4CJ8A

Monoclinic crystal form of bogt6a e192q in complex with udp-galnac, udp and galnac
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
238
structure length
238
Chain Sequence
SHMRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products
pubmed doi rcsb
source organism Bacteroides ovatus
molecule tags Transferase
total genus 62
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cj8A00
2VSIA 1MP4A 2Z87A 1ZJOA 4KPXA 4EE5A 3SXDA 3U0YA 2JCOA 2A8UA 3DJ4A 1JV1A 2GGOA 1GA8A 3HL3A 4CVHA 2RJ8A 2OI6A 1I52A 5C3BA 1VZTA 1H7FA 2Y6PA 3ZF8A 2V0IA 2NXVA 3RMWA 1H4EA 1G93A 1H7QA 1O7OA 3PKPA 2WVLA 2I5EA 2CU2A 5C38A 3U2VA 1GQ9A 1QGSA 1OMXA 4B4GA 4KC4A 3I0KA 2FYAA 4HCQA 4MYBA 1FOAA 2OI7A 1YP3A 4KQLA 1YP4A 2QKXA 5IFYA 1VZUA 1VPAA 3SX3A 3SXBA 1LZ7A 1H4DA 1ZCYA 1VGTA 1V83A 1VGWA 4M2AA 4Y9XA 2YCMA 3U2UA 3NGWA 1H5SB 4FROA 1S4OA 4AYJA 5FV9A 2YC3A 1W57A 1H5SD 2P72A 4Y64A 2YQSA 4Y6UA 1JYLA 5CMGX 3OH0A 1HM9A 4FCUA 2XMEA 2QGIA 2PA4A 3I0HA 4NANA 2RITA 3V8YA 5C1LA 1R80A 3V0PA 3DUVA 2AE7A 2AECA 5C4DA 4AYLA 2YC5A 5C47A 2V0LA 3OGZA 2O1HA 2Y4MA 2ZU8A 2FYCB 4P00A 4DE7A 3CU0A 2WVMA 4Y7TA 1ZI1A 3KIAA 2V0HA 3ZLKA 1NWGB 3SXEA 2FY7A 3OH4A 3K8DA 4LW3A 1VGZA 5AJPA 4LW6A 1H7GA 1R82A 3BCVA 3V0LA 5C8RA 1GWWA 4E1KA 3SPTA 1R7UA 3USQA 1LVWA 3QVBA 4G3SA 1TZFA 4FRPA 5EJ1A 3RMVA 4UEGA 2D7RA 1MC3A 4FREA 3I0GA 5DDVA 4CJBA 2ICXA 3T7NA 2P73A 1MP5A 1LL0A 4FQWA 1LZJA 4G87A 1FZWA 3ZGGA 1JVGA 5I1FA 3V90A 2FFVA 2I5KA 3U2XA 2AM5A 1IIMA 1YP2A 4DECA 2AM3A 5CMFX 1TW1A 5IDSA 2VS3A 3T7OA 2VD4A 1W77A 4FRDA 3Q7UA 5FU8A 4AC3A 4FRAA 1H5TB 1ZCTA 4D48A 3USRA 3I0IX 5CMHA 5C4FA 1LL2A 4JD0A 3U0XA 4M4KA 2QH5A 5CMIA 4D11C 2RJ7A 5CQOA 5HS2A 4M28A 1FR8A 5CQMX 4DDZA 4ECMA 2JCJA 2BO7A 2WE9A 4R7PA 4FCEA 1MP3A 1NKHB 1INIA 1NQIB 1ZJ1A 2D0JA 2UX8A 3ZGFA 3JTJA 2VS5A 2XWMA 1FGGA 4FRHA 3CKVA 4XWIA 1VH3A 1QWJA 2WGZA 1ON8A 2PX7A 4Y7VA 5CQLX 3Q4SA 2JCKA 3F1YA 4C2SA 1GX0A 4ASYA 1H5TA 1H7LA 4Y7FA 1FRWA 3I0CA 1FXOA 4L41C 1XHBA 1OQMB 1GQCA 5CQPA 4ARWA 2BO6A 1YROB 4HO6A 1FR9A 4G3PA 4HO0A 4HO8A 1R7TA 3SXCA 1G95A 1ZHJA 4Y7GA 1JV3A 4EEMA 2MZBA 1G97A 2VS4A 1ZDFA 1JYKA 4HOCA 3OH1A 4MNDA 5C3AA 4BQHA 1LZIA 1ZJ2A 2OEFA 1LZ0A 4Y7UA 1O23B 3CGXA 4KC2A 1K4VA 3CKNA 2X5SA 1E5KA 2AESA 2RJ9A 1OMZA 3V8ZA 1QG8A 1WT2A 3PKQA 1VZXA 1IINA 2RJ0A 2Y4KA 3V0NA 4FRQA 2A8WA 1JVDA 1H3MA 4B4MA 2V0JA 1ZI4A 4B2WA 4HO9A 4KPZA 2AH9A 1H5SA 3TZTA 4D0ZA 3V0OA 3E26A 4EEGA 2RJ5A 1H7HA 2OEGA 3V91A 2PGVA 2Y4LA 2AGDA 3E25A 1S4NA 2JCLA 1EZIA 1O7QA 4YS8A 1ZIZA 1G2VA 2ZU7A 3SXGA 2E8BA 2APCA 4FRBA 3ST8A 2FYDB 3I0LA 1G3LA 1ZI5A 4EVWA 2RIZA 2Y4JA 5L6VA 4NAIA 2V0KA 2XMHA 2O1FA 1WT1A 3OC9A 2YQHA 1G8OA 1ON6A 2W0VA 5FUHA 2ZU9A 3DK5A 5C1HA 2X65A 3V0QA 1VM8A 1HM0A 4BMAA 2XWNA 3CKOA 1ZCUA 1FG5N 4KNRA 3F1CA 3OH2A 3I0EA 1ZJPA 3SX8A 4EE3A 4FRMA 5C1GA 2VFZA 3RSBA 1WVCA 3D98A 5FTVA 3IOHA 3PNNA 2OI5A 2WEEA 2Z86A 3POLA 4CJ8A 1NHEB 2W0WA 3SXAA 4B4BA 1TW5A 2FYBA 2E3DA 2Y7AA 4J18A 4HO2A 1H7EA 2VSHA 1GWVA 2WVKA 3V0MA 5IDTA 4KT7A 1HJLA 1ZDGA 1V82A 1NF5B 1G1LA 1V84A 2RJ4A 2RIYA 1FWYA 2WAWA 4NALA 4KXOA 4GBPA 2YQJA 4B5BA 1GX4A 1PZYB 1Z90A 3OAMA 1KWSA 2DPWA 3SX5A 5C4EA 3I0JA 3JUKA 4HG6A 4KRVA 4JISA 3TQDA 1R7VA 1TVYA 5CQNX 1S4PA 3O3PA 4Y63A 5FU0A 5C3DA 1H4CA 3CKQA 3I0FA 5J49A 2BO8A 3IOIA 4EEOA 1H5RB 3K8EA 4NAKA 2AM4A 5C4BA 5FTSA 1WT0A 3R3IA 1FGXA 3FWWA 3SX7A 3I0DA 1G23A 1ZI3A 1R7XA 5AJNA 1QGQA 5DDTA 4Y6NA 1FO8A 5C49A 1H7TA 1SS9A 1G0RA 1VICA 1ZJ3A 4IRQA 4FRLA 3T7MA 4ASJA 1R81A 2O1GA 3IOJA 4D0TA 3U2WA 2P6WA 3FOQA 1PZTA 1HM8A 3R2WA 1H5RA 5C4CA 3D5NA 1R7YA 3LW6A 4D11A 4K6RA 1HV9A 4G3QA 1VH1A 2VXMA 3Q80A 4ZDQA 3EE5A 1ZJ0A 5L6SA 2VXLA 5BXCA 2ICYA 4HO3A 2GGQA 3OH3A 4HO5A 4M2BA 4P02A 3BRKX 2RIXA 2FFUA 2XWLA 1HJJA 3N9WA 1LL3A 3OKRA 1VGUA 3U2TA 4EEAA 4AAWA 2BO4A 4B42A 3GUEA 2I7BA 2Q4JA 1INJA 4Y62A 5JQQA 4HO4A 2YESA 1O0RA 1WT3A 3ZLLA 2RJ1A 2RJ6A 2PGYA 4CJCA 1FO9A 4B3UA 5EIYA 5C48A 4IRPA 5AJOA 5C36A 1XZ6A 4KC1A 2D7IA 4EE4A 1G9RA 1WSZA 5FYEA 1W55A 1H5SC 4B2XA 1EYRA 1NMMB 4KNXA 2X60A 1ZCVA 2X5ZA 3JUJA 5EJZA 5CMJA 1FXJA 3CKJA 3D8VA 2YQCA
