4CJ8A

Monoclinic crystal form of bogt6a e192q in complex with udp-galnac, udp and galnac
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
238
structure length
238
Chain Sequence
SHMRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products
pubmed doi rcsb
source organism Bacteroides ovatus
molecule tags Transferase
total genus 62
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cj8A00
1NHEB 4NAIA 4EE3A 3TZTA 1OMZA 2YCMA 4FCEA 4GBPA 2VXLA 4Y6NA 1ZJ0A 2W0VA 1ON8A 4NANA 2GGOA 4D11A 1H3MA 1LZ0A 1LZ7A 2VS4A 2RJ8A 4FCUA 1JV1A 2X5ZA 4MNDA 4ASJA 4EEMA 5C4BA 5EJ1A 3U2XA 5AJNA 4M2AA 3CKVA 3I0FA 4FQWA 1G1LA 4D48A 1NQIB 4D0TA 4FRBA 1VICA 1H7HA 1ZI3A 4EEOA 1S4PA 2RJ0A 2Q4JA 2E8BA 2RJ6A 2JCKA 2VD4A 3ZGFA 4B4BA 4FRLA 4EE4A 3OC9A 1R7TA 3V0PA 1H5TA 4EE5A 4ARWA 3U2UA 3U0XA 3CGXA 3SPTA 1LL3A 1GQ9A 1G93A 4LW6A 3CKJA 1FO9A 2A8WA 1H5SB 3D5NA 4KC4A 5CQOA 2P6WA 1IIMA 1H5SD 2O1GA 3HL3A 1LZJA 1O7QA 5CQLX 1GWWA 2I5KA 1LL0A 1IINA 1VH1A 3I0DA 3IOIA 5C48A 4B42A 1FRWA 1FOAA 3V91A 2VFZA 4FRMA 1G3LA 2RJ1A 4KQLA 1V84A 3OH3A 2XWNA 4B5BA 5C3BA 4EEAA 3I0KA 3R2WA 4KPXA 1YP3A 2ZU7A 5IDTA 3DJ4A 2FYDB 3OKRA 2D0JA 5C4DA 2ZU8A 1PZYB 5C3AA 1S4NA 3EE5A 1K4VA 4HO8A 4HG6A 4KC1A 3SXAA 4KNXA 3ST8A 1ZI4A 3SX5A 2APCA 1H7QA 1MC3A 2X5SA 3I0JA 3IOJA 3R3IA 3Q80A 3T7MA 4AC3A 4DE7A 5C8RA 2BO4A 2P73A 4C2SA 1QWJA 1ZCTA 1FXOA 2Z87A 3SXDA 3BRKX 5CMHA 1ZI5A 2RIYA 3GUEA 1O0RA 5C36A 1R7XA 5IFYA 1VGUA 2ZU9A 5L6VA 1Z90A 5C1LA 4P00A 1E5KA 4Y7FA 1HJJA 2VS5A 3OH0A 5CMFX 5JQQA 3ZLKA 1MP5A 1ZJOA 2Y4LA 3V8YA 1FXJA 1ZJ2A 2JCLA 1VZTA 3U2TA 1INJA 3CKNA 3U0YA 4B4MA 4DDZA 2V0HA 3RMVA 5C3DA 4D0ZA 2FYBA 3BCVA 4FRAA 2YESA 1FG5N 1VGTA 1QGQA 1TW1A 3OH1A 4G87A 4FRPA 4JD0A 3OAMA 4FRHA 1H5SA 2AE7A 1NWGB 1EZIA 1GWVA 1KWSA 4HO9A 2OI7A 1PZTA 1R81A 3SXGA 4FREA 2PA4A 1R7YA 5C49A 4CJCA 2OEFA 1YP4A 4NALA 1MP3A 1XZ6A 2RIZA 5C38A 4UEGA 2GGQA 3TQDA 1H4DA 1HM0A 2XWMA 2WVMA 4HCQA 5C4EA 3USQA 1WT1A 1FGXA 2JCJA 5EIYA 1YROB 1WT2A 2V0LA 2MZBA 1WSZA 1WVCA 1FGGA 2Z86A 2RIXA 4Y7UA 4IRQA 4JISA 1R7UA 2VSHA 2BO6A 2XWLA 4E1KA 2Y4KA 4CJ8A 4ASYA 3RMWA 3U2VA 5CQNX 2RJ5A 2Y6PA 3FWWA 4KXOA 1NF5B 1G8OA 4R7PA 5C1HA 2VXMA 1VH3A 1TZFA 4M28A 2WGZA 4YS8A 1ZDFA 2AECA 3IOHA 5HS2A 3RSBA 4CVHA 1H4CA 3CKOA 3T7NA 4AYLA 2AM5A 3CU0A 1JYKA 5CQMX 3E25A 4FRQA 2FYCB 4K6RA 4KRVA 2WEEA 1V83A 4KPZA 2BO7A 4G3QA 3OH2A 1TW5A 1QG8A 1XHBA 2AESA 2YQCA 4Y7TA 1JVDA 2RJ7A 1G2VA 1FR8A 1ZJ1A 2V0KA 4BMAA 1H4EA 3FOQA 4M2BA 5FYEA 3SX3A 1H7TA 2FYAA 1VGWA 4B3UA 1V82A 1W57A 1ZJ3A 3V0LA 2WVKA 1H7FA 4Y7VA 2D7IA 3O3PA 1ZHJA 4ZDQA 2QH5A 1G95A 2X60A 4D11C 3PKQA 3QVBA 4LW3A 2V0IA 4FROA 3K8EA 2VS3A 1H7GA 4KT7A 3JUJA 3Q4SA 4B2WA 3U2WA 1INIA 4B2XA 4NAKA 4AAWA 2P72A 1GA8A 1G0RA 5CQPA 1ZCUA 1FO8A 3ZLLA 5IDSA 3V90A 1VGZA 2YC5A 3F1YA 2YQSA 5J49A 5C1GA 4FRDA 3OGZA 4B4GA 2V0JA 1R82A 4M4KA 2OEGA 3JTJA 4Y64A 1ZI1A 4HO0A 5C4FA 4KC2A 3K8DA 4G3SA 1ZDGA 4HO2A 1TVYA 2VSIA 1YP2A 3SXBA 2NXVA 3POLA 2ICYA 1H7EA 1H7LA 2AH9A 3V0NA 3E26A 1NMMB 1HM9A 5AJOA 2PGYA 5FU0A 1HJLA 1VPAA 2QKXA 1R80A 5DDVA 1WT0A 2XMEA 3JUKA 2OI6A 4HO5A 4Y63A 2YQHA 5C4CA 1SS9A 5FV9A 4MYBA 1FR9A 4EEGA 5CMJA 4Y6UA 1ON6A 5BXCA 1VZUA 3D98A 3Q7UA 2YQJA 2W0WA 2Y7AA 2AM3A 2O1HA 1H5RB 3I0LA 5FTVA 2D7RA 2X65A 1OQMB 5FUHA 4L41C 4ECMA 2WAWA 1ZJPA 5CMIA 4HOCA 1HV9A 3I0IX 1OMXA 1ZIZA 3N9WA 2I5EA 2Y4JA 1JVGA 3I0CA 4G3PA 1GQCA 1G97A 2WVLA 2ICXA 1O7OA 5EJZA 2UX8A 3F1CA 2A8UA 3I0GA 1GX0A 2FFUA 3D8VA 3PKPA 1ZCVA 1MP4A 2FY7A 5FU8A 2PX7A 4P02A 3SX7A 1HM8A 4HO6A 1GX4A 4HO3A 2AGDA 2O1FA 3PNNA 5AJPA 2OI5A 5FTSA 1LL2A 1R7VA 1WT3A 4Y7GA 5L6SA 2RJ9A 5I1FA 3V0QA 1ZCYA 3V0MA 4Y9XA 3SXEA 1S4OA 2BO8A 3OH4A 3KIAA 1G9RA 3NGWA 2DPWA 1FZWA 3DUVA 3DK5A 2RITA 1H5SC 3USRA 4HO4A 3SXCA 4CJBA 1O23B 1W77A 2JCOA 4BQHA 2E3DA 2XMHA 3V8ZA 3I0HA 4IRPA 1EYRA 1W55A 4KNRA 5C47A 2WE9A 4Y62A 1H5TB 1JYLA 2FFVA 4XWIA 2QGIA 3ZGGA 4DECA 5DDTA 4EVWA 1H5RA 2Y4MA 2RJ4A 3V0OA 4J18A 3LW6A 1VM8A 3T7OA 1FWYA 1QGSA 2CU2A 1NKHB 2AM4A 2PGVA 1G23A 5CMGX 1JV3A 1LZIA 1VZXA 3I0EA 2I7BA 1LVWA 4AYJA 3ZF8A 1I52A 3CKQA 2YC3A 3SX8A
