5C38A

Crystal structure of aabb + udp-c-gal + di
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
277
Chain Sequence
EFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAMRRMEMISFCERFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 277
sequence length 287
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c38A00
5CMIA 3I0DA 2PX7A 1ZI5A 5C4DA 1H5TA 3SXBA 1IIMA 1H7LA 3PNNA 1H7FA 2RJ7A 4DDZA 1G2VA 3DK5A 4FROA 2PGYA 1G93A 3SX7A 3ZF8A 4ASJA 3CU0A 1XHBA 1QGQA 4IRPA 5FU8A 1HM8A 3ZGFA 1G1LA 1WSZA 3I0GA 4EEMA 1R7YA 1GX0A 1I52A 5C48A 4R7PA 2X60A 3SX3A 3ZLKA 2AGDA 4FRMA 5CQNX 1SS9A 2AM4A 4BQHA 1WVCA 1G8OA 2O1FA 1JYLA 2VS5A 4KQLA 4HG6A 4KC2A 2YQSA 1ZI4A 3OKRA 2MZBA 4EE3A 1GX4A 2ZU8A 4YS8A 2E8BA 4AYLA 5FV9A 4AAWA 3F1YA 2GGQA 2WVMA 2XWNA 1VGWA 3O3PA 1NMMB 2WVLA 1PZTA 3PKPA 1K4VA 3RMWA 1H5SC 1H5SA 2Y7AA 1ZDGA 2XWLA 2FYCB 1O23B 1GWWA 2RJ9A 4M4KA 3GUEA 4ARWA 2VS4A 2P73A 1LL2A 5C8RA 3USQA 1ZJOA 3SPTA 2V0HA 5C4CA 4Y6NA 3D5NA 2VSIA 3LW6A 1FGGA 1ZDFA 3CKQA 4HO5A 3T7OA 4HO8A 2OEFA 2OEGA 1ZCTA 2YQHA 3U2WA 2WEEA 3BRKX 2FFVA 2Y4MA 4HO4A 2DPWA 2X5SA 3U2XA 4ECMA 3I0IX 5CMGX 5AJNA 3OC9A 4BMAA 1FXJA 1INJA 4LW3A 1NKHB 4Y63A 2VS3A 2I5KA 4NAKA 1MP4A 2Q4JA 1LVWA 1FR8A 3DUVA 4DE7A 1VH1A 2RJ1A 1VH3A 2E3DA 3K8DA 3U2UA 2RITA 1FRWA 2YESA 4B4GA 1H7HA 2Y4KA 3ST8A 1LZJA 1H4CA 3NGWA 2YC5A 4KT7A 5C4EA 3KIAA 1ZJPA 2V0JA 3U2VA 2RJ0A 5CQOA 2Y6PA 3SXDA 2VXMA 4DECA 3N9WA 1O7OA 4KPZA 1O0RA 3SXAA 1YROB 3V90A 1WT3A 2D7IA 2Y4LA 3OH3A 1R7XA 3SXGA 3SXCA 1FO8A 3BCVA 4FCEA 2JCLA 4G3PA 5FTVA 4B3UA 1H7GA 1INIA 1G0RA 4G3SA 1VZTA 5J49A 1WT1A 3T7NA 2PGVA 1YP3A 5EJZA 5BXCA 1V82A 2FYAA 4HCQA 2RIXA 1FR9A 5L6SA 1VZXA 3D8VA 2W0VA 4Y7VA 1H5RB 4M28A 4CJCA 1VPAA 3V0OA 5JQQA 2XWMA 2ICYA 3U0XA 3F1CA 1ZI1A 2RJ4A 4Y9XA 2AM5A 1G23A 5CQMX 1HJJA 3JUKA 1NHEB 1W57A 1O7QA 3QVBA 4B2WA 2V0IA 2QGIA 5C36A 3FOQA 3FWWA 2CU2A 4P00A 2RJ8A 2VD4A 1VZUA 4FREA 1R81A 2FYDB 3POLA 1QG8A 3HL3A 4B42A 5C49A 4FQWA 1TZFA 3I0CA 3E25A 4Y7TA 5C1LA 3TZTA 1ZCVA 1W77A 3SX8A 4CJ8A 3Q7UA 3D98A 2YQCA 4FRDA 5C1GA 1WT0A 4NANA 2VFZA 3I0JA 3R3IA 3CGXA 4AC3A 1VGUA 4FRPA 3OH0A 5EIYA 2X5ZA 5L6VA 3IOHA 4P02A 1LZIA 2OI5A 2YCMA 4KNXA 5CMFX 1G97A 1V84A 5I1FA 5FU0A 1OMZA 2PA4A 4HO0A 4D11A 4EEOA 2AH9A 2XMHA 4Y62A 1G3LA 4FRLA 2AECA 1G95A 2WE9A 1JVGA 2I5EA 3V8ZA 1H3MA 3JUJA 1GWVA 4UEGA 2RIZA 1NQIB 1E5KA 1H5SB 1GQCA 1JVDA 4NAIA 2RIYA 5CMJA 4FRAA 4IRQA 1HJLA 4CJBA 3R2WA 3I0FA 1OQMB 1ZJ2A 2AM3A 1H4EA 2Z87A 2QH5A 1MP5A 4FRHA 3ZLLA 1ON6A 3V91A 2ZU9A 4KPXA 5FYEA 4D0ZA 1S4NA 3IOIA 3T7MA 4HO6A 3CKNA 1FO9A 1R80A 1YP4A 2BO8A 4FCUA 5DDTA 1R82A 3DJ4A 1W55A 1ZI3A 1FOAA 2UX8A 4LW6A 3V0MA 2FYBA 1NF5B 3I0LA 4B2XA 2JCKA 3OAMA 1H4DA 2P6WA 3V0LA 2X65A 1NWGB 3I0KA 1FZWA 1QGSA 4KXOA 5FTSA 1KWSA 2WGZA 4ASYA 1TVYA 1LZ0A 5C1HA 3E26A 1IINA 1VGZA 3EE5A 4MYBA 5C47A 1JV1A 1H5RA 3V0NA 5AJOA 4FRBA 4XWIA 3OH2A 1H7QA 4EEGA 2V0KA 3K8EA 4Y6UA 5CQLX 3CKVA 1EYRA 1TW1A 1S4PA 3OH4A 1HM9A 2RJ5A 4HO2A 2O1GA 4CVHA 3SX5A 1G9RA 3RSBA 2VSHA 1H5TB 5IDSA 5IFYA 1S4OA 4HO3A 1JYKA 1GQ9A 4B4BA 3JTJA 2XMEA 4Y64A 4EE5A 1LL0A 4M2AA 1LL3A 1XZ6A 1HM0A 3RMVA 5C3AA 1ZJ1A 5AJPA 2WVKA 1H7TA 2V0LA 4FRQA 2JCOA 1R7UA 3Q80A 5C3BA 1VM8A 2GGOA 4B5BA 4B4MA 3I0HA 2WAWA 2YQJA 1ZCYA 1QWJA 2I7BA 3V0PA 2VXLA 1FWYA 3OH1A 5C4BA 1GA8A 1MC3A 3CKOA 1R7TA 5C3DA 2AESA 2BO4A 4MNDA 3I0EA 2OI7A 4Y7UA 3V0QA 4EEAA 4Y7GA 1ZIZA 2Y4JA 1ON8A 2D7RA 4JISA 4D11C 1FG5N 3U0YA 3PKQA 2A8WA 4ZDQA 1OMXA 2P72A 2O1HA 5EJ1A 3TQDA 4E1KA 2ZU7A 3SXEA 1EZIA 4NALA 1VICA 2JCJA 4KC4A 4AYJA 2RJ6A 1FXOA 1MP3A 4K6RA 2AE7A 4KC1A 5CMHA 2W0WA 2NXVA 1YP2A 1FGXA 2ICXA 1Z90A 5C4FA 1ZJ0A 3V8YA 4KNRA 2QKXA 4D48A 2YC3A 1PZYB 1ZJ3A 1H5SD 4HOCA 1ZHJA 3ZGGA 1TW5A 2FY7A 1HV9A 1V83A 2APCA 4JD0A 4M2BA 3IOJA 3USRA 3Q4SA 3U2TA 4EE4A 5DDVA 2FFUA 2OI6A 4D0TA 4L41C 5CQPA 4EVWA 2BO6A 1VGTA 4G3QA 1ZCUA 2BO7A 2D0JA 3OGZA 5FUHA 5HS2A 1H7EA 1R7VA 2Z86A 3CKJA 1WT2A 4C2SA 5IDTA 4J18A 4HO9A 4KRVA 4Y7FA 1JV3A 5C38A 2A8UA 4G87A 4GBPA 1LZ7A
