4CJ8A

Monoclinic crystal form of bogt6a e192q in complex with udp-galnac, udp and galnac
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
238
structure length
238
Chain Sequence
SHMRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products
pubmed doi rcsb
source organism Bacteroides ovatus
total genus 62
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cj8A00
2OEFA 1H5TB 2RIXA 4HCQA 5C1HA 1LZJA 1VZXA 1LL0A 2FFVA 1O0RA 5IDSA 4BMAA 3OH3A 2P73A 1G8OA 5C3AA 3SX5A 4R7PA 3U2TA 1V82A 5CQNX 1W57A 3T7NA 1LVWA 2QH5A 1FR9A 1ZJ3A 2Y4JA 2Y4MA 1EYRA 1INJA 1ON6A 4KC4A 2YC5A 5FU8A 3N9WA 1QG8A 1INIA 4Y7TA 1YP4A 1ZJOA 4FCEA 3I0IX 4DECA 4D0ZA 4HO9A 3V91A 4ZDQA 2X60A 5FUHA 1E5KA 2RIYA 4G3SA 4M2BA 1ZCUA 3NGWA 1PZYB 4NAIA 4AYLA 2BO8A 3OH0A 1ZJ2A 3CKVA 4UEGA 1O23B 1ZI5A 4KC1A 1S4NA 2Z86A 3V0LA 4Y7FA 5EIYA 4IRQA 2RJ8A 2VFZA 2E8BA 2VS5A 4EE3A 3U0XA 4C2SA 2RJ9A 1GX0A 2VS4A 4KQLA 3CKJA 5CMFX 4NANA 2DPWA 2RJ7A 4KC2A 1ZI4A 3IOIA 1JYLA 1W55A 2OEGA 1VPAA 2D7RA 2XWNA 4FRQA 2V0JA 1HJLA 2JCKA 5L6VA 1MP4A 2V0HA 2V0IA 1H4CA 2BO4A 1SS9A 2W0WA 2JCLA 3PKQA 1H3MA 2OI5A 1V83A 2APCA 4FRMA 3KIAA 1NWGB 1R7XA 1IIMA 2AECA 3F1YA 3QVBA 4E1KA 3OH4A 3U2WA 1ZHJA 3GUEA 1KWSA 3K8EA 4KT7A 5FTSA 2PX7A 1NF5B 1QGQA 3Q7UA 1OMZA 1JVGA 1GQCA 5DDVA 4Y9XA 1G97A 3CKOA 4EE4A 3ZGFA 3V0NA 4CJCA 1FRWA 3OH2A 2BO6A 4FCUA 2AM5A 4Y6UA 2VXMA 1TW5A 1YP2A 4IRPA 3BCVA 4ASJA 5IFYA 3V8ZA 5FYEA 2Y4KA 3JUJA 3I0LA 3ZLKA 1FG5N 4YS8A 4AYJA 3OAMA 4EEGA 2D7IA 1QGSA 3SXGA 1R7UA 2YESA 1MC3A 1H7LA 1ZIZA 4FREA 2QKXA 1JV3A 2WVKA 4FRDA 2QGIA 3O3PA 1ZJ1A 4AC3A 4EVWA 2YCMA 1JYKA 4CJBA 3TQDA 3R3IA 4EE5A 1IINA 4XWIA 1WT1A 4ARWA 5C36A 1VICA 1ZDFA 3OH1A 1VM8A 2JCJA 4HO2A 2RJ0A 4HO5A 2V0KA 3IOJA 2X5SA 1MP3A 3POLA 1NMMB 3F1CA 1EZIA 4G87A 3V8YA 4D11C 3E26A 3ST8A 5CQOA 1VGZA 3SXEA 2PGVA 1GX4A 2RJ5A 4FRBA 3ZLLA 4HO3A 4HO4A 3U2XA 2YC3A 5IDTA 4CVHA 1FO9A 2P6WA 4JISA 1VH3A 1R80A 4L41C 3V0QA 1ZJ0A 1Z90A 4D0TA 3I0JA 4HO0A 2PA4A 1TVYA 1OQMB 3OKRA 1HV9A 2AESA 1ZCVA 3V90A 3T7OA 4GBPA 4Y7GA 2Y4LA 1VH1A 2FYCB 4M28A 1H7GA 1H4EA 1XZ6A 4HOCA 4B42A 2P72A 4ECMA 5JQQA 3ZF8A 2RITA 3V0OA 5J49A 1LL3A 1H5SD 4MYBA 5CQLX 2YQJA 4P02A 1O7OA 2V0LA 2BO7A 5C4DA 4G3QA 2WAWA 5C3BA 2AE7A 1NKHB 2WE9A 1ZCTA 3OC9A 5EJ1A 3SXCA 4FRLA 1GQ9A 2MZBA 2AGDA 5AJNA 1XHBA 1FOAA 2CU2A 1VZUA 1G9RA 3PKPA 3FWWA 4M4KA 3V0PA 1FO8A 4B4BA 5BXCA 5C48A 2RJ4A 1G2VA 2VXLA 2VD4A 3U2VA 2O1FA 1S4PA 5DDTA 4EEMA 1H7EA 4Y6NA 1LL2A 2WEEA 1VZTA 3CU0A 1V84A 4B2WA 5FV9A 3SXBA 3I0GA 1R81A 3U0YA 4MNDA 5CQMX 2D0JA 4KNXA 4D11A 4LW3A 1R7VA 4Y64A 1TZFA 3I0DA 4B2XA 1S4OA 3CKQA 5C4BA 2GGQA 2O1HA 3BRKX 1FWYA 1H5SC 2JCOA 1H4DA 1OMXA 3OGZA 1ZI1A 2XMHA 2WGZA 4B4MA 1GA8A 4M2AA 5FU0A 1FXOA 2O1GA 5EJZA 3USQA 4HG6A 3EE5A 2ICYA 1I52A 2WVMA 4KRVA 2YQCA 3U2UA 5CQPA 1ZDGA 4FQWA 4B5BA 1LZ0A 5L6SA 2YQSA 3JTJA 4AAWA 1VGUA 1H5RA 4B4GA 1O7QA 2GGOA 3I0KA 2XMEA 5CMHA 5HS2A 1ZJPA 3I0HA 4EEOA 1HM0A 1QWJA 2I5EA 3FOQA 1YP3A 5AJOA 2ZU9A 1FGGA 1HM9A 4P00A 1WT2A 1H7FA 3Q4SA 2FYAA 4EEAA 4B3UA 1H7QA 3R2WA 1WSZA 2Y6PA 3ZGGA 2A8WA 1G23A 1ZI3A 1JV1A 4BQHA 4DDZA 1ZCYA 3HL3A 2Q4JA 4HO6A 4KNRA 3SPTA 3D98A 1FZWA 3DJ4A 4ASYA 2AM3A 1TW1A 3CKNA 1YROB 1H5RB 5C4EA 3DK5A 3CGXA 1ON8A 4Y62A 3JUKA 2X5ZA 4KXOA 3RMVA 4CJ8A 3SX8A 5C8RA 3DUVA 2RJ6A 1FR8A 5C1LA 4LW6A 2AH9A 4J18A 1PZTA 3E25A 1H7TA 3LW6A 2FFUA 1R7TA 1MP5A 3Q80A 5CMGX 4JD0A 4NAKA 1H5SA 2E3DA 2RJ1A 1WT0A 4KPZA 3TZTA 5C47A 3SX3A 2X65A 5C4CA 1NHEB 1R7YA 5C3DA 1R82A 1WT3A 3V0MA 1H7HA 1W77A 3USRA 2I7BA 4G3PA 5FTVA 1G1LA 1GWVA 1JVDA 4KPXA 3D8VA 4HO8A 1G93A 2OI7A 2WVLA 4Y7UA 2FYBA 3K8DA 5I1FA 4Y7VA 2UX8A 2I5KA 1VGTA 3D5NA 3I0FA 4DE7A 4FRAA 1H5SB 4FRHA 5AJPA 1GWWA 3T7MA 1NQIB 1FGXA 2FY7A 5C1GA 2ICXA 2OI6A 2W0VA 5CMJA 2NXVA 2VS3A 3IOHA 3SXDA 2ZU7A 1H5TA 1G3LA 2VSIA 4D48A 5C38A 2VSHA 1LZ7A 2AM4A 1WVCA 4NALA 1K4VA 3RSBA 5C49A 2RIZA 4FRPA 3SXAA 2XWMA 5CMIA 3I0CA 2FYDB 2Y7AA 4FROA 1LZIA 3PNNA 1FXJA 2ZU8A 4K6RA 1HJJA 1HM8A 3SX7A 2Z87A 5C4FA 2XWLA 1G0RA 3I0EA 1G95A 1VGWA 4Y63A 2A8UA 2PGYA 2YQHA 3RMWA