chains in the Genus database with same CATH superfamily
1NHEB 4NAIA 4EE3A 3TZTA 1OMZA 2YCMA 4FCEA 4GBPA 2VXLA 4Y6NA 1ZJ0A 2W0VA 1ON8A 4NANA 2GGOA 4D11A 1H3MA 1LZ0A 1LZ7A 2VS4A 2RJ8A 4FCUA 1JV1A 2X5ZA 4MNDA 4ASJA 4EEMA 5C4BA 5EJ1A 3U2XA 5AJNA 4M2AA 3CKVA 3I0FA 4FQWA 1G1LA 4D48A 1NQIB 4D0TA 4FRBA 1VICA 1H7HA 1ZI3A 4EEOA 1S4PA 2RJ0A 2Q4JA 2C0NA 2E8BA 2JCKA 2RJ6A 2VD4A 5D92A 3ZGFA 4B4BA 4FRLA 4EE4A 3OC9A 1R7TA 3V0PA 1H5TA 4EE5A 4ARWA 3U2UA 3U0XA 3CGXA 5D91A 3SPTA 1LL3A 1GQ9A 1G93A 4LW6A 3CKJA 1FO9A 2A8WA 1H5SB 3D5NA 4KC4A 5CQOA 2P6WA 1IIMA 1H5SD 2O1GA 3HL3A 1LZJA 1O7QA 5CQLX 1GWWA 2I5KA 1LL0A 1IINA 1VH1A 3I0DA 3IOIA 5C48A 4B42A 1FRWA 1FOAA 3V91A 2VFZA 4FRMA 1G3LA 2RJ1A 4KQLA 1V84A 3OH3A 2XWNA 4B5BA 5C3BA 4EEAA 3I0KA 3R2WA 4KPXA 2J0AA 1YP3A 2ZU7A 5IDTA 3DJ4A 2FYDB 3OKRA 2D0JA 5C4DA 2ZU8A 1PZYB 5C3AA 1S4NA 3EE5A 1K4VA 4HO8A 4HG6A 4KC1A 3SXAA 4KNXA 3ST8A 1ZI4A 3SX5A 2APCA 1H7QA 1MC3A 2X5SA 3I0JA 3IOJA 3R3IA 3Q80A 3T7MA 4AC3A 4DE7A 5C8RA 2BO4A 2P73A 4C2SA 1QWJA 1ZCTA 1FXOA 2Z87A 3SXDA 3BRKX 5CMHA 1ZI5A 2RIYA 3GUEA 1O0RA 5C36A 1R7XA 5IFYA 1VGUA 2ZU9A 5L6VA 1Z90A 5C1LA 2VK9A 4P00A 1E5KA 4Y7FA 1HJJA 2VS5A 3OH0A 5CMFX 5JQQA 3ZLKA 1MP5A 1ZJOA 2Y4LA 3V8YA 1FXJA 1ZJ2A 2JCLA 1VZTA 3U2TA 1INJA 3CKNA 2J0BA 3U0YA 4B4MA 4DDZA 2V0HA 3RMVA 5C3DA 4D0ZA 2FYBA 3BCVA 4FRAA 2YESA 1FG5N 1VGTA 1QGQA 1TW1A 3OH1A 4G87A 4FRPA 4JD0A 3OAMA 4FRHA 1H5SA 2AE7A 1NWGB 1EZIA 1GWVA 1KWSA 4HO9A 2OI7A 1PZTA 1R81A 3SXGA 4FREA 2PA4A 1R7YA 5C49A 4CJCA 2OEFA 1YP4A 4NALA 1MP3A 1XZ6A 2RIZA 5C38A 4UEGA 2GGQA 3TQDA 1H4DA 1HM0A 2XWMA 2WVMA 4HCQA 5C4EA 3USQA 1WT1A 1FGXA 2JCJA 5EIYA 1YROB 1WT2A 2V0LA 2MZBA 1WSZA 1WVCA 1FGGA 2Z86A 2RIXA 4Y7UA 4IRQA 4JISA 1R7UA 2VSHA 2BO6A 2XWLA 4E1KA 2Y4KA 4CJ8A 4ASYA 3RMWA 3U2VA 5CQNX 2RJ5A 2Y6PA 3FWWA 4KXOA 1NF5B 1G8OA 4R7PA 5C1HA 2VXMA 1VH3A 1TZFA 4M28A 2WGZA 4YS8A 1ZDFA 2AECA 3IOHA 5HS2A 3RSBA 4CVHA 1H4CA 3CKOA 3T7NA 4AYLA 2AM5A 3CU0A 1JYKA 5CQMX 3E25A 4FRQA 2FYCB 4FIXA 4K6RA 4KRVA 2WEEA 1V83A 4KPZA 2BO7A 4G3QA 3OH2A 1TW5A 1QG8A 1XHBA 2AESA 2YQCA 4Y7TA 1JVDA 2RJ7A 1G2VA 1FR8A 1ZJ1A 2V0KA 4BMAA 1H4EA 3FOQA 4M2BA 5FYEA 3SX3A 1H7TA 2FYAA 1VGWA 4B3UA 1V82A 1W57A 1ZJ3A 3V0LA 2WVKA 1H7FA 4Y7VA 2D7IA 3O3PA 1ZHJA 4ZDQA 2QH5A 4O6MA 1G95A 2X60A 4D11C 3PKQA 3QVBA 4LW3A 2V0IA 4FROA 3K8EA 2VS3A 1H7GA 4KT7A 3JUJA 3Q4SA 4B2WA 3U2WA 1INIA 4B2XA 4NAKA 4AAWA 2P72A 1GA8A 1G0RA 5CQPA 1ZCUA 1FO8A 3ZLLA 5IDSA 4FIYA 3V90A 1VGZA 2YC5A 3F1YA 2YQSA 5J49A 5C1GA 4FRDA 3OGZA 4B4GA 2V0JA 1R82A 4M4KA 2OEGA 3JTJA 4Y64A 1ZI1A 4HO0A 5C4FA 4KC2A 3K8DA 4G3SA 1ZDGA 4HO2A 1TVYA 2VSIA 1YP2A 3SXBA 2NXVA 3POLA 2ICYA 1H7EA 1H7LA 2AH9A 3V0NA 3E26A 1NMMB 1HM9A 5AJOA 2PGYA 5FU0A 1HJLA 1VPAA 2QKXA 1R80A 5DDVA 1WT0A 2XMEA 3JUKA 2OI6A 4HO5A 4Y63A 2YQHA 5C4CA 1SS9A 5FV9A 4MYBA 1FR9A 4EEGA 5CMJA 4Y6UA 4Q7CA 1ON6A 5BXCA 1VZUA 3D98A 3Q7UA 2YQJA 2W0WA 2Y7AA 2AM3A 2O1HA 1H5RB 3I0LA 5FTVA 2D7RA 2X65A 1OQMB 5FUHA 4L41C 4ECMA 2WAWA 1ZJPA 5CMIA 4HOCA 1HV9A 3I0IX 1OMXA 1ZIZA 3N9WA 2I5EA 2Y4JA 1JVGA 