chains in the Genus database with same CATH superfamily
5CMIA 3I0DA 2PX7A 1ZI5A 5C4DA 1H5TA 3SXBA 1IIMA 1H7LA 3PNNA 1H7FA 2RJ7A 4DDZA 1G2VA 3DK5A 4FROA 2PGYA 1G93A 3SX7A 3ZF8A 4ASJA 3CU0A 1XHBA 1QGQA 4IRPA 5FU8A 1HM8A 3ZGFA 1G1LA 1WSZA 3I0GA 4EEMA 1R7YA 1GX0A 1I52A 5C48A 4R7PA 2X60A 3SX3A 3ZLKA 2AGDA 4FRMA 5CQNX 1SS9A 2AM4A 4BQHA 1WVCA 1G8OA 2O1FA 1JYLA 2VS5A 4KQLA 4HG6A 4KC2A 2YQSA 1ZI4A 3OKRA 2MZBA 4EE3A 1GX4A 2ZU8A 4YS8A 2E8BA 4AYLA 5FV9A 4AAWA 3F1YA 2GGQA 2WVMA 2XWNA 1VGWA 3O3PA 1NMMB 2WVLA 1PZTA 3PKPA 1K4VA 3RMWA 1H5SC 1H5SA 2Y7AA 1ZDGA 2XWLA 2FYCB 1O23B 1GWWA 2RJ9A 4M4KA 3GUEA 4ARWA 2VS4A 2P73A 1LL2A 5C8RA 3USQA 1ZJOA 3SPTA 2V0HA 5C4CA 4Y6NA 3D5NA 2VSIA 3LW6A 1FGGA 1ZDFA 3CKQA 4HO5A 3T7OA 4HO8A 2OEFA 2OEGA 1ZCTA 2YQHA 3U2WA 2WEEA 3BRKX 2FFVA 2Y4MA 4HO4A 2DPWA 2X5SA 3U2XA 4ECMA 3I0IX 5CMGX 5AJNA 4O6MA 3OC9A 4BMAA 1FXJA 1INJA 4LW3A 4Q7CA 1NKHB 4Y63A 2VS3A 2I5KA 4NAKA 1MP4A 2Q4JA 1LVWA 1FR8A 3DUVA 4DE7A 1VH1A 2RJ1A 1VH3A 2E3DA 3K8DA 3U2UA 2RITA 1FRWA 2YESA 4B4GA 1H7HA 2Y4KA 3ST8A 1LZJA 1H4CA 3NGWA 2YC5A 4KT7A 5C4EA 3KIAA 1ZJPA 2V0JA 3U2VA 2RJ0A 5CQOA 2Y6PA 3SXDA 2VXMA 4DECA 3N9WA 1O7OA 4KPZA 1O0RA 3SXAA 1YROB 3V90A 1WT3A 2J0AA 2D7IA 2Y4LA 3OH3A 1R7XA 3SXGA 3SXCA 1FO8A 3BCVA 4FCEA 2J0BA 2JCLA 4G3PA 5FTVA 4B3UA 1H7GA 1INIA 1G0RA 4G3SA 1VZTA 5J49A 1WT1A 3T7NA 2PGVA 1YP3A 5EJZA 5BXCA 1V82A 2FYAA 4HCQA 2RIXA 1FR9A 5L6SA 1VZXA 3D8VA 2W0VA 4Y7VA 1H5RB 4M28A 4CJCA 1VPAA 3V0OA 5JQQA 2XWMA 2ICYA 3U0XA 3F1CA 1ZI1A 2RJ4A 4Y9XA 2AM5A 1G23A 5CQMX 5D92A 1HJJA 3JUKA 1NHEB 1W57A 1O7QA 3QVBA 4B2WA 2V0IA 2QGIA 5C36A 3FOQA 3FWWA 2CU2A 4P00A 2RJ8A 2VD4A 1VZUA 4FREA 1R81A 2FYDB 3POLA 1QG8A 3HL3A 4B42A 5C49A 4FQWA 1TZFA 3I0CA 3E25A 4Y7TA 5C1LA 3TZTA 1ZCVA 1W77A 3SX8A 4CJ8A 3Q7UA 3D98A 2YQCA 4FRDA 5C1GA 1WT0A 4NANA 2VFZA 3I0JA 3R3IA 3CGXA 4AC3A 1VGUA 4FRPA 4MIXA 3OH0A 5EIYA 2X5ZA 5L6VA 3IOHA 4P02A 1LZIA 2OI5A 2YCMA 4KNXA 5CMFX 1G97A 1V84A 5I1FA 5FU0A 1OMZA 2PA4A 4HO0A 4D11A 4EEOA 2AH9A 2XMHA 4Y62A 1G3LA 4FRLA 2AECA 1G95A 2WE9A 1JVGA 2I5EA 3V8ZA 1H3MA 3JUJA 1GWVA 4UEGA 2RIZA 1NQIB 1E5KA 1H5SB 1GQCA 1JVDA 4NAIA 2RIYA 5CMJA 4FRAA 4IRQA 1HJLA 4CJBA 3R2WA 3I0FA 1OQMB 1ZJ2A 2AM3A 2VK9A 1H4EA 2Z87A 2QH5A 1MP5A 4FRHA 3ZLLA 1ON6A 3V91A 2ZU9A 4KPXA 5FYEA 4D0ZA 1S4NA 3IOIA 3T7MA 4HO6A 3CKNA 1FO9A 1R80A 1YP4A 2BO8A 4FCUA 5DDTA 1R82A 3DJ4A 1W55A 1ZI3A 1FOAA 2UX8A 4LW6A 4FIYA 3V0MA 2FYBA 1NF5B 3I0LA 4B2XA 2JCKA 3OAMA 1H4DA 2P6WA 3V0LA 2X65A 2C0NA 1NWGB 3I0KA 1FZWA 1QGSA 4KXOA 5FTSA 1KWSA 2WGZA 4ASYA 1TVYA 1LZ0A 5C1HA 3E26A 1IINA 1VGZA 3EE5A 4MYBA 5C47A 1JV1A 1H5RA 3V0NA 5AJOA 4FRBA 4XWIA 3OH2A 1H7QA 4EEGA 2V0KA 3K8EA 4Y6UA 5CQLX 3CKVA 1EYRA 1TW1A 1S4PA 3OH4A 1HM9A 2RJ5A 4HO2A 2O1GA 4CVHA 3SX5A 1G9RA 3RSBA 2VSHA 1H5TB 5IDSA 5IFYA 1S4OA 4HO3A 1JYKA 1GQ9A 4B4BA 3JTJA 2XMEA 4Y64A 4EE5A 1LL0A 4M2AA 1LL3A 1XZ6A 1HM0A 3RMVA 5C3AA 1ZJ1A 5AJPA 2WVKA 1H7TA 2V0LA 4FRQA 2JCOA 1R7UA 3Q80A 5C3BA 1VM8A 2GGOA 4B5BA 4B4MA 3I0HA 2WAWA 2YQJA 1ZCYA 1QWJA 2I7BA 3V0PA 2VXLA 1FWYA 3OH1A 5C4BA 1GA8A 1MC3A 3CKOA 1R7TA 5C3DA 2AESA 2BO4A 