5C38A

Crystal structure of aabb + udp-c-gal + di
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
277
Chain Sequence
EFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAMRRMEMISFCERFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 277
sequence length 287
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c38A00
3OH0A 3E25A 2E8BA 3U2UA 4ASJA 4FRPA 2AH9A 1S4PA 4KPXA 4UEGA 2VS4A 4Y6NA 5C1HA 3ZF8A 1WSZA 1MP4A 3R2WA 4Y6UA 4NAKA 1S4NA 2VXMA 4M2AA 3V91A 4M2BA 3U2WA 5L6SA 5FYEA 1SS9A 1MP3A 2FY7A 5L6VA 1V83A 2ICXA 2RJ7A 1H5SB 3U0XA 5DDVA 1NKHB 4KC4A 1QGQA 2OI7A 5FTVA 4FCUA 1R82A 1NQIB 4E1KA 3DJ4A 4KC2A 2WVMA 1FR9A 3I0FA 1GWWA 3F1CA 1NHEB 1H5TB 2XMEA 2XWNA 1LZJA 3CKOA 4EE5A 2AGDA 3POLA 2D7IA 4FREA 3ZGFA 1H4CA 1R7YA 1H7GA 4FRBA 3JUKA 2PGVA 1YP3A 4Y62A 1H5SD 2RIZA 4Y9XA 4HO3A 4BQHA 1EYRA 1ZCYA 1YP2A 4B2XA 2A8WA 4FCEA 1VGTA 3EE5A 3OH1A 1VGWA 5CQOA 4P00A 3SXEA 2Y4MA 2P72A 1O7QA 4HG6A 4B4MA 1LL2A 5AJPA 1R7VA 4KC1A 4EVWA 3N9WA 2VFZA 3GUEA 3V0MA 2OEFA 3I0DA 3Q4SA 4KXOA 3PKPA 2JCLA 3SXCA 2W0WA 1XZ6A 4HO8A 5C48A 1WT2A 3V0OA 5EJZA 4AC3A 1FGXA 4AAWA 5C3DA 4AYLA 1QWJA 1G1LA 1GX4A 1VH1A 1VGUA 4D48A 2RJ1A 1R7XA 1VICA 2Y6PA 5C4CA 2RJ4A 1S4OA 2RIXA 3OH3A 1H5SA 4KRVA 2Y4JA 3K8EA 4EE3A 4JISA 3V0LA 4Y7VA 3NGWA 1FXOA 3R3IA 1HJJA 1H7HA 2YQSA 3TQDA 1JV1A 3CKQA 5C8RA 4B4BA 3T7MA 1MP5A 3JTJA 4DDZA 4AYJA 2FFUA 4FRAA 5FU0A 3T7OA 1TW1A 2X5ZA 4KNXA 1ZJ3A 3USRA 2JCKA 1ZDFA 2DPWA 3Q7UA 5AJOA 5C4DA 1H5TA 2NXVA 1MC3A 2Y4LA 4M28A 4R7PA 5HS2A 1ZI5A 1QGSA 2ICYA 4Y7FA 2FYBA 5C1GA 5C4EA 3U2XA 1TZFA 2AM3A 1LZIA 2BO6A 5FV9A 1FOAA 1LL3A 2YESA 1YP4A 2VS5A 5CMFX 1I52A 1PZTA 4Y63A 5JQQA 3Q80A 4ZDQA 3ZLLA 5FU8A 4NAIA 3SX5A 1ZJOA 2E3DA 1H5RB 3OH2A 4G3QA 4CJBA 2BO7A 1HM8A 2P73A 1FRWA 2OEGA 2O1HA 2W0VA 