chains in the Genus database with same CATH superfamily
2VSIA 1MP4A 2Z87A 1ZJOA 4KPXA 4EE5A 3SXDA 3U0YA 2JCOA 2A8UA 3DJ4A 1JV1A 2GGOA 1GA8A 3HL3A 4CVHA 2RJ8A 2OI6A 1I52A 5C3BA 1VZTA 1H7FA 2Y6PA 3ZF8A 2V0IA 2NXVA 3RMWA 1H4EA 1G93A 1H7QA 1O7OA 3PKPA 2WVLA 2I5EA 2CU2A 5D92A 5C38A 3U2VA 1GQ9A 1QGSA 1OMXA 4B4GA 4KC4A 3I0KA 2FYAA 4HCQA 4MYBA 1FOAA 2OI7A 1YP3A 4KQLA 1YP4A 2QKXA 5IFYA 1VZUA 1VPAA 3SX3A 3SXBA 1LZ7A 1H4DA 1ZCYA 1VGTA 2VK9A 1V83A 1VGWA 4M2AA 4Y9XA 2YCMA 3U2UA 3NGWA 1H5SB 4FROA 1S4OA 4AYJA 5FV9A 2YC3A 1W57A 1H5SD 2P72A 4Y64A 2YQSA 4Y6UA 1JYLA 5CMGX 3OH0A 1HM9A 4FCUA 2XMEA 2QGIA 2PA4A 3I0HA 4NANA 2RITA 3V8YA 5C1LA 1R80A 3V0PA 3DUVA 2AE7A 2AECA 5C4DA 4AYLA 2YC5A 5C47A 2V0LA 3OGZA 2O1HA 2Y4MA 2ZU8A 2FYCB 4P00A 4DE7A 3CU0A 2WVMA 4Y7TA 1ZI1A 4FIYA 3KIAA 2V0HA 3ZLKA 1NWGB 3SXEA 2FY7A 3OH4A 3K8DA 4LW3A 1VGZA 5AJPA 4LW6A 1H7GA 1R82A 3BCVA 3V0LA 5C8RA 1GWWA 5D91A 4E1KA 3SPTA 1R7UA 3USQA 1LVWA 3QVBA 4G3SA 1TZFA 4FRPA 5EJ1A 3RMVA 4UEGA 2D7RA 1MC3A 4FREA 3I0GA 5DDVA 4CJBA 2ICXA 3T7NA 2P73A 1MP5A 1LL0A 4FQWA 1LZJA 4G87A 1FZWA 3ZGGA 1JVGA 5I1FA 3V90A 2FFVA 2I5KA 3U2XA 2AM5A 1IIMA 1YP2A 4DECA 2AM3A 5CMFX 1TW1A 5IDSA 2VS3A 3T7OA 2VD4A 1W77A 4FRDA 3Q7UA 5FU8A 4AC3A 4FRAA 1H5TB 1ZCTA 4D48A 3USRA 3I0IX 5CMHA 5C4FA 1LL2A 4JD0A 3U0XA 4M4KA 2QH5A 5CMIA 4D11C 2RJ7A 5CQOA 5HS2A 4M28A 1FR8A 5CQMX 4DDZA 4ECMA 2JCJA 2BO7A 2WE9A 4R7PA 4FCEA 1MP3A 1NKHB 1INIA 1NQIB 1ZJ1A 2D0JA 2UX8A 3ZGFA 3JTJA 2VS5A 2XWMA 1FGGA 4FRHA 3CKVA 4XWIA 1VH3A 2J0AA 1QWJA 2WGZA 1ON8A 2PX7A 4Y7VA 5CQLX 3Q4SA 2JCKA 3F1YA 4C2SA 1GX0A 4ASYA 1H5TA 1H7LA 4Y7FA 1FRWA 3I0CA 1FXOA 4L41C 1XHBA 1OQMB 1GQCA 5CQPA 4ARWA 2BO6A 1YROB 4HO6A 1FR9A 4G3PA 4HO0A 4HO8A 1R7TA 3SXCA 1G95A 1ZHJA 4Y7GA 1JV3A 4EEMA 2MZBA 1G97A 2VS4A 1ZDFA 1JYKA 4HOCA 3OH1A 4MNDA 5C3AA 4BQHA 1LZIA 2C0NA 1ZJ2A 2OEFA 1LZ0A 4O6NA 4Y7UA 1O23B 3CGXA 4KC2A 1K4VA 3CKNA 2X5SA 1E5KA 2J0BA 2AESA 2RJ9A 1OMZA 3V8ZA 1QG8A 1WT2A 3PKQA 1VZXA 1IINA 2RJ0A 2Y4KA 3V0NA 4FRQA 2A8WA 1JVDA 1H3MA 4B4MA 2V0JA 1ZI4A 4B2WA 4HO9A 4KPZA 2AH9A 1H5SA 3TZTA 4D0ZA 3V0OA 3E26A 4EEGA 2RJ5A 1H7HA 2OEGA 3V91A 2PGVA 2Y4LA 2AGDA 3E25A 1S4NA 2JCLA 1EZIA 1O7QA 4YS8A 1ZIZA 1G2VA 2ZU7A 3SXGA 2E8BA 2APCA 4FRBA 3ST8A 2FYDB 3I0LA 1G3LA 1ZI5A 4EVWA 2RIZA 2Y4JA 4FIXA 5L6VA 4NAIA 2V0KA 2XMHA 2O1FA 1WT1A 3OC9A 2YQHA 1G8OA 1ON6A 2W0VA 5FUHA 2ZU9A 3DK5A 5C1HA 2X65A 3V0QA 1VM8A 1HM0A 4BMAA 2XWNA 3CKOA 1ZCUA 1FG5N 4KNRA 3F1CA 3OH2A 4O6MA 3I0EA 1ZJPA 3SX8A 4EE3A 4FRMA 5C1GA 2VFZA 3RSBA 1WVCA 3D98A 5FTVA 3IOHA 3PNNA 2OI5A 2WEEA 2Z86A 3POLA 4CJ8A 1NHEB 2W0WA 3SXAA 4B4BA 1TW5A 2FYBA 2E3DA 2Y7AA 4J18A 4HO2A 1H7EA 2VSHA 1GWVA 2WVKA 3V0MA 5IDTA 4KT7A 1HJLA 1ZDGA 1V82A 1NF5B 1G1LA 1V84A 2RJ4A 2RIYA 1FWYA 2WAWA 4NALA 4KXOA 4GBPA 2YQJA 4B5BA 1GX4A 1PZYB 1Z90A 3OAMA 1KWSA 2DPWA 3SX5A 5C4EA 3I0JA 3JUKA 4HG6A 4KRVA 4JISA 3TQDA 1R7VA 1TVYA 5CQNX 1S4PA 3O3PA 4Y63A 5FU0A 5C3DA 1H4CA 3CKQA 3I0FA 5J49A 2BO8A 3IOIA 4EEOA 1H5RB 3K8EA 4NAKA 2AM4A 5C4BA 5FTSA 1WT0A 3R3IA 1FGXA 3FWWA 3SX7A 