chains in the Genus database with same CATH superfamily
2OEFA 1H5TB 2RIXA 4HCQA 5C1HA 1LZJA 1VZXA 1LL0A 2FFVA 1O0RA 5IDSA 4BMAA 3OH3A 2P73A 1G8OA 5C3AA 3SX5A 4R7PA 3U2TA 1V82A 5CQNX 1W57A 3T7NA 1LVWA 2QH5A 1FR9A 1ZJ3A 2Y4JA 2Y4MA 1EYRA 1INJA 1ON6A 4KC4A 2YC5A 5FU8A 4FIYA 3N9WA 1QG8A 1INIA 4Y7TA 1YP4A 1ZJOA 4FCEA 3I0IX 4DECA 4D0ZA 4HO9A 3V91A 4ZDQA 2X60A 5FUHA 1E5KA 2RIYA 4G3SA 2VK9A 4M2BA 1ZCUA 3NGWA 1PZYB 4NAIA 4AYLA 2BO8A 3OH0A 1ZJ2A 3CKVA 4UEGA 1O23B 1ZI5A 4KC1A 1S4NA 2Z86A 3V0LA 4Y7FA 5EIYA 4IRQA 2RJ8A 2VFZA 2E8BA 2VS5A 4EE3A 3U0XA 4C2SA 2RJ9A 1GX0A 2VS4A 4KQLA 3CKJA 5CMFX 4NANA 2DPWA 2RJ7A 4KC2A 1ZI4A 3IOIA 1JYLA 1W55A 2OEGA 1VPAA 2D7RA 2XWNA 4FRQA 2V0JA 1HJLA 2JCKA 5L6VA 1MP4A 2V0HA 2V0IA 1H4CA 2BO4A 1SS9A 2W0WA 2JCLA 2J0AA 3PKQA 1H3MA 2OI5A 1V83A 2APCA 4FRMA 3KIAA 1NWGB 1R7XA 1IIMA 2AECA 3F1YA 3QVBA 4E1KA 3OH4A 3U2WA 1ZHJA 3GUEA 1KWSA 3K8EA 4KT7A 5FTSA 2PX7A 5D92A 1NF5B 1QGQA 3Q7UA 1OMZA 2C0NA 1JVGA 1GQCA 5DDVA 4Y9XA 1G97A 3CKOA 4EE4A 3ZGFA 3V0NA 4CJCA 1FRWA 3OH2A 2BO6A 4FCUA 2AM5A 4Y6UA 2VXMA 1TW5A 1YP2A 4IRPA 3BCVA 4ASJA 5IFYA 3V8ZA 5FYEA 2Y4KA 3JUJA 3I0LA 3ZLKA 1FG5N 4YS8A 4AYJA 3OAMA 4EEGA 2D7IA 1QGSA 3SXGA 1R7UA 2YESA 1MC3A 1H7LA 1ZIZA 4FREA 2QKXA 1JV3A 2WVKA 4FRDA 2QGIA 3O3PA 1ZJ1A 4AC3A 4EVWA 2YCMA 1JYKA 4CJBA 3TQDA 3R3IA 4EE5A 1IINA 4XWIA 1WT1A 4ARWA 5C36A 1VICA 1ZDFA 3OH1A 1VM8A 2JCJA 4HO2A 2RJ0A 4HO5A 2V0KA 3IOJA 2X5SA 1MP3A 3POLA 1NMMB 3F1CA 1EZIA 4G87A 3V8YA 4D11C 3E26A 3ST8A 5CQOA 1VGZA 3SXEA 2PGVA 1GX4A 2RJ5A 4FRBA 3ZLLA 4HO3A 4HO4A 3U2XA 2YC3A 5IDTA 4CVHA 1FO9A 2P6WA 4JISA 1VH3A 1R80A 4L41C 3V0QA 1ZJ0A 1Z90A 4O6MA 4D0TA 3I0JA 4HO0A 2PA4A 1TVYA 1OQMB 3OKRA 1HV9A 2AESA 1ZCVA 3V90A 3T7OA 4GBPA 4Y7GA 2Y4LA 1VH1A 2FYCB 4M28A 1H7GA 1H4EA 1XZ6A 4HOCA 4B42A 2P72A 4ECMA 5JQQA 3ZF8A 2RITA 3V0OA 5J49A 4FIXA 1LL3A 1H5SD 4MYBA 5CQLX 2YQJA 4P02A 1O7OA 2V0LA 2BO7A 5C4DA 4G3QA 2WAWA 5C3BA 2AE7A 1NKHB 2WE9A 1ZCTA 3OC9A 5EJ1A 3SXCA 4FRLA 1GQ9A 2MZBA 2AGDA 4Q7CA 5AJNA 1XHBA 1FOAA 2CU2A 1VZUA 1G9RA 3PKPA 3FWWA 4M4KA 3V0PA 1FO8A 4B4BA 5BXCA 5C48A 2RJ4A 1G2VA 2VXLA 2VD4A 3U2VA 2O1FA 1S4PA 5DDTA 4EEMA 1H7EA 4Y6NA 1LL2A 2WEEA 1VZTA 3CU0A 1V84A 4B2WA 5FV9A 3SXBA 3I0GA 1R81A 3U0YA 4MNDA 5CQMX 2D0JA 4KNXA 5D91A 4D11A 4LW3A 1R7VA 4Y64A 1TZFA 3I0DA 4B2XA 1S4OA 3CKQA 5C4BA 2GGQA 2O1HA 3BRKX 1FWYA 1H5SC 2JCOA 1H4DA 1OMXA 3OGZA 1ZI1A 2XMHA 2WGZA 4B4MA 1GA8A 4M2AA 5FU0A 1FXOA 2O1GA 5EJZA 3USQA 4HG6A 3EE5A 2ICYA 1I52A 2WVMA 4KRVA 2YQCA 3U2UA 5CQPA 1ZDGA 4FQWA 4B5BA 1LZ0A 5L6SA 2YQSA 3JTJA 4AAWA 1VGUA 1H5RA 4B4GA 1O7QA 2GGOA 3I0KA 2XMEA 5CMHA 5HS2A 1ZJPA 3I0HA 4EEOA 2J0BA 1HM0A 1QWJA 2I5EA 3FOQA 1YP3A 5AJOA 2ZU9A 1FGGA 1HM9A 4P00A 1WT2A 1H7FA 3Q4SA 2FYAA 4EEAA 4B3UA 1H7QA 3R2WA 1WSZA 2Y6PA 3ZGGA 2A8WA 1G23A 1ZI3A 1JV1A 4BQHA 4DDZA 1ZCYA 3HL3A 2Q4JA 4HO6A 4KNRA 3SPTA 3D98A 1FZWA 3DJ4A 4ASYA 2AM3A 1TW1A 3CKNA 1YROB 1H5RB 5C4EA 3DK5A 3CGXA 1ON8A 4Y62A 3JUKA 2X5ZA 4KXOA 3RMVA 4CJ8A 3SX8A 5C8RA 3DUVA 2RJ6A 4O6NA 1FR8A 5C1LA 4LW6A 2AH9A 4J18A 1PZTA 3E25A 1H7TA 