3I0CA 4G3PA 1GQCA 1G97A 2WVLA 2ICXA 1O7OA 5EJZA 2UX8A 3F1CA 2A8UA 3I0GA 1GX0A 2FFUA 3D8VA 3PKPA 1ZCVA 1MP4A 2FY7A 5FU8A 2PX7A 4P02A 3SX7A 1HM8A 4HO6A 1GX4A 4HO3A 2AGDA 2O1FA 3PNNA 5AJPA 2OI5A 5FTSA 1LL2A 1R7VA 1WT3A 4Y7GA 5L6SA 2RJ9A 5I1FA 3V0QA 1ZCYA 3V0MA 4Y9XA 3SXEA 1S4OA 2BO8A 3OH4A 3KIAA 1G9RA 3NGWA 2DPWA 1FZWA 3DUVA 3DK5A 2RITA 1H5SC 3USRA 4HO4A 3SXCA 4CJBA 1O23B 1W77A 2JCOA 4BQHA 2E3DA 2XMHA 3V8ZA 3I0HA 4IRPA 4MIXA 1EYRA 1W55A 4KNRA 5C47A 2WE9A 4Y62A 1H5TB 1JYLA 2FFVA 4XWIA 2QGIA 3ZGGA 4DECA 5DDTA 4EVWA 1H5RA 2Y4MA 2RJ4A 3V0OA 4J18A 3LW6A 1VM8A 3T7OA 1FWYA 1QGSA 2CU2A 1NKHB 2AM4A 2PGVA 4O6NA 1G23A 5CMGX 1JV3A 1LZIA 1VZXA 3I0EA 2I7BA 1LVWA 4AYJA 3ZF8A 1I52A 3CKQA 2YC3A 3SX8A
chains in the Genus database with same CATH topology
1NHEB 4NAIA 4EE3A 3TZTA 1OMZA 2YCMA 4FCEA 4GBPA 2VXLA 4Y6NA 1ZJ0A 2W0VA 1ON8A 4NANA 2GGOA 4D11A 1H3MA 1LZ0A 1LZ7A 2VS4A 2RJ8A 4FCUA 1JV1A 2X5ZA 4MNDA 4ASJA 4EEMA 5C4BA 5EJ1A 3U2XA 5AJNA 4M2AA 3CKVA 3I0FA 4FQWA 1G1LA 4D48A 1NQIB 4D0TA 4FRBA 1VICA 1H7HA 1ZI3A 4EEOA 1S4PA 2RJ0A 2Q4JA 2C0NA 2E8BA 2JCKA 2RJ6A 2VD4A 5D92A 3ZGFA 4B4BA 4FRLA 4EE4A 3OC9A 1R7TA 3V0PA 1H5TA 4EE5A 4ARWA 3U2UA 3U0XA 3CGXA 5D91A 3SPTA 1LL3A 1GQ9A 1G93A 4LW6A 3CKJA 1FO9A 2A8WA 1H5SB 3D5NA 4KC4A 5CQOA 2P6WA 1IIMA 1H5SD 2O1GA 3HL3A 1LZJA 1O7QA 5CQLX 1GWWA 2I5KA 1LL0A 1IINA 1VH1A 3I0DA 3IOIA 5C48A 4B42A 1FRWA 1FOAA 3V91A 2VFZA 4FRMA 1G3LA 2RJ1A 4KQLA 1V84A 3OH3A 2XWNA 4B5BA 5C3BA 4EEAA 3I0KA 3R2WA 4KPXA 2J0AA 1YP3A 2ZU7A 5IDTA 3DJ4A 2FYDB 3OKRA 2D0JA 5C4DA 2ZU8A 1PZYB 5C3AA 1S4NA 3EE5A 1K4VA 4HO8A 4HG6A 4KC1A 3SXAA 4KNXA 3ST8A 1ZI4A 3SX5A 2APCA 1H7QA 1MC3A 2X5SA 3I0JA 3IOJA 3R3IA 3Q80A 3T7MA 4AC3A 4DE7A 5C8RA 2BO4A 2P73A 4C2SA 1QWJA 1ZCTA 1FXOA 2Z87A 3SXDA 3BRKX 5CMHA 1ZI5A 2RIYA 3GUEA 1O0RA 5C36A 1R7XA 5IFYA 1VGUA 2ZU9A 5L6VA 1Z90A 5C1LA 2VK9A 4P00A 1E5KA 4Y7FA 1HJJA 2VS5A 3OH0A 5CMFX 5JQQA 3ZLKA 1MP5A 1ZJOA 2Y4LA 3V8YA 1FXJA 1ZJ2A 2JCLA 1VZTA 3U2TA 1INJA 3CKNA 2J0BA 3U0YA 4B4MA 4DDZA 2V0HA 3RMVA 5C3DA 4D0ZA 2FYBA 3BCVA 4FRAA 2YESA 1FG5N 1VGTA 1QGQA 1TW1A 3OH1A 4G87A 4FRPA 4JD0A 3OAMA 4FRHA 1H5SA 2AE7A 1NWGB 1EZIA 1GWVA 1KWSA 4HO9A 2OI7A 1PZTA 1R81A 3SXGA 4FREA 2PA4A 1R7YA 5C49A 4CJCA 2OEFA 1YP4A 4NALA 1MP3A 1XZ6A 2RIZA 5C38A 4UEGA 2GGQA 3TQDA 1H4DA 1HM0A 2XWMA 2WVMA 4HCQA 5C4EA 3USQA 1WT1A 1FGXA 2JCJA 5EIYA 1YROB 1WT2A 2V0LA 2MZBA 1WSZA 1WVCA 1FGGA 2Z86A 2RIXA 4Y7UA 4IRQA 4JISA 1R7UA 2VSHA 2BO6A 2XWLA 4E1KA 2Y4KA 4CJ8A 4ASYA 3RMWA 3U2VA 5CQNX 2RJ5A 2Y6PA 3FWWA 4KXOA 1NF5B 1G8OA 4R7PA 5C1HA 2VXMA 1VH3A 1TZFA 4M28A 2WGZA 4YS8A 1ZDFA 2AECA 3IOHA 5HS2A 3RSBA 4CVHA 1H4CA 3CKOA 3T7NA 4AYLA 2AM5A 3CU0A 1JYKA 5CQMX 3E25A 4FRQA 2FYCB 4FIXA 4K6RA 4KRVA 2WEEA 1V83A 4KPZA 2BO7A 4G3QA 3OH2A 1TW5A 1QG8A 1XHBA 2AESA 2YQCA 4Y7TA 1JVDA 2RJ7A 1G2VA 1FR8A 1ZJ1A 2V0KA 4BMAA 1H4EA 3FOQA 4M2BA 5FYEA 3SX3A 1H7TA 2FYAA 1VGWA 4B3UA 1V82A 1W57A 1ZJ3A 3V0LA 2WVKA 1H7FA 4Y7VA 2D7IA 3O3PA 1ZHJA 4ZDQA 2QH5A 4O6MA 1G95A 2X60A 4D11C 3PKQA 3QVBA 4LW3A 2V0IA 4FROA 3K8EA 2VS3A 1H7GA 4KT7A 3JUJA 3Q4SA 4B2WA 3U2WA 1INIA 4B2XA 4NAKA 4AAWA 2P72A 1GA8A 1G0RA 5CQPA 1ZCUA 1FO8A 3ZLLA 5IDSA 4FIYA 3V90A 1VGZA 2YC5A 3F1YA 2YQSA 5J49A 5C1GA 4FRDA 3OGZA 4B4GA 2V0JA 1R82A 4M4KA 2OEGA 3JTJA 4Y64A 1ZI1A 4HO0A 5C4FA 4KC2A 3K8DA 4G3SA 1ZDGA 4HO2A 1TVYA 2VSIA 1YP2A 3SXBA 2NXVA 3POLA 2ICYA 1H7EA 1H7LA 2AH9A 3V0NA 3E26A 1NMMB 1HM9A 5AJOA 2PGYA 5FU0A 1HJLA 1VPAA 2QKXA 1R80A 5DDVA 1WT0A 2XMEA 3JUKA 2OI6A 4HO5A 4Y63A 2YQHA 5C4CA 1SS9A 5FV9A 4MYBA 1FR9A 4EEGA 