3I0DA 1G23A 1ZI3A 1R7XA 5AJNA 1QGQA 5DDTA 4Y6NA 1FO8A 5C49A 1H7TA 1SS9A 1G0RA 1VICA 1ZJ3A 4IRQA 4FRLA 3T7MA 4ASJA 1R81A 2O1GA 3IOJA 4D0TA 3U2WA 2P6WA 3FOQA 1PZTA 1HM8A 3R2WA 1H5RA 5C4CA 3D5NA 1R7YA 3LW6A 4D11A 4K6RA 1HV9A 4G3QA 1VH1A 2VXMA 3Q80A 4ZDQA 3EE5A 1ZJ0A 4Q7CA 5L6SA 2VXLA 5BXCA 2ICYA 4HO3A 2GGQA 3OH3A 4HO5A 4M2BA 4P02A 3BRKX 2RIXA 2FFUA 2XWLA 1HJJA 3N9WA 1LL3A 3OKRA 1VGUA 3U2TA 4EEAA 4AAWA 2BO4A 4B42A 3GUEA 2I7BA 2Q4JA 1INJA 4Y62A 5JQQA 4HO4A 2YESA 1O0RA 1WT3A 3ZLLA 2RJ1A 2RJ6A 2PGYA 4CJCA 1FO9A 4B3UA 5EIYA 5C48A 4IRPA 5AJOA 5C36A 1XZ6A 4KC1A 2D7IA 4EE4A 1G9RA 1WSZA 5FYEA 1W55A 1H5SC 4B2XA 1EYRA 1NMMB 4KNXA 2X60A 1ZCVA 2X5ZA 3JUJA 5EJZA 5CMJA 1FXJA 4MIXA 3CKJA 3D8VA 2YQCA
chains in the Genus database with same CATH topology
2VSIA 1MP4A 2Z87A 1ZJOA 4KPXA 4EE5A 3SXDA 3U0YA 2JCOA 2A8UA 3DJ4A 1JV1A 2GGOA 1GA8A 3HL3A 4CVHA 2RJ8A 2OI6A 1I52A 5C3BA 1VZTA 1H7FA 2Y6PA 3ZF8A 2V0IA 2NXVA 3RMWA 1H4EA 1G93A 1H7QA 1O7OA 3PKPA 2WVLA 2I5EA 2CU2A 5D92A 5C38A 3U2VA 1GQ9A 1QGSA 1OMXA 4B4GA 4KC4A 3I0KA 2FYAA 4HCQA 4MYBA 1FOAA 2OI7A 1YP3A 4KQLA 1YP4A 2QKXA 5IFYA 1VZUA 1VPAA 3SX3A 3SXBA 1LZ7A 1H4DA 1ZCYA 1VGTA 2VK9A 1V83A 1VGWA 4M2AA 4Y9XA 2YCMA 3U2UA 3NGWA 1H5SB 4FROA 1S4OA 4AYJA 5FV9A 2YC3A 1W57A 1H5SD 2P72A 4Y64A 2YQSA 4Y6UA 1JYLA 5CMGX 3OH0A 1HM9A 4FCUA 2XMEA 2QGIA 2PA4A 3I0HA 4NANA 2RITA 3V8YA 5C1LA 1R80A 3V0PA 3DUVA 2AE7A 2AECA 5C4DA 4AYLA 2YC5A 5C47A 2V0LA 3OGZA 2O1HA 2Y4MA 2ZU8A 2FYCB 4P00A 4DE7A 3CU0A 2WVMA 4Y7TA 1ZI1A 4FIYA 3KIAA 2V0HA 3ZLKA 1NWGB 3SXEA 2FY7A 3OH4A 3K8DA 4LW3A 1VGZA 5AJPA 4LW6A 1H7GA 1R82A 3BCVA 3V0LA 5C8RA 1GWWA 5D91A 4E1KA 3SPTA 1R7UA 3USQA 1LVWA 3QVBA 4G3SA 1TZFA 4FRPA 5EJ1A 3RMVA 4UEGA 2D7RA 1MC3A 4FREA 3I0GA 5DDVA 4CJBA 2ICXA 3T7NA 2P73A 1MP5A 1LL0A 4FQWA 1LZJA 4G87A 1FZWA 3ZGGA 1JVGA 5I1FA 3V90A 2FFVA 2I5KA 3U2XA 2AM5A 1IIMA 1YP2A 4DECA 2AM3A 5CMFX 1TW1A 5IDSA 2VS3A 3T7OA 2VD4A 1W77A 4FRDA 3Q7UA 5FU8A 4AC3A 4FRAA 1H5TB 1ZCTA 4D48A 3USRA 3I0IX 5CMHA 5C4FA 1LL2A 4JD0A 3U0XA 4M4KA 2QH5A 5CMIA 4D11C 2RJ7A 5CQOA 5HS2A 4M28A 1FR8A 5CQMX 4DDZA 4ECMA 2JCJA 2BO7A 2WE9A 4R7PA 4FCEA 1MP3A 1NKHB 1INIA 1NQIB 1ZJ1A 2D0JA 2UX8A 3ZGFA 3JTJA 2VS5A 2XWMA 1FGGA 4FRHA 3CKVA 4XWIA 1VH3A 2J0AA 1QWJA 2WGZA 1ON8A 2PX7A 4Y7VA 5CQLX 3Q4SA 2JCKA 3F1YA 4C2SA 1GX0A 4ASYA 1H5TA 1H7LA 4Y7FA 1FRWA 3I0CA 1FXOA 4L41C 1XHBA 1OQMB 1GQCA 5CQPA 4ARWA 2BO6A 1YROB 4HO6A 1FR9A 4G3PA 4HO0A 4HO8A 1R7TA 3SXCA 1G95A 1ZHJA 4Y7GA 1JV3A 4EEMA 2MZBA 1G97A 2VS4A 1ZDFA 1JYKA 4HOCA 3OH1A 4MNDA 5C3AA 4BQHA 1LZIA 2C0NA 1ZJ2A 2OEFA 1LZ0A 4O6NA 4Y7UA 1O23B 3CGXA 4KC2A 1K4VA 3CKNA 2X5SA 1E5KA 2J0BA 2AESA 2RJ9A 1OMZA 3V8ZA 1QG8A 1WT2A 3PKQA 1VZXA 1IINA 2RJ0A 2Y4KA 3V0NA 4FRQA 2A8WA 1JVDA 1H3MA 4B4MA 2V0JA 1ZI4A 4B2WA 4HO9A 4KPZA 2AH9A 1H5SA 3TZTA 4D0ZA 3V0OA 3E26A 4EEGA 2RJ5A 1H7HA 2OEGA 3V91A 2PGVA 2Y4LA 2AGDA 3E25A 1S4NA 2JCLA 1EZIA 1O7QA 4YS8A 1ZIZA 1G2VA 2ZU7A 3SXGA 2E8BA 2APCA 4FRBA 3ST8A 2FYDB 3I0LA 1G3LA 1ZI5A 4EVWA 2RIZA 2Y4JA 4FIXA 5L6VA 4NAIA 2V0KA 2XMHA 2O1FA 1WT1A 3OC9A 2YQHA 1G8OA 1ON6A 2W0VA 5FUHA 2ZU9A 3DK5A 5C1HA 2X65A 3V0QA 1VM8A 1HM0A 4BMAA 2XWNA 3CKOA 1ZCUA 1FG5N 4KNRA 3F1CA 3OH2A 4O6MA 3I0EA 1ZJPA 3SX8A 4EE3A 4FRMA 5C1GA 2VFZA 3RSBA 1WVCA 3D98A 5FTVA 3IOHA 3PNNA 2OI5A 2WEEA 2Z86A 3POLA 4CJ8A 1NHEB 2W0WA 3SXAA 4B4BA 1TW5A 2FYBA 2E3DA 2Y7AA 4J18A 4HO2A 1H7EA 2VSHA 1GWVA 2WVKA 3V0MA 5IDTA 4KT7A 1HJLA 1ZDGA 1V82A 1NF5B 1G1LA 1V84A 2RJ4A 2RIYA 1FWYA 2WAWA 4NALA 4KXOA 4GBPA 2YQJA 4B5BA 1GX4A 1PZYB 1Z90A 3OAMA 1KWSA 2DPWA 