3LW6A 2FFUA 1R7TA 1MP5A 3Q80A 5CMGX 4JD0A 4NAKA 1H5SA 2E3DA 2RJ1A 1WT0A 4KPZA 3TZTA 5C47A 3SX3A 2X65A 5C4CA 1NHEB 1R7YA 5C3DA 1R82A 1WT3A 3V0MA 1H7HA 1W77A 3USRA 2I7BA 4G3PA 5FTVA 1G1LA 1GWVA 1JVDA 4KPXA 3D8VA 4HO8A 1G93A 2OI7A 2WVLA 4Y7UA 2FYBA 3K8DA 5I1FA 4Y7VA 2UX8A 2I5KA 1VGTA 3D5NA 3I0FA 4DE7A 4FRAA 1H5SB 4FRHA 5AJPA 1GWWA 3T7MA 1NQIB 1FGXA 2FY7A 5C1GA 2ICXA 2OI6A 2W0VA 5CMJA 2NXVA 2VS3A 3IOHA 3SXDA 2ZU7A 1H5TA 1G3LA 2VSIA 4D48A 5C38A 2VSHA 1LZ7A 2AM4A 1WVCA 4NALA 1K4VA 3RSBA 5C49A 2RIZA 4FRPA 3SXAA 2XWMA 5CMIA 3I0CA 2FYDB 2Y7AA 4FROA 1LZIA 3PNNA 1FXJA 2ZU8A 4K6RA 1HJJA 1HM8A 3SX7A 2Z87A 5C4FA 2XWLA 1G0RA 4MIXA 3I0EA 1G95A 1VGWA 4Y63A 2A8UA 2PGYA 2YQHA 3RMWA
chains in the Genus database with same CATH topology
2OEFA 1H5TB 2RIXA 4HCQA 5C1HA 1LZJA 1VZXA 1LL0A 2FFVA 1O0RA 5IDSA 4BMAA 3OH3A 2P73A 1G8OA 5C3AA 3SX5A 4R7PA 3U2TA 1V82A 5CQNX 1W57A 3T7NA 1LVWA 2QH5A 1FR9A 1ZJ3A 2Y4JA 2Y4MA 1EYRA 1INJA 1ON6A 4KC4A 2YC5A 5FU8A 4FIYA 3N9WA 1QG8A 1INIA 4Y7TA 1YP4A 1ZJOA 4FCEA 3I0IX 4DECA 4D0ZA 4HO9A 3V91A 4ZDQA 2X60A 5FUHA 1E5KA 2RIYA 4G3SA 2VK9A 4M2BA 1ZCUA 3NGWA 1PZYB 4NAIA 4AYLA 2BO8A 3OH0A 1ZJ2A 3CKVA 4UEGA 1O23B 1ZI5A 4KC1A 1S4NA 2Z86A 3V0LA 4Y7FA 5EIYA 4IRQA 2RJ8A 2VFZA 2E8BA 2VS5A 4EE3A 3U0XA 4C2SA 2RJ9A 1GX0A 2VS4A 4KQLA 3CKJA 5CMFX 4NANA 2DPWA 2RJ7A 4KC2A 1ZI4A 3IOIA 1JYLA 1W55A 2OEGA 1VPAA 2D7RA 2XWNA 4FRQA 2V0JA 1HJLA 2JCKA 5L6VA 1MP4A 2V0HA 2V0IA 1H4CA 2BO4A 1SS9A 2W0WA 2JCLA 2J0AA 3PKQA 1H3MA 2OI5A 1V83A 2APCA 4FRMA 3KIAA 1NWGB 1R7XA 1IIMA 2AECA 3F1YA 3QVBA 4E1KA 3OH4A 3U2WA 1ZHJA 3GUEA 1KWSA 3K8EA 4KT7A 5FTSA 2PX7A 5D92A 1NF5B 1QGQA 3Q7UA 1OMZA 2C0NA 1JVGA 1GQCA 5DDVA 4Y9XA 1G97A 3CKOA 4EE4A 3ZGFA 3V0NA 4CJCA 1FRWA 3OH2A 2BO6A 4FCUA 2AM5A 4Y6UA 2VXMA 1TW5A 1YP2A 4IRPA 3BCVA 4ASJA 5IFYA 3V8ZA 5FYEA 2Y4KA 3JUJA 3I0LA 3ZLKA 1FG5N 4YS8A 4AYJA 3OAMA 4EEGA 2D7IA 1QGSA 3SXGA 1R7UA 2YESA 1MC3A 1H7LA 1ZIZA 4FREA 2QKXA 1JV3A 2WVKA 4FRDA 2QGIA 3O3PA 1ZJ1A 4AC3A 4EVWA 2YCMA 1JYKA 4CJBA 3TQDA 3R3IA 4EE5A 1IINA 4XWIA 1WT1A 4ARWA 5C36A 1VICA 1ZDFA 3OH1A 1VM8A 2JCJA 4HO2A 2RJ0A 4HO5A 2V0KA 3IOJA 2X5SA 1MP3A 3POLA 1NMMB 3F1CA 1EZIA 4G87A 3V8YA 4D11C 3E26A 3ST8A 5CQOA 1VGZA 3SXEA 2PGVA 1GX4A 2RJ5A 4FRBA 3ZLLA 4HO3A 4HO4A 3U2XA 2YC3A 5IDTA 4CVHA 1FO9A 2P6WA 4JISA 1VH3A 1R80A 4L41C 3V0QA 1ZJ0A 1Z90A 4O6MA 4D0TA 3I0JA 4HO0A 2PA4A 1TVYA 1OQMB 3OKRA 1HV9A 2AESA 1ZCVA 3V90A 3T7OA 4GBPA 4Y7GA 2Y4LA 1VH1A 2FYCB 4M28A 1H7GA 1H4EA 1XZ6A 4HOCA 4B42A 2P72A 4ECMA 5JQQA 3ZF8A 2RITA 3V0OA 5J49A 4FIXA 1LL3A 1H5SD 4MYBA 5CQLX 2YQJA 4P02A 1O7OA 2V0LA 2BO7A 5C4DA 4G3QA 2WAWA 5C3BA 2AE7A 1NKHB 2WE9A 1ZCTA 3OC9A 5EJ1A 3SXCA 4FRLA 1GQ9A 2MZBA 2AGDA 4Q7CA 5AJNA 1XHBA 1FOAA 2CU2A 1VZUA 1G9RA 3PKPA 3FWWA 4M4KA 3V0PA 1FO8A 4B4BA 5BXCA 5C48A 2RJ4A 1G2VA 2VXLA 2VD4A 3U2VA 2O1FA 1S4PA 5DDTA 4EEMA 1H7EA 4Y6NA 1LL2A 2WEEA 1VZTA 3CU0A 1V84A 4B2WA 5FV9A 3SXBA 3I0GA 1R81A 3U0YA 4MNDA 5CQMX 2D0JA 4KNXA 5D91A 4D11A 4LW3A 1R7VA 4Y64A 1TZFA 3I0DA 4B2XA 1S4OA 3CKQA 5C4BA 2GGQA 2O1HA 3BRKX 1FWYA 1H5SC 2JCOA 1H4DA 1OMXA 3OGZA 1ZI1A 2XMHA 2WGZA 4B4MA 1GA8A 4M2AA 5FU0A 1FXOA 2O1GA 5EJZA 3USQA 4HG6A 3EE5A 2ICYA 1I52A 2WVMA 4KRVA 2YQCA 3U2UA 5CQPA 1ZDGA 4FQWA 4B5BA 1LZ0A 5L6SA 2YQSA 3JTJA 4AAWA 1VGUA 1H5RA 4B4GA 1O7QA 2GGOA 3I0KA 2XMEA 5CMHA 5HS2A 1ZJPA 3I0HA 4EEOA 2J0BA 1HM0A 1QWJA 2I5EA 3FOQA 1YP3A 5AJOA 2ZU9A 1FGGA 1HM9A 4P00A 1WT2A 1H7FA 3Q4SA 2FYAA 4EEAA 4B3UA 1H7QA 3R2WA 1WSZA 2Y6PA 3ZGGA 2A8WA 1G23A 1ZI3A 1JV1A 4BQHA 4DDZA 1ZCYA 3HL3A 2Q4JA 4HO6A 