4MNDA 3I0EA 2OI7A 4Y7UA 3V0QA 4EEAA 4Y7GA 1ZIZA 2Y4JA 1ON8A 2D7RA 4JISA 4D11C 5D91A 1FG5N 3U0YA 3PKQA 2A8WA 4ZDQA 1OMXA 2P72A 2O1HA 5EJ1A 3TQDA 4E1KA 2ZU7A 3SXEA 1EZIA 4NALA 1VICA 2JCJA 4KC4A 4AYJA 2RJ6A 1FXOA 1MP3A 4K6RA 2AE7A 4KC1A 5CMHA 2W0WA 2NXVA 1YP2A 1FGXA 2ICXA 1Z90A 5C4FA 1ZJ0A 3V8YA 4KNRA 2QKXA 4D48A 2YC3A 1PZYB 1ZJ3A 1H5SD 4HOCA 1ZHJA 3ZGGA 1TW5A 2FY7A 1HV9A 1V83A 2APCA 4JD0A 4M2BA 3IOJA 3USRA 3Q4SA 3U2TA 4EE4A 5DDVA 2FFUA 2OI6A 4D0TA 4L41C 5CQPA 4EVWA 2BO6A 1VGTA 4G3QA 1ZCUA 2BO7A 2D0JA 3OGZA 5FUHA 5HS2A 1H7EA 1R7VA 2Z86A 3CKJA 1WT2A 4FIXA 4C2SA 5IDTA 4J18A 4HO9A 4KRVA 4Y7FA 1JV3A 5C38A 2A8UA 4G87A 4GBPA 1LZ7A 4O6NA
chains in the Genus database with same CATH topology
5CMIA 3I0DA 2PX7A 1ZI5A 5C4DA 1H5TA 3SXBA 1IIMA 1H7LA 3PNNA 1H7FA 2RJ7A 4DDZA 1G2VA 3DK5A 4FROA 2PGYA 1G93A 3SX7A 3ZF8A 4ASJA 3CU0A 1XHBA 1QGQA 4IRPA 5FU8A 1HM8A 3ZGFA 1G1LA 1WSZA 3I0GA 4EEMA 1R7YA 1GX0A 1I52A 5C48A 4R7PA 2X60A 3SX3A 3ZLKA 2AGDA 4FRMA 5CQNX 1SS9A 2AM4A 4BQHA 1WVCA 1G8OA 2O1FA 1JYLA 2VS5A 4KQLA 4HG6A 4KC2A 2YQSA 1ZI4A 3OKRA 2MZBA 4EE3A 1GX4A 2ZU8A 4YS8A 2E8BA 4AYLA 5FV9A 4AAWA 3F1YA 2GGQA 2WVMA 2XWNA 1VGWA 3O3PA 1NMMB 2WVLA 1PZTA 3PKPA 1K4VA 3RMWA 1H5SC 1H5SA 2Y7AA 1ZDGA 2XWLA 2FYCB 1O23B 1GWWA 2RJ9A 4M4KA 3GUEA 4ARWA 2VS4A 2P73A 1LL2A 5C8RA 3USQA 1ZJOA 3SPTA 2V0HA 5C4CA 4Y6NA 3D5NA 2VSIA 3LW6A 1FGGA 1ZDFA 3CKQA 4HO5A 3T7OA 4HO8A 2OEFA 2OEGA 1ZCTA 2YQHA 3U2WA 2WEEA 3BRKX 2FFVA 2Y4MA 4HO4A 2DPWA 2X5SA 3U2XA 4ECMA 3I0IX 5CMGX 5AJNA 4O6MA 3OC9A 4BMAA 1FXJA 1INJA 4LW3A 4Q7CA 1NKHB 4Y63A 2VS3A 2I5KA 4NAKA 1MP4A 2Q4JA 1LVWA 1FR8A 3DUVA 4DE7A 1VH1A 2RJ1A 1VH3A 2E3DA 3K8DA 3U2UA 2RITA 1FRWA 2YESA 4B4GA 1H7HA 2Y4KA 3ST8A 1LZJA 1H4CA 3NGWA 2YC5A 4KT7A 5C4EA 3KIAA 1ZJPA 2V0JA 3U2VA 2RJ0A 5CQOA 2Y6PA 3SXDA 2VXMA 4DECA 3N9WA 1O7OA 4KPZA 1O0RA 3SXAA 1YROB 3V90A 1WT3A 2J0AA 2D7IA 2Y4LA 3OH3A 1R7XA 3SXGA 3SXCA 1FO8A 3BCVA 4FCEA 2J0BA 2JCLA 4G3PA 5FTVA 4B3UA 1H7GA 1INIA 1G0RA 4G3SA 1VZTA 5J49A 1WT1A 3T7NA 2PGVA 1YP3A 5EJZA 5BXCA 1V82A 2FYAA 4HCQA 2RIXA 1FR9A 5L6SA 1VZXA 3D8VA 2W0VA 4Y7VA 1H5RB 4M28A 4CJCA 1VPAA 3V0OA 5JQQA 2XWMA 2ICYA 3U0XA 3F1CA 1ZI1A 2RJ4A 4Y9XA 2AM5A 1G23A 5CQMX 5D92A 1HJJA 3JUKA 1NHEB 1W57A 1O7QA 3QVBA 4B2WA 2V0IA 2QGIA 5C36A 3FOQA 3FWWA 2CU2A 4P00A 2RJ8A 2VD4A 1VZUA 4FREA 1R81A 2FYDB 3POLA 1QG8A 3HL3A 4B42A 5C49A 4FQWA 1TZFA 3I0CA 3E25A 4Y7TA 5C1LA 3TZTA 1ZCVA 1W77A 3SX8A 4CJ8A 3Q7UA 3D98A 2YQCA 4FRDA 5C1GA 1WT0A 4NANA 2VFZA 3I0JA 3R3IA 3CGXA 4AC3A 1VGUA 4FRPA 4MIXA 3OH0A 5EIYA 2X5ZA 5L6VA 3IOHA 4P02A 1LZIA 2OI5A 2YCMA 4KNXA 5CMFX 1G97A 1V84A 5I1FA 5FU0A 1OMZA 2PA4A 4HO0A 4D11A 4EEOA 2AH9A 2XMHA 4Y62A 1G3LA 4FRLA 2AECA 1G95A 2WE9A 1JVGA 2I5EA 3V8ZA 1H3MA 3JUJA 1GWVA 4UEGA 2RIZA 1NQIB 1E5KA 1H5SB 1GQCA 1JVDA 4NAIA 2RIYA 5CMJA 4FRAA 4IRQA 1HJLA 4CJBA 3R2WA 3I0FA 1OQMB 1ZJ2A 2AM3A 2VK9A 1H4EA 2Z87A 2QH5A 1MP5A 4FRHA 3ZLLA 1ON6A 3V91A 2ZU9A 4KPXA 5FYEA 4D0ZA 1S4NA 3IOIA 3T7MA 4HO6A 3CKNA 1FO9A 1R80A 1YP4A 2BO8A 4FCUA 5DDTA 1R82A 3DJ4A 1W55A 1ZI3A 1FOAA 2UX8A 4LW6A 4FIYA 3V0MA 2FYBA 1NF5B 3I0LA 4B2XA 2JCKA 3OAMA 1H4DA 2P6WA 3V0LA 2X65A 2C0NA 1NWGB 3I0KA 1FZWA 1QGSA 4KXOA 5FTSA 1KWSA 2WGZA 4ASYA 1TVYA 1LZ0A 5C1HA 3E26A 1IINA 1VGZA 3EE5A 4MYBA 5C47A 1JV1A 1H5RA 3V0NA 5AJOA 4FRBA 4XWIA 3OH2A 1H7QA 4EEGA 2V0KA 3K8EA 4Y6UA 5CQLX 3CKVA 1EYRA 1TW1A 1S4PA 3OH4A 1HM9A 2RJ5A 4HO2A 2O1GA 4CVHA 3SX5A 1G9RA 3RSBA 2VSHA 1H5TB 5IDSA 5IFYA 1S4OA 4HO3A 1JYKA 1GQ9A 4B4BA 3JTJA 2XMEA 4Y64A 4EE5A 1LL0A 4M2AA 1LL3A 