5CMJA 4Y6UA 4Q7CA 1ON6A 5BXCA 1VZUA 3D98A 3Q7UA 2YQJA 2W0WA 2Y7AA 2AM3A 2O1HA 1H5RB 3I0LA 5FTVA 2D7RA 2X65A 1OQMB 5FUHA 4L41C 4ECMA 2WAWA 1ZJPA 5CMIA 4HOCA 1HV9A 3I0IX 1OMXA 1ZIZA 3N9WA 2I5EA 2Y4JA 1JVGA 3I0CA 4G3PA 1GQCA 1G97A 2WVLA 2ICXA 1O7OA 5EJZA 2UX8A 3F1CA 2A8UA 3I0GA 1GX0A 2FFUA 3D8VA 3PKPA 1ZCVA 1MP4A 2FY7A 5FU8A 2PX7A 4P02A 3SX7A 1HM8A 4HO6A 1GX4A 4HO3A 2AGDA 2O1FA 3PNNA 5AJPA 2OI5A 5FTSA 1LL2A 1R7VA 1WT3A 4Y7GA 5L6SA 2RJ9A 5I1FA 3V0QA 1ZCYA 3V0MA 4Y9XA 3SXEA 1S4OA 2BO8A 3OH4A 3KIAA 1G9RA 3NGWA 2DPWA 1FZWA 3DUVA 3DK5A 2RITA 1H5SC 3USRA 4HO4A 3SXCA 4CJBA 1O23B 1W77A 2JCOA 4BQHA 2E3DA 2XMHA 3V8ZA 3I0HA 4IRPA 4MIXA 1EYRA 1W55A 4KNRA 5C47A 2WE9A 4Y62A 1H5TB 1JYLA 2FFVA 4XWIA 2QGIA 3ZGGA 4DECA 5DDTA 4EVWA 1H5RA 2Y4MA 2RJ4A 3V0OA 4J18A 3LW6A 1VM8A 3T7OA 1FWYA 1QGSA 2CU2A 1NKHB 2AM4A 2PGVA 4O6NA 1G23A 5CMGX 1JV3A 1LZIA 1VZXA 3I0EA 2I7BA 1LVWA 4AYJA 3ZF8A 1I52A 3CKQA 2YC3A 3SX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHE B;  4NAI A;  4EE3 A;  3TZT A;  1OMZ A;  2YCM A;  4FCE A;  4GBP A;  2VXL A;  4Y6N A;  1ZJ0 A;  2W0V A;  1ON8 A;  4NAN A;  2GGO A;  4D11 A;  1H3M A;  1LZ0 A;  1LZ7 A;  2VS4 A;  2RJ8 A;  4FCU A;  1JV1 A;  2X5Z A;  4MND A;  4ASJ A;  4EEM A;  5C4B A;  5EJ1 A;  3U2X A;  5AJN A;  4M2A A;  3CKV A;  3I0F A;  4FQW A;  1G1L A;  4D48 A;  1NQI B;  4D0T A;  4FRB A;  1VIC A;  1H7H A;  1ZI3 A;  4EEO A;  1S4P A;  2RJ0 A;  2Q4J A;  2E8B A;  2RJ6 A;  2JCK A;  2VD4 A;  3ZGF A;  4B4B A;  4FRL A;  4EE4 A;  3OC9 A;  1R7T A;  3V0P A;  1H5T A;  4EE5 A;  4ARW A;  3U2U A;  3U0X A;  3CGX A;  3SPT A;  1LL3 A;  1GQ9 A;  1G93 A;  4LW6 A;  3CKJ A;  1FO9 A;  2A8W A;  1H5S B;  3D5N A;  4KC4 A;  5CQO A;  2P6W A;  1IIM A;  1H5S D;  2O1G A;  3HL3 A;  1LZJ A;  1O7Q A;  5CQL X;  1GWW A;  2I5K A;  1LL0 A;  1IIN A;  1VH1 A;  3I0D A;  3IOI A;  5C48 A;  4B42 A;  1FRW A;  1FOA A;  3V91 A;  2VFZ A;  4FRM A;  1G3L A;  2RJ1 A;  4KQL A;  1V84 A;  3OH3 A;  2XWN A;  4B5B A;  5C3B A;  4EEA A;  3I0K A;  3R2W A;  4KPX A;  1YP3 A;  2ZU7 A;  5IDT A;  3DJ4 A;  2FYD B;  3OKR A;  2D0J A;  5C4D A;  2ZU8 A;  1PZY B;  5C3A A;  1S4N A;  3EE5 A;  1K4V A;  4HO8 A;  4HG6 A;  4KC1 A;  3SXA A;  4KNX A;  3ST8 A;  1ZI4 A;  3SX5 A;  2APC A;  1H7Q A;  1MC3 A;  2X5S A;  3I0J A;  3IOJ A;  3R3I A;  3Q80 A;  3T7M A;  4AC3 A;  4DE7 A;  5C8R A;  2BO4 A;  2P73 A;  4C2S A;  1QWJ A;  1ZCT A;  1FXO A;  2Z87 A;  3SXD A;  3BRK X;  5CMH A;  1ZI5 A;  2RIY A;  3GUE A;  1O0R A;  5C36 A;  1R7X A;  5IFY A;  1VGU A;  2ZU9 A;  5L6V A;  1Z90 A;  5C1L A;  4P00 A;  1E5K A;  4Y7F A;  1HJJ A;  2VS5 A;  3OH0 A;  5CMF X;  5JQQ A;  3ZLK A;  1MP5 A;  1ZJO A;  2Y4L A;  3V8Y A;  1FXJ A;  1ZJ2 A;  2JCL A;  1VZT A;  3U2T A;  1INJ A;  3CKN A;  3U0Y A;  4B4M A;  4DDZ A;  2V0H A;  3RMV A;  5C3D A;  4D0Z A;  2FYB A;  3BCV A;  4FRA A;  2YES A;  1FG5 N;  1VGT A;  1QGQ A;  1TW1 A;  3OH1 A;  4G87 A;  4FRP A;  4JD0 A;  3OAM A;  4FRH A;  1H5S A;  2AE7 A;  1NWG B;  1EZI A;  1GWV A;  1KWS A;  4HO9 A;  2OI7 A;  1PZT A;  1R81 A;  3SXG A;  4FRE A;  2PA4 A;  1R7Y A;  5C49 A;  4CJC A;  2OEF A;  1YP4 A;  4NAL A;  1MP3 A;  1XZ6 A;  2RIZ A;  5C38 A;  4UEG A;  2GGQ A;  3TQD A;  1H4D A;  1HM0 A;  2XWM A;  2WVM A;  4HCQ A;  5C4E A;  3USQ A;  1WT1 A;  1FGX A;  2JCJ A;  5EIY A;  1YRO B;  1WT2 A;  2V0L A;  2MZB A;  1WSZ A;  1WVC A;  1FGG A;  2Z86 A;  2RIX A;  4Y7U A;  4IRQ A;  4JIS A;  1R7U A;  2VSH A;  2BO6 A;  2XWL A;  4E1K A;  2Y4K A;  4CJ8 A;  4ASY A;  3RMW A;  3U2V A;  5CQN X;  2RJ5 A;  2Y6P