4KNRA 3SPTA 3D98A 1FZWA 3DJ4A 4ASYA 2AM3A 1TW1A 3CKNA 1YROB 1H5RB 5C4EA 3DK5A 3CGXA 1ON8A 4Y62A 3JUKA 2X5ZA 4KXOA 3RMVA 4CJ8A 3SX8A 5C8RA 3DUVA 2RJ6A 4O6NA 1FR8A 5C1LA 4LW6A 2AH9A 4J18A 1PZTA 3E25A 1H7TA 3LW6A 2FFUA 1R7TA 1MP5A 3Q80A 5CMGX 4JD0A 4NAKA 1H5SA 2E3DA 2RJ1A 1WT0A 4KPZA 3TZTA 5C47A 3SX3A 2X65A 5C4CA 1NHEB 1R7YA 5C3DA 1R82A 1WT3A 3V0MA 1H7HA 1W77A 3USRA 2I7BA 4G3PA 5FTVA 1G1LA 1GWVA 1JVDA 4KPXA 3D8VA 4HO8A 1G93A 2OI7A 2WVLA 4Y7UA 2FYBA 3K8DA 5I1FA 4Y7VA 2UX8A 2I5KA 1VGTA 3D5NA 3I0FA 4DE7A 4FRAA 1H5SB 4FRHA 5AJPA 1GWWA 3T7MA 1NQIB 1FGXA 2FY7A 5C1GA 2ICXA 2OI6A 2W0VA 5CMJA 2NXVA 2VS3A 3IOHA 3SXDA 2ZU7A 1H5TA 1G3LA 2VSIA 4D48A 5C38A 2VSHA 1LZ7A 2AM4A 1WVCA 4NALA 1K4VA 3RSBA 5C49A 2RIZA 4FRPA 3SXAA 2XWMA 5CMIA 3I0CA 2FYDB 2Y7AA 4FROA 1LZIA 3PNNA 1FXJA 2ZU8A 4K6RA 1HJJA 1HM8A 3SX7A 2Z87A 5C4FA 2XWLA 1G0RA 4MIXA 3I0EA 1G95A 1VGWA 4Y63A 2A8UA 2PGYA 2YQHA 3RMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEF A;  1H5T B;  2RIX A;  4HCQ A;  5C1H A;  1LZJ A;  1VZX A;  1LL0 A;  2FFV A;  1O0R A;  5IDS A;  4BMA A;  3OH3 A;  2P73 A;  1G8O A;  5C3A A;  3SX5 A;  4R7P A;  3U2T A;  1V82 A;  5CQN X;  1W57 A;  3T7N A;  1LVW A;  2QH5 A;  1FR9 A;  1ZJ3 A;  2Y4J A;  2Y4M A;  1EYR A;  1INJ A;  1ON6 A;  4KC4 A;  2YC5 A;  5FU8 A;  3N9W A;  1QG8 A;  1INI A;  4Y7T A;  1YP4 A;  1ZJO A;  4FCE A;  3I0I X;  4DEC A;  4D0Z A;  4HO9 A;  3V91 A;  4ZDQ A;  2X60 A;  5FUH A;  1E5K A;  2RIY A;  4G3S A;  4M2B A;  1ZCU A;  3NGW A;  1PZY B;  4NAI A;  4AYL A;  2BO8 A;  3OH0 A;  1ZJ2 A;  3CKV A;  4UEG A;  1O23 B;  1ZI5 A;  4KC1 A;  1S4N A;  2Z86 A;  3V0L A;  4Y7F A;  5EIY A;  4IRQ A;  2RJ8 A;  2VFZ A;  2E8B A;  2VS5 A;  4EE3 A;  3U0X A;  4C2S A;  2RJ9 A;  1GX0 A;  2VS4 A;  4KQL A;  3CKJ A;  5CMF X;  4NAN A;  2DPW A;  2RJ7 A;  4KC2 A;  1ZI4 A;  3IOI A;  1JYL A;  1W55 A;  2OEG A;  1VPA A;  2D7R A;  2XWN A;  4FRQ A;  2V0J A;  1HJL A;  2JCK A;  5L6V A;  1MP4 A;  2V0H A;  2V0I A;  1H4C A;  2BO4 A;  1SS9 A;  2W0W A;  2JCL A;  3PKQ A;  1H3M A;  2OI5 A;  1V83 A;  2APC A;  4FRM A;  3KIA A;  1NWG B;  1R7X A;  1IIM A;  2AEC A;  3F1Y A;  3QVB A;  4E1K A;  3OH4 A;  3U2W A;  1ZHJ A;  3GUE A;  1KWS A;  3K8E A;  4KT7 A;  5FTS A;  2PX7 A;  1NF5 B;  1QGQ A;  3Q7U A;  1OMZ A;  1JVG A;  1GQC A;  5DDV A;  4Y9X A;  1G97 A;  3CKO A;  4EE4 A;  3ZGF A;  3V0N A;  4CJC A;  1FRW A;  3OH2 A;  2BO6 A;  4FCU A;  2AM5 A;  4Y6U A;  2VXM A;  1TW5 A;  1YP2 A;  4IRP A;  3BCV A;  4ASJ A;  5IFY A;  3V8Z A;  5FYE A;  2Y4K A;  3JUJ A;  3I0L A;  3ZLK A;  1FG5 N;  4YS8 A;  4AYJ A;  3OAM A;  4EEG A;  2D7I A;  1QGS A;  3SXG A;  1R7U A;  2YES A;  1MC3 A;  1H7L A;  1ZIZ A;  4FRE A;  2QKX A;  1JV3 A;  2WVK A;  4FRD A;  2QGI A;  3O3P A;  1ZJ1 A;  4AC3 A;  4EVW A;  2YCM A;  1JYK A;  4CJB A;  3TQD A;  3R3I A;  4EE5 A;  1IIN A;  4XWI A;  1WT1 A;  4ARW A;  5C36 A;  1VIC A;  1ZDF A;  3OH1 A;  1VM8 A;  2JCJ A;  4HO2 A;  2RJ0 A;  4HO5 A;  2V0K A;  3IOJ A;  2X5S A;  1MP3 A;  3POL A;  1NMM B;  3F1C A;  1EZI A;  4G87 A;  3V8Y A;  4D11 C;  3E26 A;  3ST8 A;  5CQO A;  1VGZ A;  3SXE A;  2PGV A;  1GX4 A;  2RJ5 A;  4FRB A;  3ZLL A;  4HO3 A;  4HO4 A;  3U2X A;  2YC3 A;  5IDT A;  4CVH A;  1FO9 A;  2P6W A;  4JIS A;  1VH3 A;  1R80 A;  4L41 C;  3V0Q A;  1ZJ0 A;  1Z90 A;  4D0T A;  3I0J A;  4HO0 A;  2PA4 A;  1TVY A;  1OQM B;  3OKR A;  1HV9 A;  2AES A;  1ZCV A;  3V90 A;  3T7O A;  4GBP A;  4Y7G A;  2Y4L A;  1VH1 A;  2FYC B;  4M28 A;  1H7G A;  1H4E A;  1XZ6 A;  4HOC A;  4B42 A;  2P72 A;  4ECM