1XZ6A 1HM0A 3RMVA 5C3AA 1ZJ1A 5AJPA 2WVKA 1H7TA 2V0LA 4FRQA 2JCOA 1R7UA 3Q80A 5C3BA 1VM8A 2GGOA 4B5BA 4B4MA 3I0HA 2WAWA 2YQJA 1ZCYA 1QWJA 2I7BA 3V0PA 2VXLA 1FWYA 3OH1A 5C4BA 1GA8A 1MC3A 3CKOA 1R7TA 5C3DA 2AESA 2BO4A 4MNDA 3I0EA 2OI7A 4Y7UA 3V0QA 4EEAA 4Y7GA 1ZIZA 2Y4JA 1ON8A 2D7RA 4JISA 4D11C 5D91A 1FG5N 3U0YA 3PKQA 2A8WA 4ZDQA 1OMXA 2P72A 2O1HA 5EJ1A 3TQDA 4E1KA 2ZU7A 3SXEA 1EZIA 4NALA 1VICA 2JCJA 4KC4A 4AYJA 2RJ6A 1FXOA 1MP3A 4K6RA 2AE7A 4KC1A 5CMHA 2W0WA 2NXVA 1YP2A 1FGXA 2ICXA 1Z90A 5C4FA 1ZJ0A 3V8YA 4KNRA 2QKXA 4D48A 2YC3A 1PZYB 1ZJ3A 1H5SD 4HOCA 1ZHJA 3ZGGA 1TW5A 2FY7A 1HV9A 1V83A 2APCA 4JD0A 4M2BA 3IOJA 3USRA 3Q4SA 3U2TA 4EE4A 5DDVA 2FFUA 2OI6A 4D0TA 4L41C 5CQPA 4EVWA 2BO6A 1VGTA 4G3QA 1ZCUA 2BO7A 2D0JA 3OGZA 5FUHA 5HS2A 1H7EA 1R7VA 2Z86A 3CKJA 1WT2A 4FIXA 4C2SA 5IDTA 4J18A 4HO9A 4KRVA 4Y7FA 1JV3A 5C38A 2A8UA 4G87A 4GBPA 1LZ7A 4O6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMI A;  3I0D A;  2PX7 A;  1ZI5 A;  5C4D A;  1H5T A;  3SXB A;  1IIM A;  1H7L A;  3PNN A;  1H7F A;  2RJ7 A;  4DDZ A;  1G2V A;  3DK5 A;  4FRO A;  2PGY A;  1G93 A;  3SX7 A;  3ZF8 A;  4ASJ A;  3CU0 A;  1XHB A;  1QGQ A;  4IRP A;  5FU8 A;  1HM8 A;  3ZGF A;  1G1L A;  1WSZ A;  3I0G A;  4EEM A;  1R7Y A;  1GX0 A;  1I52 A;  5C48 A;  4R7P A;  2X60 A;  3SX3 A;  3ZLK A;  2AGD A;  4FRM A;  5CQN X;  1SS9 A;  2AM4 A;  4BQH A;  1WVC A;  1G8O A;  2O1F A;  1JYL A;  2VS5 A;  4KQL A;  4HG6 A;  4KC2 A;  2YQS A;  1ZI4 A;  3OKR A;  2MZB A;  4EE3 A;  1GX4 A;  2ZU8 A;  4YS8 A;  2E8B A;  4AYL A;  5FV9 A;  4AAW A;  3F1Y A;  2GGQ A;  2WVM A;  2XWN A;  1VGW A;  3O3P A;  1NMM B;  2WVL A;  1PZT A;  3PKP A;  1K4V A;  3RMW A;  1H5S C;  1H5S A;  2Y7A A;  1ZDG A;  2XWL A;  2FYC B;  1O23 B;  1GWW A;  2RJ9 A;  4M4K A;  3GUE A;  4ARW A;  2VS4 A;  2P73 A;  1LL2 A;  5C8R A;  3USQ A;  1ZJO A;  3SPT A;  2V0H A;  5C4C A;  4Y6N A;  3D5N A;  2VSI A;  3LW6 A;  1FGG A;  1ZDF A;  3CKQ A;  4HO5 A;  3T7O A;  4HO8 A;  2OEF A;  2OEG A;  1ZCT A;  2YQH A;  3U2W A;  2WEE A;  3BRK X;  2FFV A;  2Y4M A;  4HO4 A;  2DPW A;  2X5S A;  3U2X A;  4ECM A;  3I0I X;  5CMG X;  5AJN A;  3OC9 A;  4BMA A;  1FXJ A;  1INJ A;  4LW3 A;  1NKH B;  4Y63 A;  2VS3 A;  2I5K A;  4NAK A;  1MP4 A;  2Q4J A;  1LVW A;  1FR8 A;  3DUV A;  4DE7 A;  1VH1 A;  2RJ1 A;  1VH3 A;  2E3D A;  3K8D A;  3U2U A;  2RIT A;  1FRW A;  2YES A;  4B4G A;  1H7H A;  2Y4K A;  3ST8 A;  1LZJ A;  1H4C A;  3NGW A;  2YC5 A;  4KT7 A;  5C4E A;  3KIA A;  1ZJP A;  2V0J A;  3U2V A;  2RJ0 A;  5CQO A;  2Y6P A;  3SXD A;  2VXM A;  4DEC A;  3N9W A;  1O7O A;  4KPZ A;  1O0R A;  3SXA A;  1YRO B;  3V90 A;  1WT3 A;  2D7I A;  2Y4L A;  3OH3 A;  1R7X A;  3SXG A;  3SXC A;  1FO8 A;  3BCV A;  4FCE A;  2JCL A;  4G3P A;  5FTV A;  4B3U A;  1H7G A;  1INI A;  1G0R A;  4G3S A;  1VZT A;  5J49 A;  1WT1 A;  3T7N A;  2PGV A;  1YP3 A;  5EJZ A;  5BXC A;  1V82 A;  2FYA A;  4HCQ A;  2RIX A;  1FR9 A;  5L6S A;  1VZX A;  3D8V A;  2W0V A;  4Y7V A;  1H5R B;  4M28 A;  4CJC A;  1VPA A;  3V0O A;  5JQQ A;  2XWM A;  2ICY A;  3U0X A;  3F1C A;  1ZI1 A;  2RJ4 A;  4Y9X A;  2AM5 A;  1G23 A;  5CQM X;  1HJJ A;  3JUK A;  1NHE B;  1W57 A;  1O7Q A;  3QVB A;  4B2W A;  2V0I A;  2QGI A;  5C36 A;  3FOQ A;  3FWW A;  2CU2 A;  4P00 A;  2RJ8 A;  2VD4 A;  1VZU A;  4FRE A;  1R81 A;  2FYD B;  3POL A;  1QG8 A;  3HL3 A;  4B42 A;  5C49 A;  4FQW A;  1TZF A;  3I0C A;  3E25 A;  4Y7T A;  5C1L A;  3TZT A;  1ZCV A;  1W77 A;  3SX8 A;  4CJ8 A;  3Q7U A;  3D98 A;  2YQC A;  4FRD A;  5C1G A;  1WT0 A;  4NAN