A;  3FWW A;  4KXO A;  1NF5 B;  1G8O A;  4R7P A;  5C1H A;  2VXM A;  1VH3 A;  1TZF A;  4M28 A;  2WGZ A;  4YS8 A;  1ZDF A;  2AEC A;  3IOH A;  5HS2 A;  3RSB A;  4CVH A;  1H4C A;  3CKO A;  3T7N A;  4AYL A;  2AM5 A;  3CU0 A;  1JYK A;  5CQM X;  3E25 A;  4FRQ A;  2FYC B;  4K6R A;  4KRV A;  2WEE A;  1V83 A;  4KPZ A;  2BO7 A;  4G3Q A;  3OH2 A;  1TW5 A;  1QG8 A;  1XHB A;  2AES A;  2YQC A;  4Y7T A;  1JVD A;  2RJ7 A;  1G2V A;  1FR8 A;  1ZJ1 A;  2V0K A;  4BMA A;  1H4E A;  3FOQ A;  4M2B A;  5FYE A;  3SX3 A;  1H7T A;  2FYA A;  1VGW A;  4B3U A;  1V82 A;  1W57 A;  1ZJ3 A;  3V0L A;  2WVK A;  1H7F A;  4Y7V A;  2D7I A;  3O3P A;  1ZHJ A;  4ZDQ A;  2QH5 A;  1G95 A;  2X60 A;  4D11 C;  3PKQ A;  3QVB A;  4LW3 A;  2V0I A;  4FRO A;  3K8E A;  2VS3 A;  1H7G A;  4KT7 A;  3JUJ A;  3Q4S A;  4B2W A;  3U2W A;  1INI A;  4B2X A;  4NAK A;  4AAW A;  2P72 A;  1GA8 A;  1G0R A;  5CQP A;  1ZCU A;  1FO8 A;  3ZLL A;  5IDS A;  3V90 A;  1VGZ A;  2YC5 A;  3F1Y A;  2YQS A;  5J49 A;  5C1G A;  4FRD A;  3OGZ A;  4B4G A;  2V0J A;  1R82 A;  4M4K A;  2OEG A;  3JTJ A;  4Y64 A;  1ZI1 A;  4HO0 A;  5C4F A;  4KC2 A;  3K8D A;  4G3S A;  1ZDG A;  4HO2 A;  1TVY A;  2VSI A;  1YP2 A;  3SXB A;  2NXV A;  3POL A;  2ICY A;  1H7E A;  1H7L A;  2AH9 A;  3V0N A;  3E26 A;  1NMM B;  1HM9 A;  5AJO A;  2PGY A;  5FU0 A;  1HJL A;  1VPA A;  2QKX A;  1R80 A;  5DDV A;  1WT0 A;  2XME A;  3JUK A;  2OI6 A;  4HO5 A;  4Y63 A;  2YQH A;  5C4C A;  1SS9 A;  5FV9 A;  4MYB A;  1FR9 A;  4EEG A;  5CMJ A;  4Y6U A;  1ON6 A;  5BXC A;  1VZU A;  3D98 A;  3Q7U A;  2YQJ A;  2W0W A;  2Y7A A;  2AM3 A;  2O1H A;  1H5R B;  3I0L A;  5FTV A;  2D7R A;  2X65 A;  1OQM B;  5FUH A;  4L41 C;  4ECM A;  2WAW A;  1ZJP A;  5CMI A;  4HOC A;  1HV9 A;  3I0I X;  1OMX A;  1ZIZ A;  3N9W A;  2I5E A;  2Y4J A;  1JVG A;  3I0C A;  4G3P A;  1GQC A;  1G97 A;  2WVL A;  2ICX A;  1O7O A;  5EJZ A;  2UX8 A;  3F1C A;  2A8U A;  3I0G A;  1GX0 A;  2FFU A;  3D8V A;  3PKP A;  1ZCV A;  1MP4 A;  2FY7 A;  5FU8 A;  2PX7 A;  4P02 A;  3SX7 A;  1HM8 A;  4HO6 A;  1GX4 A;  4HO3 A;  2AGD A;  2O1F A;  3PNN A;  5AJP A;  2OI5 A;  5FTS A;  1LL2 A;  1R7V A;  1WT3 A;  4Y7G A;  5L6S A;  2RJ9 A;  5I1F A;  3V0Q A;  1ZCY A;  3V0M A;  4Y9X A;  3SXE A;  1S4O A;  2BO8 A;  3OH4 A;  3KIA A;  1G9R A;  3NGW A;  2DPW A;  1FZW A;  3DUV A;  3DK5 A;  2RIT A;  1H5S C;  3USR A;  4HO4 A;  3SXC A;  4CJB A;  1O23 B;  1W77 A;  2JCO A;  4BQH A;  2E3D A;  2XMH A;  3V8Z A;  3I0H A;  4IRP A;  1EYR A;  1W55 A;  4KNR A;  5C47 A;  2WE9 A;  4Y62 A;  1H5T B;  1JYL A;  2FFV A;  4XWI A;  2QGI A;  3ZGG A;  4DEC A;  5DDT A;  4EVW A;  1H5R A;  2Y4M A;  2RJ4 A;  3V0O A;  4J18 A;  3LW6 A;  1VM8 A;  3T7O A;  1FWY A;  1QGS A;  2CU2 A;  1NKH B;  2AM4 A;  2PGV A;  1G23 A;  5CMG X;  1JV3 A;  1LZI A;  1VZX A;  3I0E A;  2I7B A;  1LVW A;  4AYJ A;  3ZF8 A;  1I52 A;  3CKQ A;  2YC3 A;  3SX8 A; 
#chains in the Genus database with same CATH topology
 1NHE B;  4NAI A;  4EE3 A;  3TZT A;  1OMZ A;  2YCM A;  4FCE A;  4GBP A;  2VXL A;  4Y6N A;  1ZJ0 A;  2W0V A;  1ON8 A;  4NAN A;  2GGO A;  4D11 A;  1H3M A;  1LZ0 A;  1LZ7 A;  2VS4 A;  2RJ8 A;  4FCU A;  1JV1 A;  2X5Z A;  4MND A;  4ASJ A;  4EEM A;  5C4B A;  5EJ1 A;  3U2X A;  5AJN A;  4M2A A;  3CKV A;  3I0F A;  4FQW A;  1G1L A;  4D48 A;  1NQI B;  4D0T A;  4FRB A;  1VIC A;  1H7H A;  1ZI3 A;  4EEO A;  1S4P A;  2RJ0 A;  2Q4J A;  2C0N A;  2E8B A;  2JCK A;  2RJ6 A;  2VD4 A;  5D92 A;  3ZGF A;  4B4B A;  4FRL A;  4EE4 A;  3OC9 A;  1R7T A;  3V0P A;  1H5T A;  4EE5 A;  4ARW