A;  5JQQ A;  3ZF8 A;  2RIT A;  3V0O A;  5J49 A;  1LL3 A;  1H5S D;  4MYB A;  5CQL X;  2YQJ A;  4P02 A;  1O7O A;  2V0L A;  2BO7 A;  5C4D A;  4G3Q A;  2WAW A;  5C3B A;  2AE7 A;  1NKH B;  2WE9 A;  1ZCT A;  3OC9 A;  5EJ1 A;  3SXC A;  4FRL A;  1GQ9 A;  2MZB A;  2AGD A;  5AJN A;  1XHB A;  1FOA A;  2CU2 A;  1VZU A;  1G9R A;  3PKP A;  3FWW A;  4M4K A;  3V0P A;  1FO8 A;  4B4B A;  5BXC A;  5C48 A;  2RJ4 A;  1G2V A;  2VXL A;  2VD4 A;  3U2V A;  2O1F A;  1S4P A;  5DDT A;  4EEM A;  1H7E A;  4Y6N A;  1LL2 A;  2WEE A;  1VZT A;  3CU0 A;  1V84 A;  4B2W A;  5FV9 A;  3SXB A;  3I0G A;  1R81 A;  3U0Y A;  4MND A;  5CQM X;  2D0J A;  4KNX A;  4D11 A;  4LW3 A;  1R7V A;  4Y64 A;  1TZF A;  3I0D A;  4B2X A;  1S4O A;  3CKQ A;  5C4B A;  2GGQ A;  2O1H A;  3BRK X;  1FWY A;  1H5S C;  2JCO A;  1H4D A;  1OMX A;  3OGZ A;  1ZI1 A;  2XMH A;  2WGZ A;  4B4M A;  1GA8 A;  4M2A A;  5FU0 A;  1FXO A;  2O1G A;  5EJZ A;  3USQ A;  4HG6 A;  3EE5 A;  2ICY A;  1I52 A;  2WVM A;  4KRV A;  2YQC A;  3U2U A;  5CQP A;  1ZDG A;  4FQW A;  4B5B A;  1LZ0 A;  5L6S A;  2YQS A;  3JTJ A;  4AAW A;  1VGU A;  1H5R A;  4B4G A;  1O7Q A;  2GGO A;  3I0K A;  2XME A;  5CMH A;  5HS2 A;  1ZJP A;  3I0H A;  4EEO A;  1HM0 A;  1QWJ A;  2I5E A;  3FOQ A;  1YP3 A;  5AJO A;  2ZU9 A;  1FGG A;  1HM9 A;  4P00 A;  1WT2 A;  1H7F A;  3Q4S A;  2FYA A;  4EEA A;  4B3U A;  1H7Q A;  3R2W A;  1WSZ A;  2Y6P A;  3ZGG A;  2A8W A;  1G23 A;  1ZI3 A;  1JV1 A;  4BQH A;  4DDZ A;  1ZCY A;  3HL3 A;  2Q4J A;  4HO6 A;  4KNR A;  3SPT A;  3D98 A;  1FZW A;  3DJ4 A;  4ASY A;  2AM3 A;  1TW1 A;  3CKN A;  1YRO B;  1H5R B;  5C4E A;  3DK5 A;  3CGX A;  1ON8 A;  4Y62 A;  3JUK A;  2X5Z A;  4KXO A;  3RMV A;  4CJ8 A;  3SX8 A;  5C8R A;  3DUV A;  2RJ6 A;  1FR8 A;  5C1L A;  4LW6 A;  2AH9 A;  4J18 A;  1PZT A;  3E25 A;  1H7T A;  3LW6 A;  2FFU A;  1R7T A;  1MP5 A;  3Q80 A;  5CMG X;  4JD0 A;  4NAK A;  1H5S A;  2E3D A;  2RJ1 A;  1WT0 A;  4KPZ A;  3TZT A;  5C47 A;  3SX3 A;  2X65 A;  5C4C A;  1NHE B;  1R7Y A;  5C3D A;  1R82 A;  1WT3 A;  3V0M A;  1H7H A;  1W77 A;  3USR A;  2I7B A;  4G3P A;  5FTV A;  1G1L A;  1GWV A;  1JVD A;  4KPX A;  3D8V A;  4HO8 A;  1G93 A;  2OI7 A;  2WVL A;  4Y7U A;  2FYB A;  3K8D A;  5I1F A;  4Y7V A;  2UX8 A;  2I5K A;  1VGT A;  3D5N A;  3I0F A;  4DE7 A;  4FRA A;  1H5S B;  4FRH A;  5AJP A;  1GWW A;  3T7M A;  1NQI B;  1FGX A;  2FY7 A;  5C1G A;  2ICX A;  2OI6 A;  2W0V A;  5CMJ A;  2NXV A;  2VS3 A;  3IOH A;  3SXD A;  2ZU7 A;  1H5T A;  1G3L A;  2VSI A;  4D48 A;  5C38 A;  2VSH A;  1LZ7 A;  2AM4 A;  1WVC A;  4NAL A;  1K4V A;  3RSB A;  5C49 A;  2RIZ A;  4FRP A;  3SXA A;  2XWM A;  5CMI A;  3I0C A;  2FYD B;  2Y7A A;  4FRO A;  1LZI A;  3PNN A;  1FXJ A;  2ZU8 A;  4K6R A;  1HJJ A;  1HM8 A;  3SX7 A;  2Z87 A;  5C4F A;  2XWL A;  1G0R A;  3I0E A;  1G95 A;  1VGW A;  4Y63 A;  2A8U A;  2PGY A;  2YQH A;  3RMW A; 
#chains in the Genus database with same CATH topology
 2OEF A;  1H5T B;  2RIX A;  4HCQ A;  5C1H A;  1LZJ A;  1VZX A;  1LL0 A;  2FFV A;  1O0R A;  5IDS A;  4BMA A;  3OH3 A;  2P73 A;  1G8O A;  5C3A A;  3SX5 A;  4R7P A;  3U2T A;  1V82 A;  5CQN X;  1W57 A;  3T7N A;  1LVW A;  2QH5 A;  1FR9 A;  1ZJ3 A;  2Y4J A;  2Y4M A;  1EYR A;  1INJ A;  1ON6 A;  4KC4 A;  2YC5 A;  5FU8 A;  4FIY A;  3N9W A;  1QG8 A;  1INI A;  4Y7T A;  1YP4 A;  1ZJO A;  4FCE A;  3I0I X;  4DEC A;  4D0Z A;  4HO9 A;  3V91 A;  4ZDQ A;  2X60 A;  5FUH A;  1E5K A;  2RIY A;  4G3S A;  2VK9 A;  4M2B A;  1ZCU A;  3NGW A;  1PZY B;  4NAI A;  4AYL A;  2BO8 A;  3OH0 A;  1ZJ2 