A;  2VFZ A;  3I0J A;  3R3I A;  3CGX A;  4AC3 A;  1VGU A;  4FRP A;  3OH0 A;  5EIY A;  2X5Z A;  5L6V A;  3IOH A;  4P02 A;  1LZI A;  2OI5 A;  2YCM A;  4KNX A;  5CMF X;  1G97 A;  1V84 A;  5I1F A;  5FU0 A;  1OMZ A;  2PA4 A;  4HO0 A;  4D11 A;  4EEO A;  2AH9 A;  2XMH A;  4Y62 A;  1G3L A;  4FRL A;  2AEC A;  1G95 A;  2WE9 A;  1JVG A;  2I5E A;  3V8Z A;  1H3M A;  3JUJ A;  1GWV A;  4UEG A;  2RIZ A;  1NQI B;  1E5K A;  1H5S B;  1GQC A;  1JVD A;  4NAI A;  2RIY A;  5CMJ A;  4FRA A;  4IRQ A;  1HJL A;  4CJB A;  3R2W A;  3I0F A;  1OQM B;  1ZJ2 A;  2AM3 A;  1H4E A;  2Z87 A;  2QH5 A;  1MP5 A;  4FRH A;  3ZLL A;  1ON6 A;  3V91 A;  2ZU9 A;  4KPX A;  5FYE A;  4D0Z A;  1S4N A;  3IOI A;  3T7M A;  4HO6 A;  3CKN A;  1FO9 A;  1R80 A;  1YP4 A;  2BO8 A;  4FCU A;  5DDT A;  1R82 A;  3DJ4 A;  1W55 A;  1ZI3 A;  1FOA A;  2UX8 A;  4LW6 A;  3V0M A;  2FYB A;  1NF5 B;  3I0L A;  4B2X A;  2JCK A;  3OAM A;  1H4D A;  2P6W A;  3V0L A;  2X65 A;  1NWG B;  3I0K A;  1FZW A;  1QGS A;  4KXO A;  5FTS A;  1KWS A;  2WGZ A;  4ASY A;  1TVY A;  1LZ0 A;  5C1H A;  3E26 A;  1IIN A;  1VGZ A;  3EE5 A;  4MYB A;  5C47 A;  1JV1 A;  1H5R A;  3V0N A;  5AJO A;  4FRB A;  4XWI A;  3OH2 A;  1H7Q A;  4EEG A;  2V0K A;  3K8E A;  4Y6U A;  5CQL X;  3CKV A;  1EYR A;  1TW1 A;  1S4P A;  3OH4 A;  1HM9 A;  2RJ5 A;  4HO2 A;  2O1G A;  4CVH A;  3SX5 A;  1G9R A;  3RSB A;  2VSH A;  1H5T B;  5IDS A;  5IFY A;  1S4O A;  4HO3 A;  1JYK A;  1GQ9 A;  4B4B A;  3JTJ A;  2XME A;  4Y64 A;  4EE5 A;  1LL0 A;  4M2A A;  1LL3 A;  1XZ6 A;  1HM0 A;  3RMV A;  5C3A A;  1ZJ1 A;  5AJP A;  2WVK A;  1H7T A;  2V0L A;  4FRQ A;  2JCO A;  1R7U A;  3Q80 A;  5C3B A;  1VM8 A;  2GGO A;  4B5B A;  4B4M A;  3I0H A;  2WAW A;  2YQJ A;  1ZCY A;  1QWJ A;  2I7B A;  3V0P A;  2VXL A;  1FWY A;  3OH1 A;  5C4B A;  1GA8 A;  1MC3 A;  3CKO A;  1R7T A;  5C3D A;  2AES A;  2BO4 A;  4MND A;  3I0E A;  2OI7 A;  4Y7U A;  3V0Q A;  4EEA A;  4Y7G A;  1ZIZ A;  2Y4J A;  1ON8 A;  2D7R A;  4JIS A;  4D11 C;  1FG5 N;  3U0Y A;  3PKQ A;  2A8W A;  4ZDQ A;  1OMX A;  2P72 A;  2O1H A;  5EJ1 A;  3TQD A;  4E1K A;  2ZU7 A;  3SXE A;  1EZI A;  4NAL A;  1VIC A;  2JCJ A;  4KC4 A;  4AYJ A;  2RJ6 A;  1FXO A;  1MP3 A;  4K6R A;  2AE7 A;  4KC1 A;  5CMH A;  2W0W A;  2NXV A;  1YP2 A;  1FGX A;  2ICX A;  1Z90 A;  5C4F A;  1ZJ0 A;  3V8Y A;  4KNR A;  2QKX A;  4D48 A;  2YC3 A;  1PZY B;  1ZJ3 A;  1H5S D;  4HOC A;  1ZHJ A;  3ZGG A;  1TW5 A;  2FY7 A;  1HV9 A;  1V83 A;  2APC A;  4JD0 A;  4M2B A;  3IOJ A;  3USR A;  3Q4S A;  3U2T A;  4EE4 A;  5DDV A;  2FFU A;  2OI6 A;  4D0T A;  4L41 C;  5CQP A;  4EVW A;  2BO6 A;  1VGT A;  4G3Q A;  1ZCU A;  2BO7 A;  2D0J A;  3OGZ A;  5FUH A;  5HS2 A;  1H7E A;  1R7V A;  2Z86 A;  3CKJ A;  1WT2 A;  4C2S A;  5IDT A;  4J18 A;  4HO9 A;  4KRV A;  4Y7F A;  1JV3 A;  5C38 A;  2A8U A;  4G87 A;  4GBP A;  1LZ7 A; 
#chains in the Genus database with same CATH topology
 5CMI A;  3I0D A;  2PX7 A;  1ZI5 A;  5C4D A;  1H5T A;  3SXB A;  1IIM A;  1H7L A;  3PNN A;  1H7F A;  2RJ7 A;  4DDZ A;  1G2V A;  3DK5 A;  4FRO A;  2PGY A;  1G93 A;  3SX7 A;  3ZF8 A;  4ASJ A;  3CU0 A;  1XHB A;  1QGQ A;  4IRP A;  5FU8 A;  1HM8 A;  3ZGF A;  1G1L A;  1WSZ A;  3I0G A;  4EEM A;  1R7Y A;  1GX0 A;  1I52 A;  5C48 A;  4R7P A;  2X60 A;  3SX3 A;  3ZLK A;  2AGD A;  4FRM A;  5CQN X;  1SS9 A;  2AM4 A;  4BQH A;  1WVC A;  1G8O A;  2O1F A;  1JYL A;  2VS5 A;  4KQL A;  4HG6 A;  4KC2 A;  2YQS A;  1ZI4 A;  3OKR A;  2MZB A;  4EE3 A;  1GX4 A;  2ZU8 A;  4YS8 A;  2E8B A;  4AYL A;  5FV9 A;  4AAW