A;  3U2U A;  3U0X A;  3CGX A;  5D91 A;  3SPT A;  1LL3 A;  1GQ9 A;  1G93 A;  4LW6 A;  3CKJ A;  1FO9 A;  2A8W A;  1H5S B;  3D5N A;  4KC4 A;  5CQO A;  2P6W A;  1IIM A;  1H5S D;  2O1G A;  3HL3 A;  1LZJ A;  1O7Q A;  5CQL X;  1GWW A;  2I5K A;  1LL0 A;  1IIN A;  1VH1 A;  3I0D A;  3IOI A;  5C48 A;  4B42 A;  1FRW A;  1FOA A;  3V91 A;  2VFZ A;  4FRM A;  1G3L A;  2RJ1 A;  4KQL A;  1V84 A;  3OH3 A;  2XWN A;  4B5B A;  5C3B A;  4EEA A;  3I0K A;  3R2W A;  4KPX A;  2J0A A;  1YP3 A;  2ZU7 A;  5IDT A;  3DJ4 A;  2FYD B;  3OKR A;  2D0J A;  5C4D A;  2ZU8 A;  1PZY B;  5C3A A;  1S4N A;  3EE5 A;  1K4V A;  4HO8 A;  4HG6 A;  4KC1 A;  3SXA A;  4KNX A;  3ST8 A;  1ZI4 A;  3SX5 A;  2APC A;  1H7Q A;  1MC3 A;  2X5S A;  3I0J A;  3IOJ A;  3R3I A;  3Q80 A;  3T7M A;  4AC3 A;  4DE7 A;  5C8R A;  2BO4 A;  2P73 A;  4C2S A;  1QWJ A;  1ZCT A;  1FXO A;  2Z87 A;  3SXD A;  3BRK X;  5CMH A;  1ZI5 A;  2RIY A;  3GUE A;  1O0R A;  5C36 A;  1R7X A;  5IFY A;  1VGU A;  2ZU9 A;  5L6V A;  1Z90 A;  5C1L A;  2VK9 A;  4P00 A;  1E5K A;  4Y7F A;  1HJJ A;  2VS5 A;  3OH0 A;  5CMF X;  5JQQ A;  3ZLK A;  1MP5 A;  1ZJO A;  2Y4L A;  3V8Y A;  1FXJ A;  1ZJ2 A;  2JCL A;  1VZT A;  3U2T A;  1INJ A;  3CKN A;  2J0B A;  3U0Y A;  4B4M A;  4DDZ A;  2V0H A;  3RMV A;  5C3D A;  4D0Z A;  2FYB A;  3BCV A;  4FRA A;  2YES A;  1FG5 N;  1VGT A;  1QGQ A;  1TW1 A;  3OH1 A;  4G87 A;  4FRP A;  4JD0 A;  3OAM A;  4FRH A;  1H5S A;  2AE7 A;  1NWG B;  1EZI A;  1GWV A;  1KWS A;  4HO9 A;  2OI7 A;  1PZT A;  1R81 A;  3SXG A;  4FRE A;  2PA4 A;  1R7Y A;  5C49 A;  4CJC A;  2OEF A;  1YP4 A;  4NAL A;  1MP3 A;  1XZ6 A;  2RIZ A;  5C38 A;  4UEG A;  2GGQ A;  3TQD A;  1H4D A;  1HM0 A;  2XWM A;  2WVM A;  4HCQ A;  5C4E A;  3USQ A;  1WT1 A;  1FGX A;  2JCJ A;  5EIY A;  1YRO B;  1WT2 A;  2V0L A;  2MZB A;  1WSZ A;  1WVC A;  1FGG A;  2Z86 A;  2RIX A;  4Y7U A;  4IRQ A;  4JIS A;  1R7U A;  2VSH A;  2BO6 A;  2XWL A;  4E1K A;  2Y4K A;  4CJ8 A;  4ASY A;  3RMW A;  3U2V A;  5CQN X;  2RJ5 A;  2Y6P A;  3FWW A;  4KXO A;  1NF5 B;  1G8O A;  4R7P A;  5C1H A;  2VXM A;  1VH3 A;  1TZF A;  4M28 A;  2WGZ A;  4YS8 A;  1ZDF A;  2AEC A;  3IOH A;  5HS2 A;  3RSB A;  4CVH A;  1H4C A;  3CKO A;  3T7N A;  4AYL A;  2AM5 A;  3CU0 A;  1JYK A;  5CQM X;  3E25 A;  4FRQ A;  2FYC B;  4FIX A;  4K6R A;  4KRV A;  2WEE A;  1V83 A;  4KPZ A;  2BO7 A;  4G3Q A;  3OH2 A;  1TW5 A;  1QG8 A;  1XHB A;  2AES A;  2YQC A;  4Y7T A;  1JVD A;  2RJ7 A;  1G2V A;  1FR8 A;  1ZJ1 A;  2V0K A;  4BMA A;  1H4E A;  3FOQ A;  4M2B A;  5FYE A;  3SX3 A;  1H7T A;  2FYA A;  1VGW A;  4B3U A;  1V82 A;  1W57 A;  1ZJ3 A;  3V0L A;  2WVK A;  1H7F A;  4Y7V A;  2D7I A;  3O3P A;  1ZHJ A;  4ZDQ A;  2QH5 A;  4O6M A;  1G95 A;  2X60 A;  4D11 C;  3PKQ A;  3QVB A;  4LW3 A;  2V0I A;  4FRO A;  3K8E A;  2VS3 A;  1H7G A;  4KT7 A;  3JUJ A;  3Q4S A;  4B2W A;  3U2W A;  1INI A;  4B2X A;  4NAK A;  4AAW A;  2P72 A;  1GA8 A;  1G0R A;  5CQP A;  1ZCU A;  1FO8 A;  3ZLL A;  5IDS A;  4FIY A;  3V90 A;  1VGZ A;  2YC5 A;  3F1Y A;  2YQS A;  5J49 A;  5C1G A;  4FRD A;  3OGZ A;  4B4G A;  2V0J A;  1R82 A;  4M4K A;  2OEG A;  3JTJ A;  4Y64 A;  1ZI1 A;  4HO0 A;  5C4F A;  4KC2 A;  3K8D A;  4G3S A;  1ZDG A;  4HO2 A;  1TVY A;  2VSI A;  1YP2 A;  3SXB A;  2NXV A;  3POL A;  2ICY A;  1H7E A;  1H7L A;  2AH9 A;  3V0N A;  3E26 A;  1NMM B;  1HM9 A;  5AJO A;  2PGY A;  5FU0 A;  1HJL A;  1VPA A;  2QKX A;  1R80 A;  5DDV A;  1WT0 A;  2XME A;  3JUK A;  2OI6 A;  4HO5 A;  4Y63 A;  2YQH A;  5C4C A;  1SS9 A;  5FV9 A;  4MYB A;  1FR9 A;  4EEG