A;  3CKV A;  4UEG A;  1O23 B;  1ZI5 A;  4KC1 A;  1S4N A;  2Z86 A;  3V0L A;  4Y7F A;  5EIY A;  4IRQ A;  2RJ8 A;  2VFZ A;  2E8B A;  2VS5 A;  4EE3 A;  3U0X A;  4C2S A;  2RJ9 A;  1GX0 A;  2VS4 A;  4KQL A;  3CKJ A;  5CMF X;  4NAN A;  2DPW A;  2RJ7 A;  4KC2 A;  1ZI4 A;  3IOI A;  1JYL A;  1W55 A;  2OEG A;  1VPA A;  2D7R A;  2XWN A;  4FRQ A;  2V0J A;  1HJL A;  2JCK A;  5L6V A;  1MP4 A;  2V0H A;  2V0I A;  1H4C A;  2BO4 A;  1SS9 A;  2W0W A;  2JCL A;  2J0A A;  3PKQ A;  1H3M A;  2OI5 A;  1V83 A;  2APC A;  4FRM A;  3KIA A;  1NWG B;  1R7X A;  1IIM A;  2AEC A;  3F1Y A;  3QVB A;  4E1K A;  3OH4 A;  3U2W A;  1ZHJ A;  3GUE A;  1KWS A;  3K8E A;  4KT7 A;  5FTS A;  2PX7 A;  5D92 A;  1NF5 B;  1QGQ A;  3Q7U A;  1OMZ A;  2C0N A;  1JVG A;  1GQC A;  5DDV A;  4Y9X A;  1G97 A;  3CKO A;  4EE4 A;  3ZGF A;  3V0N A;  4CJC A;  1FRW A;  3OH2 A;  2BO6 A;  4FCU A;  2AM5 A;  4Y6U A;  2VXM A;  1TW5 A;  1YP2 A;  4IRP A;  3BCV A;  4ASJ A;  5IFY A;  3V8Z A;  5FYE A;  2Y4K A;  3JUJ A;  3I0L A;  3ZLK A;  1FG5 N;  4YS8 A;  4AYJ A;  3OAM A;  4EEG A;  2D7I A;  1QGS A;  3SXG A;  1R7U A;  2YES A;  1MC3 A;  1H7L A;  1ZIZ A;  4FRE A;  2QKX A;  1JV3 A;  2WVK A;  4FRD A;  2QGI A;  3O3P A;  1ZJ1 A;  4AC3 A;  4EVW A;  2YCM A;  1JYK A;  4CJB A;  3TQD A;  3R3I A;  4EE5 A;  1IIN A;  4XWI A;  1WT1 A;  4ARW A;  5C36 A;  1VIC A;  1ZDF A;  3OH1 A;  1VM8 A;  2JCJ A;  4HO2 A;  2RJ0 A;  4HO5 A;  2V0K A;  3IOJ A;  2X5S A;  1MP3 A;  3POL A;  1NMM B;  3F1C A;  1EZI A;  4G87 A;  3V8Y A;  4D11 C;  3E26 A;  3ST8 A;  5CQO A;  1VGZ A;  3SXE A;  2PGV A;  1GX4 A;  2RJ5 A;  4FRB A;  3ZLL A;  4HO3 A;  4HO4 A;  3U2X A;  2YC3 A;  5IDT A;  4CVH A;  1FO9 A;  2P6W A;  4JIS A;  1VH3 A;  1R80 A;  4L41 C;  3V0Q A;  1ZJ0 A;  1Z90 A;  4O6M A;  4D0T A;  3I0J A;  4HO0 A;  2PA4 A;  1TVY A;  1OQM B;  3OKR A;  1HV9 A;  2AES A;  1ZCV A;  3V90 A;  3T7O A;  4GBP A;  4Y7G A;  2Y4L A;  1VH1 A;  2FYC B;  4M28 A;  1H7G A;  1H4E A;  1XZ6 A;  4HOC A;  4B42 A;  2P72 A;  4ECM A;  5JQQ A;  3ZF8 A;  2RIT A;  3V0O A;  5J49 A;  4FIX A;  1LL3 A;  1H5S D;  4MYB A;  5CQL X;  2YQJ A;  4P02 A;  1O7O A;  2V0L A;  2BO7 A;  5C4D A;  4G3Q A;  2WAW A;  5C3B A;  2AE7 A;  1NKH B;  2WE9 A;  1ZCT A;  3OC9 A;  5EJ1 A;  3SXC A;  4FRL A;  1GQ9 A;  2MZB A;  2AGD A;  4Q7C A;  5AJN A;  1XHB A;  1FOA A;  2CU2 A;  1VZU A;  1G9R A;  3PKP A;  3FWW A;  4M4K A;  3V0P A;  1FO8 A;  4B4B A;  5BXC A;  5C48 A;  2RJ4 A;  1G2V A;  2VXL A;  2VD4 A;  3U2V A;  2O1F A;  1S4P A;  5DDT A;  4EEM A;  1H7E A;  4Y6N A;  1LL2 A;  2WEE A;  1VZT A;  3CU0 A;  1V84 A;  4B2W A;  5FV9 A;  3SXB A;  3I0G A;  1R81 A;  3U0Y A;  4MND A;  5CQM X;  2D0J A;  4KNX A;  5D91 A;  4D11 A;  4LW3 A;  1R7V A;  4Y64 A;  1TZF A;  3I0D A;  4B2X A;  1S4O A;  3CKQ A;  5C4B A;  2GGQ A;  2O1H A;  3BRK X;  1FWY A;  1H5S C;  2JCO A;  1H4D A;  1OMX A;  3OGZ A;  1ZI1 A;  2XMH A;  2WGZ A;  4B4M A;  1GA8 A;  4M2A A;  5FU0 A;  1FXO A;  2O1G A;  5EJZ A;  3USQ A;  4HG6 A;  3EE5 A;  2ICY A;  1I52 A;  2WVM A;  4KRV A;  2YQC A;  3U2U A;  5CQP A;  1ZDG A;  4FQW A;  4B5B A;  1LZ0 A;  5L6S A;  2YQS A;  3JTJ A;  4AAW A;  1VGU A;  1H5R A;  4B4G A;  1O7Q A;  2GGO A;  3I0K A;  2XME A;  5CMH A;  5HS2 A;  1ZJP A;  3I0H A;  4EEO A;  2J0B A;  1HM0 A;  1QWJ A;  2I5E A;  3FOQ A;  1YP3 A;  5AJO A;  2ZU9 A;  1FGG A;  1HM9 A;  4P00 A;  1WT2 A;  1H7F A;  3Q4S A;  2FYA A;  4EEA A;  4B3U A;  1H7Q A;  3R2W A;  1WSZ A;  2Y6P A;  3ZGG A;  2A8W A;  1G23 A;  1ZI3 A;  1JV1 A;  4BQH A;  4DDZ A;  1ZCY A;  