2Z87A 3U0YA 1VH3A 1TVYA 3F1YA 1G3LA 1PZYB 1IINA 2FYCB 3U2TA 2X5SA 4D11A 3I0EA 1ZJ1A 2YCMA 1W57A 3SXAA 2X60A 1W77A 4FRHA 2FFVA 1VM8A 3SX8A 5IFYA 1HM0A 3I0IX 3SXBA 1ZCTA 2OI6A 3D5NA 2MZBA 4M4KA 2YQHA 4Y7TA 1Z90A 1ZDGA 2YC3A 3OAMA 1LZ7A 2I7BA 4CJ8A 2JCOA 1INJA 2WVLA 1TW5A 2YC5A 2BO4A 5CMIA 1JVGA 1O23B 3PNNA 1ZI1A 5CMHA 4XWIA 4C2SA 1IIMA 2V0HA 1R81A 3IOJA 1INIA 4YS8A 3LW6A 3CGXA 2PGYA 4JD0A 3O3PA 3PKQA 3V0QA 1R80A 3SX3A 3SXDA 1ZJPA 1QG8A 1V82A 4CJCA 4IRPA 2PA4A 1VZTA 2RIYA 4BMAA 2JCJA 4ECMA 5C49A 5IDSA 5FUHA 4HO5A 2Y4KA 5DDTA 5C3AA 1VPAA 1G2VA 1FGGA 3BCVA 3I0HA 2A8UA 4FRMA 4FRDA 5AJNA 4ASYA 1H4DA 5C47A 1O0RA 1G93A 1JVDA 3SX7A 4ARWA 4EE4A 1ON8A 1H5RA 1H7TA 4FQWA 5CQPA 5J49A 1JYLA 1OMXA 3DUVA 1G95A 2CU2A 2AM5A 2YQCA 1G9RA 2WGZA 3T7NA 5CQMX 1GWVA 3TZTA 2BO8A 3CKVA 1H7QA 1JYKA 2ZU7A 5BXCA 1G23A 3CKNA 3DK5A 2Y7AA 1EZIA 3I0CA 4J18A 4G87A 1H5SC 1VZUA 1V84A 2P6WA 3OGZA 1HJLA 4EEOA 2D7RA 2RJ8A 3RMVA 1R7UA 2O1FA 1H7FA 1YROB 3ZGGA 2VXLA 5C36A 4B3UA 2V0JA 1GA8A 1G0RA 1KWSA 1O7OA 3OKRA 3V0NA 1W55A 4Y7GA 4HO9A 4D0ZA 3D98A 1GQ9A 2V0KA 2PX7A 2RITA 1JV3A 1NMMB 1K4VA 1LL0A 1HV9A 2Z86A 1E5KA 1WT3A 4G3SA 1WT1A 5C4FA 2QGIA 2AESA 2WE9A 3OH4A 1ZHJA 4L41C 1FO9A 3ST8A 3I0GA 2VD4A 4K6RA 2VSIA 4D0TA 2FYAA 1OMZA 2AM4A 1ON6A 3ZLKA 4HOCA 4HO4A 4LW6A 2D0JA 2XMHA 3E26A 1WVCA 3OC9A 1ZCVA 4EEAA 1H7EA 4Y7UA 5EIYA 1G97A 4Y64A 5FTSA 2V0LA 1H7LA 1HM9A 4KQLA 3SPTA 4CVHA 3JUJA 2UX8A 4KT7A 3I0JA 4B2WA 2APCA 2GGQA 1ZI3A 5C1LA 4D11C 3SXGA 4P02A 4KNRA 4HO6A 4B42A 1WT0A 4FRLA 1OQMB 3IOHA 3FWWA 2O1GA 1LVWA 3I0LA 3QVBA 1VZXA 4HO0A 4LW3A 2VS3A 4MNDA 2I5EA 2ZU9A 4FROA 3V8YA 2WEEA 4HO2A 1NWGB 4NANA 4DECA 1H3MA 3K8DA 2ZU8A 3KIAA 5C4BA 4FRQA 1ZI4A 4B4GA 2AECA 2WAWA 2VSHA 2XWLA 1NF5B 4DE7A 1ZIZA 3USQA 4EEGA 1FR8A 2Q4JA 