A;  5CMJ A;  4Y6U A;  4Q7C A;  1ON6 A;  5BXC A;  1VZU A;  3D98 A;  3Q7U A;  2YQJ A;  2W0W A;  2Y7A A;  2AM3 A;  2O1H A;  1H5R B;  3I0L A;  5FTV A;  2D7R A;  2X65 A;  1OQM B;  5FUH A;  4L41 C;  4ECM A;  2WAW A;  1ZJP A;  5CMI A;  4HOC A;  1HV9 A;  3I0I X;  1OMX A;  1ZIZ A;  3N9W A;  2I5E A;  2Y4J A;  1JVG A;  3I0C A;  4G3P A;  1GQC A;  1G97 A;  2WVL A;  2ICX A;  1O7O A;  5EJZ A;  2UX8 A;  3F1C A;  2A8U A;  3I0G A;  1GX0 A;  2FFU A;  3D8V A;  3PKP A;  1ZCV A;  1MP4 A;  2FY7 A;  5FU8 A;  2PX7 A;  4P02 A;  3SX7 A;  1HM8 A;  4HO6 A;  1GX4 A;  4HO3 A;  2AGD A;  2O1F A;  3PNN A;  5AJP A;  2OI5 A;  5FTS A;  1LL2 A;  1R7V A;  1WT3 A;  4Y7G A;  5L6S A;  2RJ9 A;  5I1F A;  3V0Q A;  1ZCY A;  3V0M A;  4Y9X A;  3SXE A;  1S4O A;  2BO8 A;  3OH4 A;  3KIA A;  1G9R A;  3NGW A;  2DPW A;  1FZW A;  3DUV A;  3DK5 A;  2RIT A;  1H5S C;  3USR A;  4HO4 A;  3SXC A;  4CJB A;  1O23 B;  1W77 A;  2JCO A;  4BQH A;  2E3D A;  2XMH A;  3V8Z A;  3I0H A;  4IRP A;  4MIX A;  1EYR A;  1W55 A;  4KNR A;  5C47 A;  2WE9 A;  4Y62 A;  1H5T B;  1JYL A;  2FFV A;  4XWI A;  2QGI A;  3ZGG A;  4DEC A;  5DDT A;  4EVW A;  1H5R A;  2Y4M A;  2RJ4 A;  3V0O A;  4J18 A;  3LW6 A;  1VM8 A;  3T7O A;  1FWY A;  1QGS A;  2CU2 A;  1NKH B;  2AM4 A;  2PGV A;  4O6N A;  1G23 A;  5CMG X;  1JV3 A;  1LZI A;  1VZX A;  3I0E A;  2I7B A;  1LVW A;  4AYJ A;  3ZF8 A;  1I52 A;  3CKQ A;  2YC3 A;  3SX8 A; 
#chains in the Genus database with same CATH homology
 1NHE B;  4NAI A;  4EE3 A;  3TZT A;  1OMZ A;  2YCM A;  4FCE A;  4GBP A;  2VXL A;  4Y6N A;  1ZJ0 A;  2W0V A;  1ON8 A;  4NAN A;  2GGO A;  4D11 A;  1H3M A;  1LZ0 A;  1LZ7 A;  2VS4 A;  2RJ8 A;  4FCU A;  1JV1 A;  2X5Z A;  4MND A;  4ASJ A;  4EEM A;  5C4B A;  5EJ1 A;  3U2X A;  5AJN A;  4M2A A;  3CKV A;  3I0F A;  4FQW A;  1G1L A;  4D48 A;  1NQI B;  4D0T A;  4FRB A;  1VIC A;  1H7H A;  1ZI3 A;  4EEO A;  1S4P A;  2RJ0 A;  2Q4J A;  2C0N A;  2E8B A;  2JCK A;  2RJ6 A;  2VD4 A;  5D92 A;  3ZGF A;  4B4B A;  4FRL A;  4EE4 A;  3OC9 A;  1R7T A;  3V0P A;  1H5T A;  4EE5 A;  4ARW A;  3U2U A;  3U0X A;  3CGX A;  5D91 A;  3SPT A;  1LL3 A;  1GQ9 A;  1G93 A;  4LW6 A;  3CKJ A;  1FO9 A;  2A8W A;  1H5S B;  3D5N A;  4KC4 A;  5CQO A;  2P6W A;  1IIM A;  1H5S D;  2O1G A;  3HL3 A;  1LZJ A;  1O7Q A;  5CQL X;  1GWW A;  2I5K A;  1LL0 A;  1IIN A;  1VH1 A;  3I0D A;  3IOI A;  5C48 A;  4B42 A;  1FRW A;  1FOA A;  3V91 A;  2VFZ A;  4FRM A;  1G3L A;  2RJ1 A;  4KQL A;  1V84 A;  3OH3 A;  2XWN A;  4B5B A;  5C3B A;  4EEA A;  3I0K A;  3R2W A;  4KPX A;  2J0A A;  1YP3 A;  2ZU7 A;  5IDT A;  3DJ4 A;  2FYD B;  3OKR A;  2D0J A;  5C4D A;  2ZU8 A;  1PZY B;  5C3A A;  1S4N A;  3EE5 A;  1K4V A;  4HO8 A;  4HG6 A;  4KC1 A;  3SXA A;  4KNX A;  3ST8 A;  1ZI4 A;  3SX5 A;  2APC A;  1H7Q A;  1MC3 A;  2X5S A;  3I0J A;  3IOJ A;  3R3I A;  3Q80 A;  3T7M A;  4AC3 A;  4DE7 A;  5C8R A;  2BO4 A;  2P73 A;  4C2S A;  1QWJ A;  1ZCT A;  1FXO A;  2Z87 A;  3SXD A;  3BRK X;  5CMH A;  1ZI5 A;  2RIY A;  3GUE A;  1O0R A;  5C36 A;  1R7X A;  5IFY A;  1VGU A;  2ZU9 A;  5L6V A;  1Z90 A;  5C1L A;  2VK9 A;  4P00 A;  1E5K A;  4Y7F A;  1HJJ A;  2VS5 A;  3OH0 A;  5CMF X;  5JQQ A;  3ZLK A;  1MP5 A;  1ZJO A;  2Y4L A;  3V8Y A;  1FXJ A;  1ZJ2 A;  2JCL A;  1VZT A;  3U2T A;  1INJ A;  3CKN A;  2J0B A;  3U0Y A;  4B4M A;  4DDZ A;  2V0H A;  3RMV A;  5C3D A;  4D0Z A;  2FYB A;  3BCV A;  4FRA A;  2YES A;  1FG5 N;  1VGT A;  1QGQ A;  1TW1 A;  3OH1 A;  4G87 A;  4FRP A;  4JD0 A;  3OAM A;  4FRH A;  1H5S A;  2AE7 A;  1NWG B;  1EZI A;  1GWV