3SX5A 5C4EA 3I0JA 3JUKA 4HG6A 4KRVA 4JISA 3TQDA 1R7VA 1TVYA 5CQNX 1S4PA 3O3PA 4Y63A 5FU0A 5C3DA 1H4CA 3CKQA 3I0FA 5J49A 2BO8A 3IOIA 4EEOA 1H5RB 3K8EA 4NAKA 2AM4A 5C4BA 5FTSA 1WT0A 3R3IA 1FGXA 3FWWA 3SX7A 3I0DA 1G23A 1ZI3A 1R7XA 5AJNA 1QGQA 5DDTA 4Y6NA 1FO8A 5C49A 1H7TA 1SS9A 1G0RA 1VICA 1ZJ3A 4IRQA 4FRLA 3T7MA 4ASJA 1R81A 2O1GA 3IOJA 4D0TA 3U2WA 2P6WA 3FOQA 1PZTA 1HM8A 3R2WA 1H5RA 5C4CA 3D5NA 1R7YA 3LW6A 4D11A 4K6RA 1HV9A 4G3QA 1VH1A 2VXMA 3Q80A 4ZDQA 3EE5A 1ZJ0A 4Q7CA 5L6SA 2VXLA 5BXCA 2ICYA 4HO3A 2GGQA 3OH3A 4HO5A 4M2BA 4P02A 3BRKX 2RIXA 2FFUA 2XWLA 1HJJA 3N9WA 1LL3A 3OKRA 1VGUA 3U2TA 4EEAA 4AAWA 2BO4A 4B42A 3GUEA 2I7BA 2Q4JA 1INJA 4Y62A 5JQQA 4HO4A 2YESA 1O0RA 1WT3A 3ZLLA 2RJ1A 2RJ6A 2PGYA 4CJCA 1FO9A 4B3UA 5EIYA 5C48A 4IRPA 5AJOA 5C36A 1XZ6A 4KC1A 2D7IA 4EE4A 1G9RA 1WSZA 5FYEA 1W55A 1H5SC 4B2XA 1EYRA 1NMMB 4KNXA 2X60A 1ZCVA 2X5ZA 3JUJA 5EJZA 5CMJA 1FXJA 4MIXA 3CKJA 3D8VA 2YQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSI A;  1MP4 A;  2Z87 A;  1ZJO A;  4KPX A;  4EE5 A;  3SXD A;  3U0Y A;  2JCO A;  2A8U A;  3DJ4 A;  1JV1 A;  2GGO A;  1GA8 A;  3HL3 A;  4CVH A;  2RJ8 A;  2OI6 A;  1I52 A;  5C3B A;  1VZT A;  1H7F A;  2Y6P A;  3ZF8 A;  2V0I A;  2NXV A;  3RMW A;  1H4E A;  1G93 A;  1H7Q A;  1O7O A;  3PKP A;  2WVL A;  2I5E A;  2CU2 A;  5C38 A;  3U2V A;  1GQ9 A;  1QGS A;  1OMX A;  4B4G A;  4KC4 A;  3I0K A;  2FYA A;  4HCQ A;  4MYB A;  1FOA A;  2OI7 A;  1YP3 A;  4KQL A;  1YP4 A;  2QKX A;  5IFY A;  1VZU A;  1VPA A;  3SX3 A;  3SXB A;  1LZ7 A;  1H4D A;  1ZCY A;  1VGT A;  1V83 A;  1VGW A;  4M2A A;  4Y9X A;  2YCM A;  3U2U A;  3NGW A;  1H5S B;  4FRO A;  1S4O A;  4AYJ A;  5FV9 A;  2YC3 A;  1W57 A;  1H5S D;  2P72 A;  4Y64 A;  2YQS A;  4Y6U A;  1JYL A;  5CMG X;  3OH0 A;  1HM9 A;  4FCU A;  2XME A;  2QGI A;  2PA4 A;  3I0H A;  4NAN A;  2RIT A;  3V8Y A;  5C1L A;  1R80 A;  3V0P A;  3DUV A;  2AE7 A;  2AEC A;  5C4D A;  4AYL A;  2YC5 A;  5C47 A;  2V0L A;  3OGZ A;  2O1H A;  2Y4M A;  2ZU8 A;  2FYC B;  4P00 A;  4DE7 A;  3CU0 A;  2WVM A;  4Y7T A;  1ZI1 A;  3KIA A;  2V0H A;  3ZLK A;  1NWG B;  3SXE A;  2FY7 A;  3OH4 A;  3K8D A;  4LW3 A;  1VGZ A;  5AJP A;  4LW6 A;  1H7G A;  1R82 A;  3BCV A;  3V0L A;  5C8R A;  1GWW A;  4E1K A;  3SPT A;  1R7U A;  3USQ A;  1LVW A;  3QVB A;  4G3S A;  1TZF A;  4FRP A;  5EJ1 A;  3RMV A;  4UEG A;  2D7R A;  1MC3 A;  4FRE A;  3I0G A;  5DDV A;  4CJB A;  2ICX A;  3T7N A;  2P73 A;  1MP5 A;  1LL0 A;  4FQW A;  1LZJ A;  4G87 A;  1FZW A;  3ZGG A;  1JVG A;  5I1F A;  3V90 A;  2FFV A;  2I5K A;  3U2X A;  2AM5 A;  1IIM A;  1YP2 A;  4DEC A;  2AM3 A;  5CMF X;  1TW1 A;  5IDS A;  2VS3 A;  3T7O A;  2VD4 A;  1W77 A;  4FRD A;  3Q7U A;  5FU8 A;  4AC3 A;  4FRA A;  1H5T B;  1ZCT A;  4D48 A;  3USR A;  3I0I X;  5CMH A;  5C4F A;  1LL2 A;  4JD0 A;  3U0X A;  4M4K A;  2QH5 A;  5CMI A;  4D11 C;  2RJ7 A;  5CQO A;  5HS2 A;  4M28 A;  1FR8 A;  5CQM X;  4DDZ A;  4ECM A;  2JCJ A;  2BO7 A;  2WE9 A;  4R7P A;  4FCE A;  1MP3 A;  1NKH B;  1INI A;  1NQI B;  1ZJ1 A;  2D0J A;  2UX8 A;  3ZGF A;  3JTJ A;  2VS5 A;  2XWM A;  1FGG A;  4FRH A;  3CKV A;  4XWI A;  1VH3 A;  1QWJ A;  2WGZ A;  1ON8 A;  2PX7 A;  4Y7V A;  5CQL X;  3Q4S A;  2JCK A;  3F1Y A;  4C2S A;  1GX0 A;  4ASY A;  1H5T A;  1H7L A;  4Y7F A;  1FRW A;  3I0C A;  1FXO A;  4L41 C;  1XHB A;  1OQM B;  1GQC A;  5CQP A;  4ARW A;  2BO6 A;  1YRO B;  4HO6 A;  1FR9 A;  4G3P A;  4HO0 A;  4HO8 A;  1R7T A;  3SXC A;  1G95 A;  1ZHJ A;  4Y7G A;  1JV3 A;  4EEM A;  2MZB A;  1G97 A;  2VS4 A;  1ZDF A;  1JYK