A;  3F1Y A;  2GGQ A;  2WVM A;  2XWN A;  1VGW A;  3O3P A;  1NMM B;  2WVL A;  1PZT A;  3PKP A;  1K4V A;  3RMW A;  1H5S C;  1H5S A;  2Y7A A;  1ZDG A;  2XWL A;  2FYC B;  1O23 B;  1GWW A;  2RJ9 A;  4M4K A;  3GUE A;  4ARW A;  2VS4 A;  2P73 A;  1LL2 A;  5C8R A;  3USQ A;  1ZJO A;  3SPT A;  2V0H A;  5C4C A;  4Y6N A;  3D5N A;  2VSI A;  3LW6 A;  1FGG A;  1ZDF A;  3CKQ A;  4HO5 A;  3T7O A;  4HO8 A;  2OEF A;  2OEG A;  1ZCT A;  2YQH A;  3U2W A;  2WEE A;  3BRK X;  2FFV A;  2Y4M A;  4HO4 A;  2DPW A;  2X5S A;  3U2X A;  4ECM A;  3I0I X;  5CMG X;  5AJN A;  4O6M A;  3OC9 A;  4BMA A;  1FXJ A;  1INJ A;  4LW3 A;  4Q7C A;  1NKH B;  4Y63 A;  2VS3 A;  2I5K A;  4NAK A;  1MP4 A;  2Q4J A;  1LVW A;  1FR8 A;  3DUV A;  4DE7 A;  1VH1 A;  2RJ1 A;  1VH3 A;  2E3D A;  3K8D A;  3U2U A;  2RIT A;  1FRW A;  2YES A;  4B4G A;  1H7H A;  2Y4K A;  3ST8 A;  1LZJ A;  1H4C A;  3NGW A;  2YC5 A;  4KT7 A;  5C4E A;  3KIA A;  1ZJP A;  2V0J A;  3U2V A;  2RJ0 A;  5CQO A;  2Y6P A;  3SXD A;  2VXM A;  4DEC A;  3N9W A;  1O7O A;  4KPZ A;  1O0R A;  3SXA A;  1YRO B;  3V90 A;  1WT3 A;  2J0A A;  2D7I A;  2Y4L A;  3OH3 A;  1R7X A;  3SXG A;  3SXC A;  1FO8 A;  3BCV A;  4FCE A;  2J0B A;  2JCL A;  4G3P A;  5FTV A;  4B3U A;  1H7G A;  1INI A;  1G0R A;  4G3S A;  1VZT A;  5J49 A;  1WT1 A;  3T7N A;  2PGV A;  1YP3 A;  5EJZ A;  5BXC A;  1V82 A;  2FYA A;  4HCQ A;  2RIX A;  1FR9 A;  5L6S A;  1VZX A;  3D8V A;  2W0V A;  4Y7V A;  1H5R B;  4M28 A;  4CJC A;  1VPA A;  3V0O A;  5JQQ A;  2XWM A;  2ICY A;  3U0X A;  3F1C A;  1ZI1 A;  2RJ4 A;  4Y9X A;  2AM5 A;  1G23 A;  5CQM X;  5D92 A;  1HJJ A;  3JUK A;  1NHE B;  1W57 A;  1O7Q A;  3QVB A;  4B2W A;  2V0I A;  2QGI A;  5C36 A;  3FOQ A;  3FWW A;  2CU2 A;  4P00 A;  2RJ8 A;  2VD4 A;  1VZU A;  4FRE A;  1R81 A;  2FYD B;  3POL A;  1QG8 A;  3HL3 A;  4B42 A;  5C49 A;  4FQW A;  1TZF A;  3I0C A;  3E25 A;  4Y7T A;  5C1L A;  3TZT A;  1ZCV A;  1W77 A;  3SX8 A;  4CJ8 A;  3Q7U A;  3D98 A;  2YQC A;  4FRD A;  5C1G A;  1WT0 A;  4NAN A;  2VFZ A;  3I0J A;  3R3I A;  3CGX A;  4AC3 A;  1VGU A;  4FRP A;  4MIX A;  3OH0 A;  5EIY A;  2X5Z A;  5L6V A;  3IOH A;  4P02 A;  1LZI A;  2OI5 A;  2YCM A;  4KNX A;  5CMF X;  1G97 A;  1V84 A;  5I1F A;  5FU0 A;  1OMZ A;  2PA4 A;  4HO0 A;  4D11 A;  4EEO A;  2AH9 A;  2XMH A;  4Y62 A;  1G3L A;  4FRL A;  2AEC A;  1G95 A;  2WE9 A;  1JVG A;  2I5E A;  3V8Z A;  1H3M A;  3JUJ A;  1GWV A;  4UEG A;  2RIZ A;  1NQI B;  1E5K A;  1H5S B;  1GQC A;  1JVD A;  4NAI A;  2RIY A;  5CMJ A;  4FRA A;  4IRQ A;  1HJL A;  4CJB A;  3R2W A;  3I0F A;  1OQM B;  1ZJ2 A;  2AM3 A;  2VK9 A;  1H4E A;  2Z87 A;  2QH5 A;  1MP5 A;  4FRH A;  3ZLL A;  1ON6 A;  3V91 A;  2ZU9 A;  4KPX A;  5FYE A;  4D0Z A;  1S4N A;  3IOI A;  3T7M A;  4HO6 A;  3CKN A;  1FO9 A;  1R80 A;  1YP4 A;  2BO8 A;  4FCU A;  5DDT A;  1R82 A;  3DJ4 A;  1W55 A;  1ZI3 A;  1FOA A;  2UX8 A;  4LW6 A;  4FIY A;  3V0M A;  2FYB A;  1NF5 B;  3I0L A;  4B2X A;  2JCK A;  3OAM A;  1H4D A;  2P6W A;  3V0L A;  2X65 A;  2C0N A;  1NWG B;  3I0K A;  1FZW A;  1QGS A;  4KXO A;  5FTS A;  1KWS A;  2WGZ A;  4ASY A;  1TVY A;  1LZ0 A;  5C1H A;  3E26 A;  1IIN A;  1VGZ A;  3EE5 A;  4MYB A;  5C47 A;  1JV1 A;  1H5R A;  3V0N A;  5AJO A;  4FRB A;  4XWI A;  3OH2 A;  1H7Q A;  4EEG A;  2V0K A;  3K8E A;  4Y6U A;  5CQL X;  3CKV A;  1EYR A;  1TW1 A;  1S4P A;  3OH4 A;  1HM9 A;  2RJ5 A;  4HO2 A;  2O1G A;  4CVH A;  3SX5 A;  1G9R A;  3RSB A;  2VSH A;  1H5T B;  5IDS A;  5IFY A;  1S4O A;  4HO3 A;  1JYK A;  1GQ9 A;  4B4B A;  3JTJ A;  2XME