2GGOA 2I5KA 2AE7A 3V0PA 5EJ1A 2V0IA 3CKJA 1GQCA 4EEMA 1G8OA 5I1FA 2XWMA 3BRKX 3RMWA 1VGZA 3RSBA 4HCQA 1GX0A 1FO8A 2QH5A 2X65A 2RJ0A 2OI5A 4G3PA 1XHBA 1ZCUA 5CMJA 3FOQA 5IDTA 1FG5N 2FYDB 3IOIA 3U2VA 5C3BA 5CQLX 3V8ZA 3D8VA 4KPZA 1ZJ0A 3V90A 4NALA 3I0KA 5C38A 4B5BA 1H4EA 1ZJ2A 2RJ5A 3CU0A 1R7TA 2RJ9A 4GBPA 4MYBA 4IRQA 5CQNX 1LZ0A 1FWYA 2RJ6A 2QKXA 5CMGX 1FXJA 2WVKA 1FZWA 3HL3A 2YQJA
chains in the Genus database with same CATH superfamily
3OH0A 3E25A 2E8BA 3U2UA 4ASJA 4FRPA 2AH9A 1S4PA 4KPXA 4UEGA 2VS4A 4Y6NA 5C1HA 3ZF8A 1WSZA 1MP4A 3R2WA 4Y6UA 4NAKA 1S4NA 2VXMA 4M2AA 3V91A 4M2BA 3U2WA 5L6SA 5FYEA 1SS9A 4FIYA 1MP3A 2FY7A 5L6VA 1V83A 2ICXA 2RJ7A 1H5SB 3U0XA 5DDVA 1NKHB 4KC4A 1QGQA 2OI7A 5FTVA 4FCUA 1R82A 1NQIB 4E1KA 3DJ4A 4KC2A 2WVMA 1FR9A 3I0FA 1GWWA 3F1CA 1NHEB 5D92A 1H5TB 2XMEA 2XWNA 1LZJA 3CKOA 4EE5A 2AGDA 3POLA 2D7IA 4FREA 3ZGFA 1H4CA 1R7YA 1H7GA 4FRBA 3JUKA 2PGVA 1YP3A 4Y62A 1H5SD 2RIZA 4Y9XA 4HO3A 4BQHA 1EYRA 1ZCYA 1YP2A 2J0AA 4B2XA 2A8WA 4FCEA 1VGTA 3EE5A 3OH1A 1VGWA 5CQOA 4P00A 3SXEA 2Y4MA 2P72A 1O7QA 4HG6A 4B4MA 1LL2A 5AJPA 1R7VA 4KC1A 4EVWA 3N9WA 2VFZA 3GUEA 3V0MA 2OEFA 3I0DA 3Q4SA 4KXOA 3PKPA 2JCLA 3SXCA 2W0WA 1XZ6A 4HO8A 5C48A 1WT2A 3V0OA 5EJZA 4AC3A 1FGXA 4AAWA 5C3DA 4AYLA 1QWJA 1G1LA 1GX4A 1VH1A 1VGUA 4D48A 2RJ1A 1R7XA 1VICA 2Y6PA 5C4CA 2RJ4A 1S4OA 2RIXA 3OH3A 1H5SA 4KRVA 2Y4JA 3K8EA 4EE3A 4JISA 3V0LA 4Y7VA 3NGWA 1FXOA 3R3IA 1HJJA 1H7HA 2YQSA 3TQDA 1JV1A 3CKQA 5C8RA 4B4BA 3T7MA 1MP5A 3JTJA 4DDZA 4AYJA 2FFUA 4FRAA 4O6NA 5FU0A 3T7OA 1TW1A 2X5ZA 4KNXA 1ZJ3A 3USRA 2JCKA 1ZDFA 2DPWA 3Q7UA 5AJOA 5C4DA 1H5TA 2NXVA 1MC3A 2Y4LA 4M28A 4R7PA 5HS2A 1ZI5A 1QGSA 2ICYA 4Y7FA 2FYBA 5C1GA 5C4EA 3U2XA 1TZFA 2AM3A 1LZIA 2BO6A 5FV9A 1FOAA 1LL3A 2YESA 1YP4A 2VS5A 5CMFX 1I52A 