A;  4HOC A;  3OH1 A;  4MND A;  5C3A A;  4BQH A;  1LZI A;  1ZJ2 A;  2OEF A;  1LZ0 A;  4Y7U A;  1O23 B;  3CGX A;  4KC2 A;  1K4V A;  3CKN A;  2X5S A;  1E5K A;  2AES A;  2RJ9 A;  1OMZ A;  3V8Z A;  1QG8 A;  1WT2 A;  3PKQ A;  1VZX A;  1IIN A;  2RJ0 A;  2Y4K A;  3V0N A;  4FRQ A;  2A8W A;  1JVD A;  1H3M A;  4B4M A;  2V0J A;  1ZI4 A;  4B2W A;  4HO9 A;  4KPZ A;  2AH9 A;  1H5S A;  3TZT A;  4D0Z A;  3V0O A;  3E26 A;  4EEG A;  2RJ5 A;  1H7H A;  2OEG A;  3V91 A;  2PGV A;  2Y4L A;  2AGD A;  3E25 A;  1S4N A;  2JCL A;  1EZI A;  1O7Q A;  4YS8 A;  1ZIZ A;  1G2V A;  2ZU7 A;  3SXG A;  2E8B A;  2APC A;  4FRB A;  3ST8 A;  2FYD B;  3I0L A;  1G3L A;  1ZI5 A;  4EVW A;  2RIZ A;  2Y4J A;  5L6V A;  4NAI A;  2V0K A;  2XMH A;  2O1F A;  1WT1 A;  3OC9 A;  2YQH A;  1G8O A;  1ON6 A;  2W0V A;  5FUH A;  2ZU9 A;  3DK5 A;  5C1H A;  2X65 A;  3V0Q A;  1VM8 A;  1HM0 A;  4BMA A;  2XWN A;  3CKO A;  1ZCU A;  1FG5 N;  4KNR A;  3F1C A;  3OH2 A;  3I0E A;  1ZJP A;  3SX8 A;  4EE3 A;  4FRM A;  5C1G A;  2VFZ A;  3RSB A;  1WVC A;  3D98 A;  5FTV A;  3IOH A;  3PNN A;  2OI5 A;  2WEE A;  2Z86 A;  3POL A;  4CJ8 A;  1NHE B;  2W0W A;  3SXA A;  4B4B A;  1TW5 A;  2FYB A;  2E3D A;  2Y7A A;  4J18 A;  4HO2 A;  1H7E A;  2VSH A;  1GWV A;  2WVK A;  3V0M A;  5IDT A;  4KT7 A;  1HJL A;  1ZDG A;  1V82 A;  1NF5 B;  1G1L A;  1V84 A;  2RJ4 A;  2RIY A;  1FWY A;  2WAW A;  4NAL A;  4KXO A;  4GBP A;  2YQJ A;  4B5B A;  1GX4 A;  1PZY B;  1Z90 A;  3OAM A;  1KWS A;  2DPW A;  3SX5 A;  5C4E A;  3I0J A;  3JUK A;  4HG6 A;  4KRV A;  4JIS A;  3TQD A;  1R7V A;  1TVY A;  5CQN X;  1S4P A;  3O3P A;  4Y63 A;  5FU0 A;  5C3D A;  1H4C A;  3CKQ A;  3I0F A;  5J49 A;  2BO8 A;  3IOI A;  4EEO A;  1H5R B;  3K8E A;  4NAK A;  2AM4 A;  5C4B A;  5FTS A;  1WT0 A;  3R3I A;  1FGX A;  3FWW A;  3SX7 A;  3I0D A;  1G23 A;  1ZI3 A;  1R7X A;  5AJN A;  1QGQ A;  5DDT A;  4Y6N A;  1FO8 A;  5C49 A;  1H7T A;  1SS9 A;  1G0R A;  1VIC A;  1ZJ3 A;  4IRQ A;  4FRL A;  3T7M A;  4ASJ A;  1R81 A;  2O1G A;  3IOJ A;  4D0T A;  3U2W A;  2P6W A;  3FOQ A;  1PZT A;  1HM8 A;  3R2W A;  1H5R A;  5C4C A;  3D5N A;  1R7Y A;  3LW6 A;  4D11 A;  4K6R A;  1HV9 A;  4G3Q A;  1VH1 A;  2VXM A;  3Q80 A;  4ZDQ A;  3EE5 A;  1ZJ0 A;  5L6S A;  2VXL A;  5BXC A;  2ICY A;  4HO3 A;  2GGQ A;  3OH3 A;  4HO5 A;  4M2B A;  4P02 A;  3BRK X;  2RIX A;  2FFU A;  2XWL A;  1HJJ A;  3N9W A;  1LL3 A;  3OKR A;  1VGU A;  3U2T A;  4EEA A;  4AAW A;  2BO4 A;  4B42 A;  3GUE A;  2I7B A;  2Q4J A;  1INJ A;  4Y62 A;  5JQQ A;  4HO4 A;  2YES A;  1O0R A;  1WT3 A;  3ZLL A;  2RJ1 A;  2RJ6 A;  2PGY A;  4CJC A;  1FO9 A;  4B3U A;  5EIY A;  5C48 A;  4IRP A;  5AJO A;  5C36 A;  1XZ6 A;  4KC1 A;  2D7I A;  4EE4 A;  1G9R A;  1WSZ A;  5FYE A;  1W55 A;  1H5S C;  4B2X A;  1EYR A;  1NMM B;  4KNX A;  2X60 A;  1ZCV A;  2X5Z A;  3JUJ A;  5EJZ A;  5CMJ A;  1FXJ A;  3CKJ A;  3D8V A;  2YQC A; 
#chains in the Genus database with same CATH topology
 2VSI A;  1MP4 A;  2Z87 A;  1ZJO A;  4KPX A;  4EE5 A;  3SXD A;  3U0Y A;  2JCO A;  2A8U A;  3DJ4 A;  1JV1 A;  2GGO A;  1GA8 A;  3HL3 A;  4CVH A;  2RJ8 A;  2OI6 A;  1I52 A;  5C3B A;  1VZT A;  1H7F A;  2Y6P A;  3ZF8 A;  2V0I A;  2NXV A;  3RMW A;  1H4E A;  1G93 A;  1H7Q A;  1O7O A;  3PKP A;  2WVL A;  2I5E A;  2CU2 A;  5D92 A;  5C38 A;  3U2V A;  1GQ9 A;  1QGS A;  1OMX A;  4B4G A;  4KC4 A;  3I0K A;  2FYA A;  4HCQ A;  4MYB A;  1FOA A;  2OI7 A;  1YP3 A;  4KQL A;  1YP4 A;  2QKX A;  5IFY A;  1VZU A;  1VPA A;  3SX3 A;  3SXB A;  1LZ7 A;  1H4D A;  1ZCY A;  1VGT A;  2VK9 