3HL3 A;  2Q4J A;  4HO6 A;  4KNR A;  3SPT A;  3D98 A;  1FZW A;  3DJ4 A;  4ASY A;  2AM3 A;  1TW1 A;  3CKN A;  1YRO B;  1H5R B;  5C4E A;  3DK5 A;  3CGX A;  1ON8 A;  4Y62 A;  3JUK A;  2X5Z A;  4KXO A;  3RMV A;  4CJ8 A;  3SX8 A;  5C8R A;  3DUV A;  2RJ6 A;  4O6N A;  1FR8 A;  5C1L A;  4LW6 A;  2AH9 A;  4J18 A;  1PZT A;  3E25 A;  1H7T A;  3LW6 A;  2FFU A;  1R7T A;  1MP5 A;  3Q80 A;  5CMG X;  4JD0 A;  4NAK A;  1H5S A;  2E3D A;  2RJ1 A;  1WT0 A;  4KPZ A;  3TZT A;  5C47 A;  3SX3 A;  2X65 A;  5C4C A;  1NHE B;  1R7Y A;  5C3D A;  1R82 A;  1WT3 A;  3V0M A;  1H7H A;  1W77 A;  3USR A;  2I7B A;  4G3P A;  5FTV A;  1G1L A;  1GWV A;  1JVD A;  4KPX A;  3D8V A;  4HO8 A;  1G93 A;  2OI7 A;  2WVL A;  4Y7U A;  2FYB A;  3K8D A;  5I1F A;  4Y7V A;  2UX8 A;  2I5K A;  1VGT A;  3D5N A;  3I0F A;  4DE7 A;  4FRA A;  1H5S B;  4FRH A;  5AJP A;  1GWW A;  3T7M A;  1NQI B;  1FGX A;  2FY7 A;  5C1G A;  2ICX A;  2OI6 A;  2W0V A;  5CMJ A;  2NXV A;  2VS3 A;  3IOH A;  3SXD A;  2ZU7 A;  1H5T A;  1G3L A;  2VSI A;  4D48 A;  5C38 A;  2VSH A;  1LZ7 A;  2AM4 A;  1WVC A;  4NAL A;  1K4V A;  3RSB A;  5C49 A;  2RIZ A;  4FRP A;  3SXA A;  2XWM A;  5CMI A;  3I0C A;  2FYD B;  2Y7A A;  4FRO A;  1LZI A;  3PNN A;  1FXJ A;  2ZU8 A;  4K6R A;  1HJJ A;  1HM8 A;  3SX7 A;  2Z87 A;  5C4F A;  2XWL A;  1G0R A;  4MIX A;  3I0E A;  1G95 A;  1VGW A;  4Y63 A;  2A8U A;  2PGY A;  2YQH A;  3RMW A; 
#chains in the Genus database with same CATH homology
 2OEF A;  1H5T B;  2RIX A;  4HCQ A;  5C1H A;  1LZJ A;  1VZX A;  1LL0 A;  2FFV A;  1O0R A;  5IDS A;  4BMA A;  3OH3 A;  2P73 A;  1G8O A;  5C3A A;  3SX5 A;  4R7P A;  3U2T A;  1V82 A;  5CQN X;  1W57 A;  3T7N A;  1LVW A;  2QH5 A;  1FR9 A;  1ZJ3 A;  2Y4J A;  2Y4M A;  1EYR A;  1INJ A;  1ON6 A;  4KC4 A;  2YC5 A;  5FU8 A;  4FIY A;  3N9W A;  1QG8 A;  1INI A;  4Y7T A;  1YP4 A;  1ZJO A;  4FCE A;  3I0I X;  4DEC A;  4D0Z A;  4HO9 A;  3V91 A;  4ZDQ A;  2X60 A;  5FUH A;  1E5K A;  2RIY A;  4G3S A;  2VK9 A;  4M2B A;  1ZCU A;  3NGW A;  1PZY B;  4NAI A;  4AYL A;  2BO8 A;  3OH0 A;  1ZJ2 A;  3CKV A;  4UEG A;  1O23 B;  1ZI5 A;  4KC1 A;  1S4N A;  2Z86 A;  3V0L A;  4Y7F A;  5EIY A;  4IRQ A;  2RJ8 A;  2VFZ A;  2E8B A;  2VS5 A;  4EE3 A;  3U0X A;  4C2S A;  2RJ9 A;  1GX0 A;  2VS4 A;  4KQL A;  3CKJ A;  5CMF X;  4NAN A;  2DPW A;  2RJ7 A;  4KC2 A;  1ZI4 A;  3IOI A;  1JYL A;  1W55 A;  2OEG A;  1VPA A;  2D7R A;  2XWN A;  4FRQ A;  2V0J A;  1HJL A;  2JCK A;  5L6V A;  1MP4 A;  2V0H A;  2V0I A;  1H4C A;  2BO4 A;  1SS9 A;  2W0W A;  2JCL A;  2J0A A;  3PKQ A;  1H3M A;  2OI5 A;  1V83 A;  2APC A;  4FRM A;  3KIA A;  1NWG B;  1R7X A;  1IIM A;  2AEC A;  3F1Y A;  3QVB A;  4E1K A;  3OH4 A;  3U2W A;  1ZHJ A;  3GUE A;  1KWS A;  3K8E A;  4KT7 A;  5FTS A;  2PX7 A;  5D92 A;  1NF5 B;  1QGQ A;  3Q7U A;  1OMZ A;  2C0N A;  1JVG A;  1GQC A;  5DDV A;  4Y9X A;  1G97 A;  3CKO A;  4EE4 A;  3ZGF A;  3V0N A;  4CJC A;  1FRW A;  3OH2 A;  2BO6 A;  4FCU A;  2AM5 A;  4Y6U A;  2VXM A;  1TW5 A;  1YP2 A;  4IRP A;  3BCV A;  4ASJ A;  5IFY A;  3V8Z A;  5FYE A;  2Y4K A;  3JUJ A;  3I0L A;  3ZLK A;  1FG5 N;  4YS8 A;  4AYJ A;  3OAM A;  4EEG A;  2D7I A;  1QGS A;  3SXG A;  1R7U A;  2YES A;  1MC3 A;  1H7L A;  1ZIZ A;  4FRE A;  2QKX A;  1JV3 A;  2WVK A;  4FRD A;  2QGI A;  3O3P A;  1ZJ1 A;  4AC3 A;  4EVW A;  2YCM A;  1JYK A;  4CJB A;  3TQD A;  3R3I A;  4EE5 A;  1IIN A;  4XWI A;  1WT1 A;  4ARW A;  5C36 A;  1VIC A;  1ZDF A;  3OH1 A;  1VM8 A;  2JCJ A;  4HO2 A;  2RJ0 A;  4HO5 A;  2V0K A;  3IOJ A;  2X5S A;  1MP3 A;  