1PZTA 4Y63A 5JQQA 3Q80A 4ZDQA 3ZLLA 5FU8A 4NAIA 3SX5A 1ZJOA 2VK9A 2E3DA 1H5RB 3OH2A 4G3QA 4CJBA 2BO7A 1HM8A 2P73A 1FRWA 2OEGA 2O1HA 2W0VA 2Z87A 3U0YA 1VH3A 1TVYA 3F1YA 1G3LA 1PZYB 1IINA 2FYCB 3U2TA 2X5SA 4D11A 3I0EA 1ZJ1A 2J0BA 1W57A 2YCMA 3SXAA 2X60A 1W77A 4FRHA 2FFVA 1VM8A 3SX8A 5IFYA 1HM0A 3I0IX 3SXBA 1ZCTA 2OI6A 3D5NA 2MZBA 4M4KA 2YQHA 4Y7TA 1Z90A 1ZDGA 2YC3A 3OAMA 1LZ7A 2I7BA 2C0NA 4CJ8A 2JCOA 1INJA 2WVLA 1TW5A 2YC5A 2BO4A 5CMIA 1JVGA 1O23B 3PNNA 1ZI1A 5CMHA 4XWIA 4C2SA 1IIMA 2V0HA 1R81A 3IOJA 1INIA 4YS8A 3LW6A 3CGXA 2PGYA 4JD0A 3O3PA 3PKQA 3V0QA 1R80A 3SX3A 3SXDA 1ZJPA 1QG8A 1V82A 4CJCA 4IRPA 2PA4A 1VZTA 2RIYA 4BMAA 2JCJA 4ECMA 5C49A 5IDSA 5FUHA 4HO5A 2Y4KA 5DDTA 5C3AA 1VPAA 1G2VA 1FGGA 3BCVA 3I0HA 2A8UA 4FRMA 4FRDA 5AJNA 4ASYA 1H4DA 5C47A 1O0RA 1G93A 1JVDA 3SX7A 4ARWA 4EE4A 1ON8A 1H5RA 1H7TA 4FQWA 5CQPA 5J49A 1JYLA 1OMXA 3DUVA 1G95A 2CU2A 2AM5A 2YQCA 1G9RA 2WGZA 3T7NA 5CQMX 1GWVA 3TZTA 2BO8A 3CKVA 1H7QA 1JYKA 2ZU7A 5BXCA 1G23A 3CKNA 3DK5A 2Y7AA 1EZIA 3I0CA 4J18A 4G87A 4Q7CA 1H5SC 1VZUA 1V84A 2P6WA 3OGZA 1HJLA 4EEOA 2D7RA 2RJ8A 3RMVA 1R7UA 2O1FA 1H7FA 1YROB 3ZGGA 2VXLA 5C36A 4B3UA 2V0JA 1GA8A 1G0RA 1KWSA 1O7OA 3OKRA 3V0NA 1W55A 4Y7GA 4HO9A 4D0ZA 3D98A 1GQ9A 2V0KA 2PX7A 2RITA 1JV3A 1NMMB 1K4VA 1LL0A 1HV9A 2Z86A 1E5KA 1WT3A 4G3SA 1WT1A 5C4FA 2QGIA 2AESA 2WE9A 3OH4A 1ZHJA 4L41C 1FO9A 3ST8A 3I0GA 2VD4A 5D91A 4K6RA 2VSIA 4D0TA 2FYAA 1OMZA 2AM4A 1ON6A 3ZLKA 4HOCA 4HO4A 4LW6A 2D0JA 2XMHA 3E26A 1WVCA 3OC9A 1ZCVA 4EEAA 1H7EA 4Y7UA 4MIXA 5EIYA 1G97A 4Y64A 5FTSA 2V0LA 1H7LA 1HM9A 4KQLA 3SPTA 4CVHA 3JUJA 2UX8A 4KT7A 3I0JA 4B2WA 2APCA 2GGQA 1ZI3A 5C1LA 4D11C 3SXGA 4P02A 4KNRA 4HO6A 4B42A 1WT0A 4FRLA 1OQMB 3IOHA 3FWWA 2O1GA 1LVWA 3I0LA 3QVBA 1VZXA 4HO0A 4LW3A 2VS3A 4MNDA 