A;  1V83 A;  1VGW A;  4M2A A;  4Y9X A;  2YCM A;  3U2U A;  3NGW A;  1H5S B;  4FRO A;  1S4O A;  4AYJ A;  5FV9 A;  2YC3 A;  1W57 A;  1H5S D;  2P72 A;  4Y64 A;  2YQS A;  4Y6U A;  1JYL A;  5CMG X;  3OH0 A;  1HM9 A;  4FCU A;  2XME A;  2QGI A;  2PA4 A;  3I0H A;  4NAN A;  2RIT A;  3V8Y A;  5C1L A;  1R80 A;  3V0P A;  3DUV A;  2AE7 A;  2AEC A;  5C4D A;  4AYL A;  2YC5 A;  5C47 A;  2V0L A;  3OGZ A;  2O1H A;  2Y4M A;  2ZU8 A;  2FYC B;  4P00 A;  4DE7 A;  3CU0 A;  2WVM A;  4Y7T A;  1ZI1 A;  4FIY A;  3KIA A;  2V0H A;  3ZLK A;  1NWG B;  3SXE A;  2FY7 A;  3OH4 A;  3K8D A;  4LW3 A;  1VGZ A;  5AJP A;  4LW6 A;  1H7G A;  1R82 A;  3BCV A;  3V0L A;  5C8R A;  1GWW A;  5D91 A;  4E1K A;  3SPT A;  1R7U A;  3USQ A;  1LVW A;  3QVB A;  4G3S A;  1TZF A;  4FRP A;  5EJ1 A;  3RMV A;  4UEG A;  2D7R A;  1MC3 A;  4FRE A;  3I0G A;  5DDV A;  4CJB A;  2ICX A;  3T7N A;  2P73 A;  1MP5 A;  1LL0 A;  4FQW A;  1LZJ A;  4G87 A;  1FZW A;  3ZGG A;  1JVG A;  5I1F A;  3V90 A;  2FFV A;  2I5K A;  3U2X A;  2AM5 A;  1IIM A;  1YP2 A;  4DEC A;  2AM3 A;  5CMF X;  1TW1 A;  5IDS A;  2VS3 A;  3T7O A;  2VD4 A;  1W77 A;  4FRD A;  3Q7U A;  5FU8 A;  4AC3 A;  4FRA A;  1H5T B;  1ZCT A;  4D48 A;  3USR A;  3I0I X;  5CMH A;  5C4F A;  1LL2 A;  4JD0 A;  3U0X A;  4M4K A;  2QH5 A;  5CMI A;  4D11 C;  2RJ7 A;  5CQO A;  5HS2 A;  4M28 A;  1FR8 A;  5CQM X;  4DDZ A;  4ECM A;  2JCJ A;  2BO7 A;  2WE9 A;  4R7P A;  4FCE A;  1MP3 A;  1NKH B;  1INI A;  1NQI B;  1ZJ1 A;  2D0J A;  2UX8 A;  3ZGF A;  3JTJ A;  2VS5 A;  2XWM A;  1FGG A;  4FRH A;  3CKV A;  4XWI A;  1VH3 A;  2J0A A;  1QWJ A;  2WGZ A;  1ON8 A;  2PX7 A;  4Y7V A;  5CQL X;  3Q4S A;  2JCK A;  3F1Y A;  4C2S A;  1GX0 A;  4ASY A;  1H5T A;  1H7L A;  4Y7F A;  1FRW A;  3I0C A;  1FXO A;  4L41 C;  1XHB A;  1OQM B;  1GQC A;  5CQP A;  4ARW A;  2BO6 A;  1YRO B;  4HO6 A;  1FR9 A;  4G3P A;  4HO0 A;  4HO8 A;  1R7T A;  3SXC A;  1G95 A;  1ZHJ A;  4Y7G A;  1JV3 A;  4EEM A;  2MZB A;  1G97 A;  2VS4 A;  1ZDF A;  1JYK A;  4HOC A;  3OH1 A;  4MND A;  5C3A A;  4BQH A;  1LZI A;  2C0N A;  1ZJ2 A;  2OEF A;  1LZ0 A;  4O6N A;  4Y7U A;  1O23 B;  3CGX A;  4KC2 A;  1K4V A;  3CKN A;  2X5S A;  1E5K A;  2J0B A;  2AES A;  2RJ9 A;  1OMZ A;  3V8Z A;  1QG8 A;  1WT2 A;  3PKQ A;  1VZX A;  1IIN A;  2RJ0 A;  2Y4K A;  3V0N A;  4FRQ A;  2A8W A;  1JVD A;  1H3M A;  4B4M A;  2V0J A;  1ZI4 A;  4B2W A;  4HO9 A;  4KPZ A;  2AH9 A;  1H5S A;  3TZT A;  4D0Z A;  3V0O A;  3E26 A;  4EEG A;  2RJ5 A;  1H7H A;  2OEG A;  3V91 A;  2PGV A;  2Y4L A;  2AGD A;  3E25 A;  1S4N A;  2JCL A;  1EZI A;  1O7Q A;  4YS8 A;  1ZIZ A;  1G2V A;  2ZU7 A;  3SXG A;  2E8B A;  2APC A;  4FRB A;  3ST8 A;  2FYD B;  3I0L A;  1G3L A;  1ZI5 A;  4EVW A;  2RIZ A;  2Y4J A;  4FIX A;  5L6V A;  4NAI A;  2V0K A;  2XMH A;  2O1F A;  1WT1 A;  3OC9 A;  2YQH A;  1G8O A;  1ON6 A;  2W0V A;  5FUH A;  2ZU9 A;  3DK5 A;  5C1H A;  2X65 A;  3V0Q A;  1VM8 A;  1HM0 A;  4BMA A;  2XWN A;  3CKO A;  1ZCU A;  1FG5 N;  4KNR A;  3F1C A;  3OH2 A;  4O6M A;  3I0E A;  1ZJP A;  3SX8 A;  4EE3 A;  4FRM A;  5C1G A;  2VFZ A;  3RSB A;  1WVC A;  3D98 A;  5FTV A;  3IOH A;  3PNN A;  2OI5 A;  2WEE A;  2Z86 A;  3POL A;  4CJ8 A;  1NHE B;  2W0W A;  3SXA A;  4B4B A;  1TW5 A;  2FYB A;  2E3D A;  2Y7A A;  4J18 A;  4HO2 A;  1H7E A;  2VSH A;  1GWV A;  2WVK A;  3V0M A;  5IDT A;  4KT7 A;  1HJL A;  1ZDG A;  1V82 A;  1NF5 B;  1G1L A;  1V84 A;  2RJ4 A;  2RIY A;  1FWY A;  2WAW A;  4NAL A;  4KXO A;  4GBP A;  2YQJ A;  4B5B A;  1GX4 A;  1PZY B;  1Z90 A;  3OAM A;  1KWS A;  2DPW