A;  4Y64 A;  4EE5 A;  1LL0 A;  4M2A A;  1LL3 A;  1XZ6 A;  1HM0 A;  3RMV A;  5C3A A;  1ZJ1 A;  5AJP A;  2WVK A;  1H7T A;  2V0L A;  4FRQ A;  2JCO A;  1R7U A;  3Q80 A;  5C3B A;  1VM8 A;  2GGO A;  4B5B A;  4B4M A;  3I0H A;  2WAW A;  2YQJ A;  1ZCY A;  1QWJ A;  2I7B A;  3V0P A;  2VXL A;  1FWY A;  3OH1 A;  5C4B A;  1GA8 A;  1MC3 A;  3CKO A;  1R7T A;  5C3D A;  2AES A;  2BO4 A;  4MND A;  3I0E A;  2OI7 A;  4Y7U A;  3V0Q A;  4EEA A;  4Y7G A;  1ZIZ A;  2Y4J A;  1ON8 A;  2D7R A;  4JIS A;  4D11 C;  5D91 A;  1FG5 N;  3U0Y A;  3PKQ A;  2A8W A;  4ZDQ A;  1OMX A;  2P72 A;  2O1H A;  5EJ1 A;  3TQD A;  4E1K A;  2ZU7 A;  3SXE A;  1EZI A;  4NAL A;  1VIC A;  2JCJ A;  4KC4 A;  4AYJ A;  2RJ6 A;  1FXO A;  1MP3 A;  4K6R A;  2AE7 A;  4KC1 A;  5CMH A;  2W0W A;  2NXV A;  1YP2 A;  1FGX A;  2ICX A;  1Z90 A;  5C4F A;  1ZJ0 A;  3V8Y A;  4KNR A;  2QKX A;  4D48 A;  2YC3 A;  1PZY B;  1ZJ3 A;  1H5S D;  4HOC A;  1ZHJ A;  3ZGG A;  1TW5 A;  2FY7 A;  1HV9 A;  1V83 A;  2APC A;  4JD0 A;  4M2B A;  3IOJ A;  3USR A;  3Q4S A;  3U2T A;  4EE4 A;  5DDV A;  2FFU A;  2OI6 A;  4D0T A;  4L41 C;  5CQP A;  4EVW A;  2BO6 A;  1VGT A;  4G3Q A;  1ZCU A;  2BO7 A;  2D0J A;  3OGZ A;  5FUH A;  5HS2 A;  1H7E A;  1R7V A;  2Z86 A;  3CKJ A;  1WT2 A;  4FIX A;  4C2S A;  5IDT A;  4J18 A;  4HO9 A;  4KRV A;  4Y7F A;  1JV3 A;  5C38 A;  2A8U A;  4G87 A;  4GBP A;  1LZ7 A;  4O6N A; 
#chains in the Genus database with same CATH homology
 5CMI A;  3I0D A;  2PX7 A;  1ZI5 A;  5C4D A;  1H5T A;  3SXB A;  1IIM A;  1H7L A;  3PNN A;  1H7F A;  2RJ7 A;  4DDZ A;  1G2V A;  3DK5 A;  4FRO A;  2PGY A;  1G93 A;  3SX7 A;  3ZF8 A;  4ASJ A;  3CU0 A;  1XHB A;  1QGQ A;  4IRP A;  5FU8 A;  1HM8 A;  3ZGF A;  1G1L A;  1WSZ A;  3I0G A;  4EEM A;  1R7Y A;  1GX0 A;  1I52 A;  5C48 A;  4R7P A;  2X60 A;  3SX3 A;  3ZLK A;  2AGD A;  4FRM A;  5CQN X;  1SS9 A;  2AM4 A;  4BQH A;  1WVC A;  1G8O A;  2O1F A;  1JYL A;  2VS5 A;  4KQL A;  4HG6 A;  4KC2 A;  2YQS A;  1ZI4 A;  3OKR A;  2MZB A;  4EE3 A;  1GX4 A;  2ZU8 A;  4YS8 A;  2E8B A;  4AYL A;  5FV9 A;  4AAW A;  3F1Y A;  2GGQ A;  2WVM A;  2XWN A;  1VGW A;  3O3P A;  1NMM B;  2WVL A;  1PZT A;  3PKP A;  1K4V A;  3RMW A;  1H5S C;  1H5S A;  2Y7A A;  1ZDG A;  2XWL A;  2FYC B;  1O23 B;  1GWW A;  2RJ9 A;  4M4K A;  3GUE A;  4ARW A;  2VS4 A;  2P73 A;  1LL2 A;  5C8R A;  3USQ A;  1ZJO A;  3SPT A;  2V0H A;  5C4C A;  4Y6N A;  3D5N A;  2VSI A;  3LW6 A;  1FGG A;  1ZDF A;  3CKQ A;  4HO5 A;  3T7O A;  4HO8 A;  2OEF A;  2OEG A;  1ZCT A;  2YQH A;  3U2W A;  2WEE A;  3BRK X;  2FFV A;  2Y4M A;  4HO4 A;  2DPW A;  2X5S A;  3U2X A;  4ECM A;  3I0I X;  5CMG X;  5AJN A;  4O6M A;  3OC9 A;  4BMA A;  1FXJ A;  1INJ A;  4LW3 A;  4Q7C A;  1NKH B;  4Y63 A;  2VS3 A;  2I5K A;  4NAK A;  1MP4 A;  2Q4J A;  1LVW A;  1FR8 A;  3DUV A;  4DE7 A;  1VH1 A;  2RJ1 A;  1VH3 A;  2E3D A;  3K8D A;  3U2U A;  2RIT A;  1FRW A;  2YES A;  4B4G A;  1H7H A;  2Y4K A;  3ST8 A;  1LZJ A;  1H4C A;  3NGW A;  2YC5 A;  4KT7 A;  5C4E A;  3KIA A;  1ZJP A;  2V0J A;  3U2V A;  2RJ0 A;  5CQO A;  2Y6P A;  3SXD A;  2VXM A;  4DEC A;  3N9W A;  1O7O A;  4KPZ A;  1O0R A;  3SXA A;  1YRO B;  3V90 A;  1WT3 A;  2J0A A;  2D7I A;  2Y4L A;  3OH3 A;  1R7X A;  3SXG A;  3SXC A;  1FO8 A;  3BCV A;  4FCE A;  2J0B A;  2JCL A;  4G3P A;  5FTV A;  4B3U A;  1H7G A;  1INI A;  1G0R A;  4G3S A;  1VZT A;  5J49 A;  1WT1 A;  3T7N A;  2PGV A;  1YP3 A;  5EJZ A;  5BXC A;  1V82 A;  2FYA A;  4HCQ A;  2RIX A;  1FR9 A;  5L6S A;  1VZX A;  3D8V A;  2W0V A;  4Y7V A;  1H5R