2I5EA 2ZU9A 4FROA 3V8YA 2WEEA 4HO2A 1NWGB 4NANA 4DECA 1H3MA 3K8DA 2ZU8A 3KIAA 5C4BA 4FRQA 1ZI4A 4B4GA 2AECA 2WAWA 2VSHA 2XWLA 1NF5B 4DE7A 1ZIZA 3USQA 4EEGA 1FR8A 2Q4JA 2GGOA 2I5KA 2AE7A 3V0PA 5EJ1A 2V0IA 3CKJA 1GQCA 4EEMA 1G8OA 5I1FA 2XWMA 3BRKX 3RMWA 1VGZA 3RSBA 4HCQA 1GX0A 1FO8A 2QH5A 2X65A 2RJ0A 2OI5A 4G3PA 1XHBA 1ZCUA 4O6MA 5CMJA 3FOQA 5IDTA 1FG5N 2FYDB 3IOIA 3U2VA 5C3BA 5CQLX 3V8ZA 3D8VA 4KPZA 1ZJ0A 3V90A 4NALA 3I0KA 5C38A 4B5BA 1H4EA 1ZJ2A 2RJ5A 3CU0A 1R7TA 2RJ9A 4GBPA 4MYBA 4IRQA 5CQNX 1LZ0A 1FWYA 2RJ6A 2QKXA 5CMGX 1FXJA 2WVKA 4FIXA 1FZWA 3HL3A 2YQJA
chains in the Genus database with same CATH topology
3OH0A 3E25A 2E8BA 3U2UA 4ASJA 4FRPA 2AH9A 1S4PA 4KPXA 4UEGA 2VS4A 4Y6NA 5C1HA 3ZF8A 1WSZA 1MP4A 3R2WA 4Y6UA 4NAKA 1S4NA 2VXMA 4M2AA 3V91A 4M2BA 3U2WA 5L6SA 5FYEA 1SS9A 4FIYA 1MP3A 2FY7A 5L6VA 1V83A 2ICXA 2RJ7A 1H5SB 3U0XA 5DDVA 1NKHB 4KC4A 1QGQA 2OI7A 5FTVA 4FCUA 1R82A 1NQIB 4E1KA 3DJ4A 4KC2A 2WVMA 1FR9A 3I0FA 1GWWA 3F1CA 1NHEB 5D92A 1H5TB 2XMEA 2XWNA 1LZJA 3CKOA 4EE5A 2AGDA 3POLA 2D7IA 4FREA 3ZGFA 1H4CA 1R7YA 1H7GA 4FRBA 3JUKA 2PGVA 1YP3A 4Y62A 1H5SD 2RIZA 4Y9XA 4HO3A 4BQHA 1EYRA 1ZCYA 1YP2A 2J0AA 4B2XA 2A8WA 4FCEA 1VGTA 3EE5A 3OH1A 1VGWA 5CQOA 4P00A 3SXEA 2Y4MA 2P72A 1O7QA 4HG6A 4B4MA 1LL2A 5AJPA 1R7VA 4KC1A 4EVWA 3N9WA 2VFZA 3GUEA 3V0MA 2OEFA 3I0DA 3Q4SA 4KXOA 3PKPA 2JCLA 3SXCA 2W0WA 1XZ6A 4HO8A 5C48A 1WT2A 3V0OA 5EJZA 4AC3A 1FGXA 4AAWA 5C3DA 4AYLA 1QWJA 1G1LA 1GX4A 1VH1A 1VGUA 4D48A 2RJ1A 1R7XA 1VICA 2Y6PA 5C4CA 2RJ4A 1S4OA 2RIXA 3OH3A 1H5SA 4KRVA 2Y4JA 3K8EA 4EE3A 4JISA 3V0LA 4Y7VA 3NGWA 1FXOA 3R3IA 1HJJA 1H7HA 2YQSA 3TQDA 1JV1A 3CKQA 5C8RA 4B4BA 3T7MA 1MP5A 3JTJA 4DDZA 4AYJA 2FFUA 4FRAA 4O6NA 5FU0A 3T7OA 1TW1A 2X5ZA 4KNXA 1ZJ3A 3USRA 2JCKA 1ZDFA 2DPWA 