A;  1KWS A;  4HO9 A;  2OI7 A;  1PZT A;  1R81 A;  3SXG A;  4FRE A;  2PA4 A;  1R7Y A;  5C49 A;  4CJC A;  2OEF A;  1YP4 A;  4NAL A;  1MP3 A;  1XZ6 A;  2RIZ A;  5C38 A;  4UEG A;  2GGQ A;  3TQD A;  1H4D A;  1HM0 A;  2XWM A;  2WVM A;  4HCQ A;  5C4E A;  3USQ A;  1WT1 A;  1FGX A;  2JCJ A;  5EIY A;  1YRO B;  1WT2 A;  2V0L A;  2MZB A;  1WSZ A;  1WVC A;  1FGG A;  2Z86 A;  2RIX A;  4Y7U A;  4IRQ A;  4JIS A;  1R7U A;  2VSH A;  2BO6 A;  2XWL A;  4E1K A;  2Y4K A;  4CJ8 A;  4ASY A;  3RMW A;  3U2V A;  5CQN X;  2RJ5 A;  2Y6P A;  3FWW A;  4KXO A;  1NF5 B;  1G8O A;  4R7P A;  5C1H A;  2VXM A;  1VH3 A;  1TZF A;  4M28 A;  2WGZ A;  4YS8 A;  1ZDF A;  2AEC A;  3IOH A;  5HS2 A;  3RSB A;  4CVH A;  1H4C A;  3CKO A;  3T7N A;  4AYL A;  2AM5 A;  3CU0 A;  1JYK A;  5CQM X;  3E25 A;  4FRQ A;  2FYC B;  4FIX A;  4K6R A;  4KRV A;  2WEE A;  1V83 A;  4KPZ A;  2BO7 A;  4G3Q A;  3OH2 A;  1TW5 A;  1QG8 A;  1XHB A;  2AES A;  2YQC A;  4Y7T A;  1JVD A;  2RJ7 A;  1G2V A;  1FR8 A;  1ZJ1 A;  2V0K A;  4BMA A;  1H4E A;  3FOQ A;  4M2B A;  5FYE A;  3SX3 A;  1H7T A;  2FYA A;  1VGW A;  4B3U A;  1V82 A;  1W57 A;  1ZJ3 A;  3V0L A;  2WVK A;  1H7F A;  4Y7V A;  2D7I A;  3O3P A;  1ZHJ A;  4ZDQ A;  2QH5 A;  4O6M A;  1G95 A;  2X60 A;  4D11 C;  3PKQ A;  3QVB A;  4LW3 A;  2V0I A;  4FRO A;  3K8E A;  2VS3 A;  1H7G A;  4KT7 A;  3JUJ A;  3Q4S A;  4B2W A;  3U2W A;  1INI A;  4B2X A;  4NAK A;  4AAW A;  2P72 A;  1GA8 A;  1G0R A;  5CQP A;  1ZCU A;  1FO8 A;  3ZLL A;  5IDS A;  4FIY A;  3V90 A;  1VGZ A;  2YC5 A;  3F1Y A;  2YQS A;  5J49 A;  5C1G A;  4FRD A;  3OGZ A;  4B4G A;  2V0J A;  1R82 A;  4M4K A;  2OEG A;  3JTJ A;  4Y64 A;  1ZI1 A;  4HO0 A;  5C4F A;  4KC2 A;  3K8D A;  4G3S A;  1ZDG A;  4HO2 A;  1TVY A;  2VSI A;  1YP2 A;  3SXB A;  2NXV A;  3POL A;  2ICY A;  1H7E A;  1H7L A;  2AH9 A;  3V0N A;  3E26 A;  1NMM B;  1HM9 A;  5AJO A;  2PGY A;  5FU0 A;  1HJL A;  1VPA A;  2QKX A;  1R80 A;  5DDV A;  1WT0 A;  2XME A;  3JUK A;  2OI6 A;  4HO5 A;  4Y63 A;  2YQH A;  5C4C A;  1SS9 A;  5FV9 A;  4MYB A;  1FR9 A;  4EEG A;  5CMJ A;  4Y6U A;  4Q7C A;  1ON6 A;  5BXC A;  1VZU A;  3D98 A;  3Q7U A;  2YQJ A;  2W0W A;  2Y7A A;  2AM3 A;  2O1H A;  1H5R B;  3I0L A;  5FTV A;  2D7R A;  2X65 A;  1OQM B;  5FUH A;  4L41 C;  4ECM A;  2WAW A;  1ZJP A;  5CMI A;  4HOC A;  1HV9 A;  3I0I X;  1OMX A;  1ZIZ A;  3N9W A;  2I5E A;  2Y4J A;  1JVG A;  3I0C A;  4G3P A;  1GQC A;  1G97 A;  2WVL A;  2ICX A;  1O7O A;  5EJZ A;  2UX8 A;  3F1C A;  2A8U A;  3I0G A;  1GX0 A;  2FFU A;  3D8V A;  3PKP A;  1ZCV A;  1MP4 A;  2FY7 A;  5FU8 A;  2PX7 A;  4P02 A;  3SX7 A;  1HM8 A;  4HO6 A;  1GX4 A;  4HO3 A;  2AGD A;  2O1F A;  3PNN A;  5AJP A;  2OI5 A;  5FTS A;  1LL2 A;  1R7V A;  1WT3 A;  4Y7G A;  5L6S A;  2RJ9 A;  5I1F A;  3V0Q A;  1ZCY A;  3V0M A;  4Y9X A;  3SXE A;  1S4O A;  2BO8 A;  3OH4 A;  3KIA A;  1G9R A;  3NGW A;  2DPW A;  1FZW A;  3DUV A;  3DK5 A;  2RIT A;  1H5S C;  3USR A;  4HO4 A;  3SXC A;  4CJB A;  1O23 B;  1W77 A;  2JCO A;  4BQH A;  2E3D A;  2XMH A;  3V8Z A;  3I0H A;  4IRP A;  4MIX A;  1EYR A;  1W55 A;  4KNR A;  5C47 A;  2WE9 A;  4Y62 A;  1H5T B;  1JYL A;  2FFV A;  4XWI A;  2QGI A;  3ZGG A;  4DEC A;  5DDT A;  4EVW A;  1H5R A;  2Y4M A;  2RJ4 A;  3V0O A;  4J18 A;  3LW6 A;  1VM8 A;  3T7O A;  1FWY A;  1QGS A;  2CU2 A;  1NKH B;  2AM4 A;  2PGV A;  4O6N A;  1G23 A;  5CMG X;  1JV3 A;  1LZI A;  1VZX A;  3I0E A;  2I7B A;  1LVW A;  4AYJ A;  3ZF8 A;  1I52 A;  3CKQ A;  2YC3 A;  3SX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...