A;  3SX5 A;  5C4E A;  3I0J A;  3JUK A;  4HG6 A;  4KRV A;  4JIS A;  3TQD A;  1R7V A;  1TVY A;  5CQN X;  1S4P A;  3O3P A;  4Y63 A;  5FU0 A;  5C3D A;  1H4C A;  3CKQ A;  3I0F A;  5J49 A;  2BO8 A;  3IOI A;  4EEO A;  1H5R B;  3K8E A;  4NAK A;  2AM4 A;  5C4B A;  5FTS A;  1WT0 A;  3R3I A;  1FGX A;  3FWW A;  3SX7 A;  3I0D A;  1G23 A;  1ZI3 A;  1R7X A;  5AJN A;  1QGQ A;  5DDT A;  4Y6N A;  1FO8 A;  5C49 A;  1H7T A;  1SS9 A;  1G0R A;  1VIC A;  1ZJ3 A;  4IRQ A;  4FRL A;  3T7M A;  4ASJ A;  1R81 A;  2O1G A;  3IOJ A;  4D0T A;  3U2W A;  2P6W A;  3FOQ A;  1PZT A;  1HM8 A;  3R2W A;  1H5R A;  5C4C A;  3D5N A;  1R7Y A;  3LW6 A;  4D11 A;  4K6R A;  1HV9 A;  4G3Q A;  1VH1 A;  2VXM A;  3Q80 A;  4ZDQ A;  3EE5 A;  1ZJ0 A;  4Q7C A;  5L6S A;  2VXL A;  5BXC A;  2ICY A;  4HO3 A;  2GGQ A;  3OH3 A;  4HO5 A;  4M2B A;  4P02 A;  3BRK X;  2RIX A;  2FFU A;  2XWL A;  1HJJ A;  3N9W A;  1LL3 A;  3OKR A;  1VGU A;  3U2T A;  4EEA A;  4AAW A;  2BO4 A;  4B42 A;  3GUE A;  2I7B A;  2Q4J A;  1INJ A;  4Y62 A;  5JQQ A;  4HO4 A;  2YES A;  1O0R A;  1WT3 A;  3ZLL A;  2RJ1 A;  2RJ6 A;  2PGY A;  4CJC A;  1FO9 A;  4B3U A;  5EIY A;  5C48 A;  4IRP A;  5AJO A;  5C36 A;  1XZ6 A;  4KC1 A;  2D7I A;  4EE4 A;  1G9R A;  1WSZ A;  5FYE A;  1W55 A;  1H5S C;  4B2X A;  1EYR A;  1NMM B;  4KNX A;  2X60 A;  1ZCV A;  2X5Z A;  3JUJ A;  5EJZ A;  5CMJ A;  1FXJ A;  4MIX A;  3CKJ A;  3D8V A;  2YQC A; 
#chains in the Genus database with same CATH homology
 2VSI A;  1MP4 A;  2Z87 A;  1ZJO A;  4KPX A;  4EE5 A;  3SXD A;  3U0Y A;  2JCO A;  2A8U A;  3DJ4 A;  1JV1 A;  2GGO A;  1GA8 A;  3HL3 A;  4CVH A;  2RJ8 A;  2OI6 A;  1I52 A;  5C3B A;  1VZT A;  1H7F A;  2Y6P A;  3ZF8 A;  2V0I A;  2NXV A;  3RMW A;  1H4E A;  1G93 A;  1H7Q A;  1O7O A;  3PKP A;  2WVL A;  2I5E A;  2CU2 A;  5D92 A;  5C38 A;  3U2V A;  1GQ9 A;  1QGS A;  1OMX A;  4B4G A;  4KC4 A;  3I0K A;  2FYA A;  4HCQ A;  4MYB A;  1FOA A;  2OI7 A;  1YP3 A;  4KQL A;  1YP4 A;  2QKX A;  5IFY A;  1VZU A;  1VPA A;  3SX3 A;  3SXB A;  1LZ7 A;  1H4D A;  1ZCY A;  1VGT A;  2VK9 A;  1V83 A;  1VGW A;  4M2A A;  4Y9X A;  2YCM A;  3U2U A;  3NGW A;  1H5S B;  4FRO A;  1S4O A;  4AYJ A;  5FV9 A;  2YC3 A;  1W57 A;  1H5S D;  2P72 A;  4Y64 A;  2YQS A;  4Y6U A;  1JYL A;  5CMG X;  3OH0 A;  1HM9 A;  4FCU A;  2XME A;  2QGI A;  2PA4 A;  3I0H A;  4NAN A;  2RIT A;  3V8Y A;  5C1L A;  1R80 A;  3V0P A;  3DUV A;  2AE7 A;  2AEC A;  5C4D A;  4AYL A;  2YC5 A;  5C47 A;  2V0L A;  3OGZ A;  2O1H A;  2Y4M A;  2ZU8 A;  2FYC B;  4P00 A;  4DE7 A;  3CU0 A;  2WVM A;  4Y7T A;  1ZI1 A;  4FIY A;  3KIA A;  2V0H A;  3ZLK A;  1NWG B;  3SXE A;  2FY7 A;  3OH4 A;  3K8D A;  4LW3 A;  1VGZ A;  5AJP A;  4LW6 A;  1H7G A;  1R82 A;  3BCV A;  3V0L A;  5C8R A;  1GWW A;  5D91 A;  4E1K A;  3SPT A;  1R7U A;  3USQ A;  1LVW A;  3QVB A;  4G3S A;  1TZF A;  4FRP A;  5EJ1 A;  3RMV A;  4UEG A;  2D7R A;  1MC3 A;  4FRE A;  3I0G A;  5DDV A;  4CJB A;  2ICX A;  3T7N A;  2P73 A;  1MP5 A;  1LL0 A;  4FQW A;  1LZJ A;  4G87 A;  1FZW A;  3ZGG A;  1JVG A;  5I1F A;  3V90 A;  2FFV A;  2I5K A;  3U2X A;  2AM5 A;  1IIM A;  1YP2 A;  4DEC A;  2AM3 A;  5CMF X;  1TW1 A;  5IDS A;  2VS3 A;  3T7O A;  2VD4 A;  1W77 A;  4FRD A;  3Q7U A;  5FU8 A;  4AC3 A;  4FRA A;  1H5T B;  1ZCT A;  4D48 A;  3USR A;  3I0I X;  5CMH A;  5C4F A;  1LL2 A;  4JD0 A;  3U0X A;  4M4K A;  2QH5 A;  5CMI A;  4D11 C;  2RJ7 A;  5CQO A;  5HS2 A;  4M28 A;  1FR8 A;  5CQM X;  4DDZ A;  4ECM A;  2JCJ A;  2BO7 A;  2WE9 A;  4R7P A;  4FCE A;  1MP3 A;  1NKH B;  1INI A;  1NQI