B;  4M28 A;  4CJC A;  1VPA A;  3V0O A;  5JQQ A;  2XWM A;  2ICY A;  3U0X A;  3F1C A;  1ZI1 A;  2RJ4 A;  4Y9X A;  2AM5 A;  1G23 A;  5CQM X;  5D92 A;  1HJJ A;  3JUK A;  1NHE B;  1W57 A;  1O7Q A;  3QVB A;  4B2W A;  2V0I A;  2QGI A;  5C36 A;  3FOQ A;  3FWW A;  2CU2 A;  4P00 A;  2RJ8 A;  2VD4 A;  1VZU A;  4FRE A;  1R81 A;  2FYD B;  3POL A;  1QG8 A;  3HL3 A;  4B42 A;  5C49 A;  4FQW A;  1TZF A;  3I0C A;  3E25 A;  4Y7T A;  5C1L A;  3TZT A;  1ZCV A;  1W77 A;  3SX8 A;  4CJ8 A;  3Q7U A;  3D98 A;  2YQC A;  4FRD A;  5C1G A;  1WT0 A;  4NAN A;  2VFZ A;  3I0J A;  3R3I A;  3CGX A;  4AC3 A;  1VGU A;  4FRP A;  4MIX A;  3OH0 A;  5EIY A;  2X5Z A;  5L6V A;  3IOH A;  4P02 A;  1LZI A;  2OI5 A;  2YCM A;  4KNX A;  5CMF X;  1G97 A;  1V84 A;  5I1F A;  5FU0 A;  1OMZ A;  2PA4 A;  4HO0 A;  4D11 A;  4EEO A;  2AH9 A;  2XMH A;  4Y62 A;  1G3L A;  4FRL A;  2AEC A;  1G95 A;  2WE9 A;  1JVG A;  2I5E A;  3V8Z A;  1H3M A;  3JUJ A;  1GWV A;  4UEG A;  2RIZ A;  1NQI B;  1E5K A;  1H5S B;  1GQC A;  1JVD A;  4NAI A;  2RIY A;  5CMJ A;  4FRA A;  4IRQ A;  1HJL A;  4CJB A;  3R2W A;  3I0F A;  1OQM B;  1ZJ2 A;  2AM3 A;  2VK9 A;  1H4E A;  2Z87 A;  2QH5 A;  1MP5 A;  4FRH A;  3ZLL A;  1ON6 A;  3V91 A;  2ZU9 A;  4KPX A;  5FYE A;  4D0Z A;  1S4N A;  3IOI A;  3T7M A;  4HO6 A;  3CKN A;  1FO9 A;  1R80 A;  1YP4 A;  2BO8 A;  4FCU A;  5DDT A;  1R82 A;  3DJ4 A;  1W55 A;  1ZI3 A;  1FOA A;  2UX8 A;  4LW6 A;  4FIY A;  3V0M A;  2FYB A;  1NF5 B;  3I0L A;  4B2X A;  2JCK A;  3OAM A;  1H4D A;  2P6W A;  3V0L A;  2X65 A;  2C0N A;  1NWG B;  3I0K A;  1FZW A;  1QGS A;  4KXO A;  5FTS A;  1KWS A;  2WGZ A;  4ASY A;  1TVY A;  1LZ0 A;  5C1H A;  3E26 A;  1IIN A;  1VGZ A;  3EE5 A;  4MYB A;  5C47 A;  1JV1 A;  1H5R A;  3V0N A;  5AJO A;  4FRB A;  4XWI A;  3OH2 A;  1H7Q A;  4EEG A;  2V0K A;  3K8E A;  4Y6U A;  5CQL X;  3CKV A;  1EYR A;  1TW1 A;  1S4P A;  3OH4 A;  1HM9 A;  2RJ5 A;  4HO2 A;  2O1G A;  4CVH A;  3SX5 A;  1G9R A;  3RSB A;  2VSH A;  1H5T B;  5IDS A;  5IFY A;  1S4O A;  4HO3 A;  1JYK A;  1GQ9 A;  4B4B A;  3JTJ A;  2XME A;  4Y64 A;  4EE5 A;  1LL0 A;  4M2A A;  1LL3 A;  1XZ6 A;  1HM0 A;  3RMV A;  5C3A A;  1ZJ1 A;  5AJP A;  2WVK A;  1H7T A;  2V0L A;  4FRQ A;  2JCO A;  1R7U A;  3Q80 A;  5C3B A;  1VM8 A;  2GGO A;  4B5B A;  4B4M A;  3I0H A;  2WAW A;  2YQJ A;  1ZCY A;  1QWJ A;  2I7B A;  3V0P A;  2VXL A;  1FWY A;  3OH1 A;  5C4B A;  1GA8 A;  1MC3 A;  3CKO A;  1R7T A;  5C3D A;  2AES A;  2BO4 A;  4MND A;  3I0E A;  2OI7 A;  4Y7U A;  3V0Q A;  4EEA A;  4Y7G A;  1ZIZ A;  2Y4J A;  1ON8 A;  2D7R A;  4JIS A;  4D11 C;  5D91 A;  1FG5 N;  3U0Y A;  3PKQ A;  2A8W A;  4ZDQ A;  1OMX A;  2P72 A;  2O1H A;  5EJ1 A;  3TQD A;  4E1K A;  2ZU7 A;  3SXE A;  1EZI A;  4NAL A;  1VIC A;  2JCJ A;  4KC4 A;  4AYJ A;  2RJ6 A;  1FXO A;  1MP3 A;  4K6R A;  2AE7 A;  4KC1 A;  5CMH A;  2W0W A;  2NXV A;  1YP2 A;  1FGX A;  2ICX A;  1Z90 A;  5C4F A;  1ZJ0 A;  3V8Y A;  4KNR A;  2QKX A;  4D48 A;  2YC3 A;  1PZY B;  1ZJ3 A;  1H5S D;  4HOC A;  1ZHJ A;  3ZGG A;  1TW5 A;  2FY7 A;  1HV9 A;  1V83 A;  2APC A;  4JD0 A;  4M2B A;  3IOJ A;  3USR A;  3Q4S A;  3U2T A;  4EE4 A;  5DDV A;  2FFU A;  2OI6 A;  4D0T A;  4L41 C;  5CQP A;  4EVW A;  2BO6 A;  1VGT A;  4G3Q A;  1ZCU A;  2BO7 A;  2D0J A;  3OGZ A;  5FUH A;  5HS2 A;  1H7E A;  1R7V A;  2Z86 A;  3CKJ A;  1WT2 A;  4FIX A;  4C2S A;  5IDT A;  4J18 A;  4HO9 A;  4KRV A;  4Y7F A;  1JV3 A;  5C38 A;  2A8U A;  4G87 A;  4GBP A;  1LZ7 A;  4O6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...