  2WE9 A;  3ZGG A;  1ZCV A;  1S4O A;  4Y64 A;  4CVH A;  1R7Y A;  2O1F A;  3GUE A;  3U0X A;  5L6V A;  2J0B A;  3N9W A;  3TQD A;  4K6R A;  5C38 A;  2AES A;  5HS2 A;  4AYJ A;  1H5T A;  2YQJ A;  4D11 A;  4Y7G A;  4DDZ A;  2WVM A;  4ASJ A;  1HV9 A;  4B3U A;  4ARW A;  4HO2 A;  4DE7 A;  3JUK A;  3SXG A;  1LVW A;  4AAW A;  2VXL A;  2XMH A;  1WT1 A;  4J18 A;  4EE3 A;  4KRV A;  4HO3 A;  2A8U A;  1VPA A;  4HO5 A;  2VS4 A;  2Y4L A;  3SXD A;  1VM8 A;  4AYL A;  1H4C A;  2YC3 A;  4FRD A;  5EJ1 A;  1ZI5 A;  2JCL A;  2JCO A;  1V83 A;  2DPW A;  1H5T B;  2BO6 A;  1SS9 A;  2W0W A;  4P02 A;  2W0V A;  4FRE A;  3SX8 A;  5IDT A;  4CJC A;  2WVL A;  2Y6P A;  3O3P A;  3IOI A;  4KPZ A;  2X5Z A;  4KC4 A;  4M2B A;  2RIY A;  3K8E A;  4BMA A;  1LL2 A;  3PNN A;  2RJ5 A;  1FGX A;  3U2U A;  1GQ9 A;  4P00 A;  4B4B A;  1H5S D;  1O7O A;  5CQO A;  5C4F A;  2E3D A;  3OAM A;  3F1Y A;  4B42 A;  4KQL A;  1ZCY A;  2Z87 A;  4D11 C;  5CQL X;  1ZIZ A;  1FWY A;  4M2A A;  1JV3 A;  1VH1 A;  1ZJ1 A;  2FYB A;  3I0E A;  1YP4 A;  4HO6 A;  3ZLK A;  3PKQ A;  1H7G A;  4MND A;  3KIA A;  2XWL A;  4EEO A;  1H4E A;  1JV1 A;  1O23 B;  2QGI A;  4L41 C;  1VZU A;  4Y6U A;  4EE5 A;  4NAN A;  5AJO A;  5EIY A;  2RIT A;  3D8V A;  4FIY A;  4Y7V A;  3ZF8 A;  2Y4K A;  2X60 A;  3I0J A;  3USQ A;  1G3L A;  2FFU A;  4LW3 A;  2YC5 A;  5DDT A;  3U2T A;  2X5S A;  2YCM A;  3JTJ A;  3R2W A;  5C4B A;  1ZCU A;  5C3A A;  3EE5 A;  4FQW A;  1ZJ2 A;  5AJP A;  1R7V A;  5CMI A;  5FU8 A;  2AGD A;  1VZT A;  2I7B A;  5IDS A;  1INI A;  1ON8 A;  4YS8 A;  1R80 A;  1GWW A;  2PA4 A;  2Q4J A;  2D0J A;  2PGY A;  2PGV A;  1OMX A;  3CKV A;  4KC2 A;  2ZU8 A;  1K4V A;  1W55 A;  2V0J A;  3SXE A;  2FY7 A;  1HM0 A;  2J0A A;  3PKP A;  3V90 A;  1NMM B;  5CMH A;  4G3S A;  5J49 A;  3I0C A;  3DK5 A;  3I0K A;  2P6W A;  2RJ9 A;  3I0G A;  2JCK A;  5C4D A;  1FO9 A;  2OI5 A;  4GBP A;  2X65 A;  4EEA A;  2Y4J A;  3U2X A;  4UEG A;  1H5S A;  2AM4 A;  3SX7 A;  2XWM A;  4FRQ A;  2ZU7 A;  1ZI1 A;  5C1G A;  1FO8 A;  2Z86 A;  5FUH A;  4Y62 A;  4CJB A;  2P73 A;  4FRH A;  5D92 A;  1QWJ A;  2OI6 A;  3U2V A;  2PX7 A;  4MIX A;  3SXB A;  3R3I A;  3BRK X;  1WVC A;  1GX4 A;  3V0M A;  1H7E A;  3U0Y A;  4AC3 A;  5C8R A;  4HO0 A;  1H7T A;  3SX3 A;  1G8O A;  1LL0 A;  3U2W A;  3OH0 A;  1O0R A;  1EZI A;  4FRM A;  5C47 A;  4KXO A;  5CMJ A;  1VGU A;  1G9R A;  1VGW A;  3OC9 A;  1ZDG A;  2RJ4 A;  5C4E A;  4BQH A;  2O1G A;  4FCE A;  1V82 A;  4EE4 A;  2RIZ A;  2RIX A;  4FRO A;  5C1L A;  3SX5 A;  1H7F A;  4O6M A;  2WVK A;  4FRP A;  5C36 A;  1FRW A;  4HO8 A;  4Y9X A;  1FOA A;  3SXC A;  3CKQ A;  4DEC A;  1H5S C;  4HO4 A;  4Y63 A;  1FZW A;  1VGT A;  1MC3 A;  1HJL A;  2JCJ A;  4M28 A;  3DUV A;  5EJZ A;  2AEC A;  3T7N A;  3IOJ A;  2D7I A;  2APC A;  1H3M A;  1XZ6 A;  2C0N A;  4JD0 A;  1NF5 B;  3D98 A;  1WSZ A;  1YP2 A;  2VSH A;  4NAI A;  4KNR A;  2I5E A;  4EEM A;  4EVW A;  1H5R A;  3FOQ A;  1MP4 A;  1FXJ A;  3ZLL A;  4M4K A;  1W57 A;  5CMG X;  1TW1 A;  2P72 A;  1KWS A;  4CJ8 A;  3SPT A;  5D91 A;  3TZT A;  4G3P A;  3Q4S A;  2V0K A;  3CKO A;  3CGX A;  4C2S A;  1G23 A;  2GGO A;  4KC1 A;  1IIN A;  3K8D A;  2YQH A;  3OH2 A;  1ZI3 A;  5FU0 A;  3NGW A;  3V0Q A;  1GX0 A;  1FXO A;  4Y7T A;  3RMW A;  1QG8 A;  1W77 A;  1PZT A;  1G97 A;  2O1H A;  1LZI A;  2WGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...