B;  1ZJ1 A;  2D0J A;  2UX8 A;  3ZGF A;  3JTJ A;  2VS5 A;  2XWM A;  1FGG A;  4FRH A;  3CKV A;  4XWI A;  1VH3 A;  2J0A A;  1QWJ A;  2WGZ A;  1ON8 A;  2PX7 A;  4Y7V A;  5CQL X;  3Q4S A;  2JCK A;  3F1Y A;  4C2S A;  1GX0 A;  4ASY A;  1H5T A;  1H7L A;  4Y7F A;  1FRW A;  3I0C A;  1FXO A;  4L41 C;  1XHB A;  1OQM B;  1GQC A;  5CQP A;  4ARW A;  2BO6 A;  1YRO B;  4HO6 A;  1FR9 A;  4G3P A;  4HO0 A;  4HO8 A;  1R7T A;  3SXC A;  1G95 A;  1ZHJ A;  4Y7G A;  1JV3 A;  4EEM A;  2MZB A;  1G97 A;  2VS4 A;  1ZDF A;  1JYK A;  4HOC A;  3OH1 A;  4MND A;  5C3A A;  4BQH A;  1LZI A;  2C0N A;  1ZJ2 A;  2OEF A;  1LZ0 A;  4O6N A;  4Y7U A;  1O23 B;  3CGX A;  4KC2 A;  1K4V A;  3CKN A;  2X5S A;  1E5K A;  2J0B A;  2AES A;  2RJ9 A;  1OMZ A;  3V8Z A;  1QG8 A;  1WT2 A;  3PKQ A;  1VZX A;  1IIN A;  2RJ0 A;  2Y4K A;  3V0N A;  4FRQ A;  2A8W A;  1JVD A;  1H3M A;  4B4M A;  2V0J A;  1ZI4 A;  4B2W A;  4HO9 A;  4KPZ A;  2AH9 A;  1H5S A;  3TZT A;  4D0Z A;  3V0O A;  3E26 A;  4EEG A;  2RJ5 A;  1H7H A;  2OEG A;  3V91 A;  2PGV A;  2Y4L A;  2AGD A;  3E25 A;  1S4N A;  2JCL A;  1EZI A;  1O7Q A;  4YS8 A;  1ZIZ A;  1G2V A;  2ZU7 A;  3SXG A;  2E8B A;  2APC A;  4FRB A;  3ST8 A;  2FYD B;  3I0L A;  1G3L A;  1ZI5 A;  4EVW A;  2RIZ A;  2Y4J A;  4FIX A;  5L6V A;  4NAI A;  2V0K A;  2XMH A;  2O1F A;  1WT1 A;  3OC9 A;  2YQH A;  1G8O A;  1ON6 A;  2W0V A;  5FUH A;  2ZU9 A;  3DK5 A;  5C1H A;  2X65 A;  3V0Q A;  1VM8 A;  1HM0 A;  4BMA A;  2XWN A;  3CKO A;  1ZCU A;  1FG5 N;  4KNR A;  3F1C A;  3OH2 A;  4O6M A;  3I0E A;  1ZJP A;  3SX8 A;  4EE3 A;  4FRM A;  5C1G A;  2VFZ A;  3RSB A;  1WVC A;  3D98 A;  5FTV A;  3IOH A;  3PNN A;  2OI5 A;  2WEE A;  2Z86 A;  3POL A;  4CJ8 A;  1NHE B;  2W0W A;  3SXA A;  4B4B A;  1TW5 A;  2FYB A;  2E3D A;  2Y7A A;  4J18 A;  4HO2 A;  1H7E A;  2VSH A;  1GWV A;  2WVK A;  3V0M A;  5IDT A;  4KT7 A;  1HJL A;  1ZDG A;  1V82 A;  1NF5 B;  1G1L A;  1V84 A;  2RJ4 A;  2RIY A;  1FWY A;  2WAW A;  4NAL A;  4KXO A;  4GBP A;  2YQJ A;  4B5B A;  1GX4 A;  1PZY B;  1Z90 A;  3OAM A;  1KWS A;  2DPW A;  3SX5 A;  5C4E A;  3I0J A;  3JUK A;  4HG6 A;  4KRV A;  4JIS A;  3TQD A;  1R7V A;  1TVY A;  5CQN X;  1S4P A;  3O3P A;  4Y63 A;  5FU0 A;  5C3D A;  1H4C A;  3CKQ A;  3I0F A;  5J49 A;  2BO8 A;  3IOI A;  4EEO A;  1H5R B;  3K8E A;  4NAK A;  2AM4 A;  5C4B A;  5FTS A;  1WT0 A;  3R3I A;  1FGX A;  3FWW A;  3SX7 A;  3I0D A;  1G23 A;  1ZI3 A;  1R7X A;  5AJN A;  1QGQ A;  5DDT A;  4Y6N A;  1FO8 A;  5C49 A;  1H7T A;  1SS9 A;  1G0R A;  1VIC A;  1ZJ3 A;  4IRQ A;  4FRL A;  3T7M A;  4ASJ A;  1R81 A;  2O1G A;  3IOJ A;  4D0T A;  3U2W A;  2P6W A;  3FOQ A;  1PZT A;  1HM8 A;  3R2W A;  1H5R A;  5C4C A;  3D5N A;  1R7Y A;  3LW6 A;  4D11 A;  4K6R A;  1HV9 A;  4G3Q A;  1VH1 A;  2VXM A;  3Q80 A;  4ZDQ A;  3EE5 A;  1ZJ0 A;  4Q7C A;  5L6S A;  2VXL A;  5BXC A;  2ICY A;  4HO3 A;  2GGQ A;  3OH3 A;  4HO5 A;  4M2B A;  4P02 A;  3BRK X;  2RIX A;  2FFU A;  2XWL A;  1HJJ A;  3N9W A;  1LL3 A;  3OKR A;  1VGU A;  3U2T A;  4EEA A;  4AAW A;  2BO4 A;  4B42 A;  3GUE A;  2I7B A;  2Q4J A;  1INJ A;  4Y62 A;  5JQQ A;  4HO4 A;  2YES A;  1O0R A;  1WT3 A;  3ZLL A;  2RJ1 A;  2RJ6 A;  2PGY A;  4CJC A;  1FO9 A;  4B3U A;  5EIY A;  5C48 A;  4IRP A;  5AJO A;  5C36 A;  1XZ6 A;  4KC1 A;  2D7I A;  4EE4 A;  1G9R A;  1WSZ A;  5FYE A;  1W55 A;  1H5S C;  4B2X A;  1EYR A;  1NMM B;  4KNX A;  2X60 A;  1ZCV A;  2X5Z A;  3JUJ A;  5EJZ A;  5CMJ A;  1FXJ A;  4MIX A;  3CKJ A;  3D8V A;  2YQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...