3Q7UA 5AJOA 5C4DA 1H5TA 2NXVA 1MC3A 2Y4LA 4M28A 4R7PA 5HS2A 1ZI5A 1QGSA 2ICYA 4Y7FA 2FYBA 5C1GA 5C4EA 3U2XA 1TZFA 2AM3A 1LZIA 2BO6A 5FV9A 1FOAA 1LL3A 2YESA 1YP4A 2VS5A 5CMFX 1I52A 1PZTA 4Y63A 5JQQA 3Q80A 4ZDQA 3ZLLA 5FU8A 4NAIA 3SX5A 1ZJOA 2VK9A 2E3DA 1H5RB 3OH2A 4G3QA 4CJBA 2BO7A 1HM8A 2P73A 1FRWA 2OEGA 2O1HA 2W0VA 2Z87A 3U0YA 1VH3A 1TVYA 3F1YA 1G3LA 1PZYB 1IINA 2FYCB 3U2TA 2X5SA 4D11A 3I0EA 1ZJ1A 2J0BA 1W57A 2YCMA 3SXAA 2X60A 1W77A 4FRHA 2FFVA 1VM8A 3SX8A 5IFYA 1HM0A 3I0IX 3SXBA 1ZCTA 2OI6A 3D5NA 2MZBA 4M4KA 2YQHA 4Y7TA 1Z90A 1ZDGA 2YC3A 3OAMA 1LZ7A 2I7BA 2C0NA 4CJ8A 2JCOA 1INJA 2WVLA 1TW5A 2YC5A 2BO4A 5CMIA 1JVGA 1O23B 3PNNA 1ZI1A 5CMHA 4XWIA 4C2SA 1IIMA 2V0HA 1R81A 3IOJA 1INIA 4YS8A 3LW6A 3CGXA 2PGYA 4JD0A 3O3PA 3PKQA 3V0QA 1R80A 3SX3A 3SXDA 1ZJPA 1QG8A 1V82A 4CJCA 4IRPA 2PA4A 1VZTA 2RIYA 4BMAA 2JCJA 4ECMA 5C49A 5IDSA 5FUHA 4HO5A 2Y4KA 5DDTA 5C3AA 1VPAA 1G2VA 1FGGA 3BCVA 3I0HA 2A8UA 4FRMA 4FRDA 5AJNA 4ASYA 1H4DA 5C47A 1O0RA 1G93A 1JVDA 3SX7A 4ARWA 4EE4A 1ON8A 1H5RA 1H7TA 4FQWA 5CQPA 5J49A 1JYLA 1OMXA 3DUVA 1G95A 2CU2A 2AM5A 2YQCA 1G9RA 2WGZA 3T7NA 5CQMX 1GWVA 3TZTA 2BO8A 3CKVA 1H7QA 1JYKA 2ZU7A 5BXCA 1G23A 3CKNA 3DK5A 2Y7AA 1EZIA 3I0CA 4J18A 4G87A 4Q7CA 1H5SC 1VZUA 1V84A 2P6WA 3OGZA 1HJLA 4EEOA 2D7RA 2RJ8A 3RMVA 1R7UA 2O1FA 1H7FA 1YROB 3ZGGA 2VXLA 5C36A 4B3UA 2V0JA 1GA8A 1G0RA 1KWSA 1O7OA 3OKRA 3V0NA 1W55A 4Y7GA 4HO9A 4D0ZA 3D98A 1GQ9A 2V0KA 2PX7A 2RITA 1JV3A 1NMMB 1K4VA 1LL0A 1HV9A 2Z86A 1E5KA 1WT3A 4G3SA 1WT1A 5C4FA 2QGIA 2AESA 2WE9A 3OH4A 1ZHJA 4L41C 1FO9A 3ST8A 3I0GA 2VD4A 5D91A 4K6RA 2VSIA 4D0TA 2FYAA 1OMZA 2AM4A 1ON6A 3ZLKA 4HOCA 4HO4A 4LW6A 2D0JA 2XMHA 3E26A 1WVCA 3OC9A 1ZCVA 4EEAA 1H7EA 4Y7UA 4MIXA 5EIYA 1G97A 4Y64A 5FTSA 2V0LA 1H7LA 1HM9A 4KQLA 3SPTA 