3POL A;  1NMM B;  3F1C A;  1EZI A;  4G87 A;  3V8Y A;  4D11 C;  3E26 A;  3ST8 A;  5CQO A;  1VGZ A;  3SXE A;  2PGV A;  1GX4 A;  2RJ5 A;  4FRB A;  3ZLL A;  4HO3 A;  4HO4 A;  3U2X A;  2YC3 A;  5IDT A;  4CVH A;  1FO9 A;  2P6W A;  4JIS A;  1VH3 A;  1R80 A;  4L41 C;  3V0Q A;  1ZJ0 A;  1Z90 A;  4O6M A;  4D0T A;  3I0J A;  4HO0 A;  2PA4 A;  1TVY A;  1OQM B;  3OKR A;  1HV9 A;  2AES A;  1ZCV A;  3V90 A;  3T7O A;  4GBP A;  4Y7G A;  2Y4L A;  1VH1 A;  2FYC B;  4M28 A;  1H7G A;  1H4E A;  1XZ6 A;  4HOC A;  4B42 A;  2P72 A;  4ECM A;  5JQQ A;  3ZF8 A;  2RIT A;  3V0O A;  5J49 A;  4FIX A;  1LL3 A;  1H5S D;  4MYB A;  5CQL X;  2YQJ A;  4P02 A;  1O7O A;  2V0L A;  2BO7 A;  5C4D A;  4G3Q A;  2WAW A;  5C3B A;  2AE7 A;  1NKH B;  2WE9 A;  1ZCT A;  3OC9 A;  5EJ1 A;  3SXC A;  4FRL A;  1GQ9 A;  2MZB A;  2AGD A;  4Q7C A;  5AJN A;  1XHB A;  1FOA A;  2CU2 A;  1VZU A;  1G9R A;  3PKP A;  3FWW A;  4M4K A;  3V0P A;  1FO8 A;  4B4B A;  5BXC A;  5C48 A;  2RJ4 A;  1G2V A;  2VXL A;  2VD4 A;  3U2V A;  2O1F A;  1S4P A;  5DDT A;  4EEM A;  1H7E A;  4Y6N A;  1LL2 A;  2WEE A;  1VZT A;  3CU0 A;  1V84 A;  4B2W A;  5FV9 A;  3SXB A;  3I0G A;  1R81 A;  3U0Y A;  4MND A;  5CQM X;  2D0J A;  4KNX A;  5D91 A;  4D11 A;  4LW3 A;  1R7V A;  4Y64 A;  1TZF A;  3I0D A;  4B2X A;  1S4O A;  3CKQ A;  5C4B A;  2GGQ A;  2O1H A;  3BRK X;  1FWY A;  1H5S C;  2JCO A;  1H4D A;  1OMX A;  3OGZ A;  1ZI1 A;  2XMH A;  2WGZ A;  4B4M A;  1GA8 A;  4M2A A;  5FU0 A;  1FXO A;  2O1G A;  5EJZ A;  3USQ A;  4HG6 A;  3EE5 A;  2ICY A;  1I52 A;  2WVM A;  4KRV A;  2YQC A;  3U2U A;  5CQP A;  1ZDG A;  4FQW A;  4B5B A;  1LZ0 A;  5L6S A;  2YQS A;  3JTJ A;  4AAW A;  1VGU A;  1H5R A;  4B4G A;  1O7Q A;  2GGO A;  3I0K A;  2XME A;  5CMH A;  5HS2 A;  1ZJP A;  3I0H A;  4EEO A;  2J0B A;  1HM0 A;  1QWJ A;  2I5E A;  3FOQ A;  1YP3 A;  5AJO A;  2ZU9 A;  1FGG A;  1HM9 A;  4P00 A;  1WT2 A;  1H7F A;  3Q4S A;  2FYA A;  4EEA A;  4B3U A;  1H7Q A;  3R2W A;  1WSZ A;  2Y6P A;  3ZGG A;  2A8W A;  1G23 A;  1ZI3 A;  1JV1 A;  4BQH A;  4DDZ A;  1ZCY A;  3HL3 A;  2Q4J A;  4HO6 A;  4KNR A;  3SPT A;  3D98 A;  1FZW A;  3DJ4 A;  4ASY A;  2AM3 A;  1TW1 A;  3CKN A;  1YRO B;  1H5R B;  5C4E A;  3DK5 A;  3CGX A;  1ON8 A;  4Y62 A;  3JUK A;  2X5Z A;  4KXO A;  3RMV A;  4CJ8 A;  3SX8 A;  5C8R A;  3DUV A;  2RJ6 A;  4O6N A;  1FR8 A;  5C1L A;  4LW6 A;  2AH9 A;  4J18 A;  1PZT A;  3E25 A;  1H7T A;  3LW6 A;  2FFU A;  1R7T A;  1MP5 A;  3Q80 A;  5CMG X;  4JD0 A;  4NAK A;  1H5S A;  2E3D A;  2RJ1 A;  1WT0 A;  4KPZ A;  3TZT A;  5C47 A;  3SX3 A;  2X65 A;  5C4C A;  1NHE B;  1R7Y A;  5C3D A;  1R82 A;  1WT3 A;  3V0M A;  1H7H A;  1W77 A;  3USR A;  2I7B A;  4G3P A;  5FTV A;  1G1L A;  1GWV A;  1JVD A;  4KPX A;  3D8V A;  4HO8 A;  1G93 A;  2OI7 A;  2WVL A;  4Y7U A;  2FYB A;  3K8D A;  5I1F A;  4Y7V A;  2UX8 A;  2I5K A;  1VGT A;  3D5N A;  3I0F A;  4DE7 A;  4FRA A;  1H5S B;  4FRH A;  5AJP A;  1GWW A;  3T7M A;  1NQI B;  1FGX A;  2FY7 A;  5C1G A;  2ICX A;  2OI6 A;  2W0V A;  5CMJ A;  2NXV A;  2VS3 A;  3IOH A;  3SXD A;  2ZU7 A;  1H5T A;  1G3L A;  2VSI A;  4D48 A;  5C38 A;  2VSH A;  1LZ7 A;  2AM4 A;  1WVC A;  4NAL A;  1K4V A;  3RSB A;  5C49 A;  2RIZ A;  4FRP A;  3SXA A;  2XWM A;  5CMI A;  3I0C A;  2FYD B;  2Y7A A;  4FRO A;  1LZI A;  3PNN A;  1FXJ A;  2ZU8 A;  4K6R A;  1HJJ A;  1HM8 A;  3SX7 A;  2Z87 A;  5C4F A;  2XWL A;  1G0R A;  4MIX A;  3I0E A;  1G95 A;  1VGW A;  4Y63 A;  2A8U A;  2PGY A;  2YQH A;  3RMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...