4CVHA 3JUJA 2UX8A 4KT7A 3I0JA 4B2WA 2APCA 2GGQA 1ZI3A 5C1LA 4D11C 3SXGA 4P02A 4KNRA 4HO6A 4B42A 1WT0A 4FRLA 1OQMB 3IOHA 3FWWA 2O1GA 1LVWA 3I0LA 3QVBA 1VZXA 4HO0A 4LW3A 2VS3A 4MNDA 2I5EA 2ZU9A 4FROA 3V8YA 2WEEA 4HO2A 1NWGB 4NANA 4DECA 1H3MA 3K8DA 2ZU8A 3KIAA 5C4BA 4FRQA 1ZI4A 4B4GA 2AECA 2WAWA 2VSHA 2XWLA 1NF5B 4DE7A 1ZIZA 3USQA 4EEGA 1FR8A 2Q4JA 2GGOA 2I5KA 2AE7A 3V0PA 5EJ1A 2V0IA 3CKJA 1GQCA 4EEMA 1G8OA 5I1FA 2XWMA 3BRKX 3RMWA 1VGZA 3RSBA 4HCQA 1GX0A 1FO8A 2QH5A 2X65A 2RJ0A 2OI5A 4G3PA 1XHBA 1ZCUA 4O6MA 5CMJA 3FOQA 5IDTA 1FG5N 2FYDB 3IOIA 3U2VA 5C3BA 5CQLX 3V8ZA 3D8VA 4KPZA 1ZJ0A 3V90A 4NALA 3I0KA 5C38A 4B5BA 1H4EA 1ZJ2A 2RJ5A 3CU0A 1R7TA 2RJ9A 4GBPA 4MYBA 4IRQA 5CQNX 1LZ0A 1FWYA 2RJ6A 2QKXA 5CMGX 1FXJA 2WVKA 4FIXA 1FZWA 3HL3A 2YQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OH0 A;  3E25 A;  2E8B A;  3U2U A;  4ASJ A;  4FRP A;  2AH9 A;  1S4P A;  4KPX A;  4UEG A;  2VS4 A;  4Y6N A;  5C1H A;  3ZF8 A;  1WSZ A;  1MP4 A;  3R2W A;  4Y6U A;  4NAK A;  1S4N A;  2VXM A;  4M2A A;  3V91 A;  4M2B A;  3U2W A;  5L6S A;  5FYE A;  1SS9 A;  1MP3 A;  2FY7 A;  5L6V A;  1V83 A;  2ICX A;  2RJ7 A;  1H5S B;  3U0X A;  5DDV A;  1NKH B;  4KC4 A;  1QGQ A;  2OI7 A;  5FTV A;  4FCU A;  1R82 A;  1NQI B;  4E1K A;  3DJ4 A;  4KC2 A;  2WVM A;  1FR9 A;  3I0F A;  1GWW A;  3F1C A;  1NHE B;  1H5T B;  2XME A;  2XWN A;  1LZJ A;  3CKO A;  4EE5 A;  2AGD A;  3POL A;  2D7I A;  4FRE A;  3ZGF A;  1H4C A;  1R7Y A;  1H7G A;  4FRB A;  3JUK A;  2PGV A;  1YP3 A;  4Y62 A;  1H5S D;  2RIZ A;  4Y9X A;  4HO3 A;  4BQH A;  1EYR A;  1ZCY A;  1YP2 A;  4B2X A;  2A8W A;  4FCE A;  1VGT A;  3EE5 A;  3OH1 A;  1VGW A;  5CQO A;  4P00 A;  3SXE A;  2Y4M A;  2P72 A;  1O7Q A;  4HG6 A;  4B4M A;  1LL2 A;  5AJP A;  1R7V A;  4KC1 A;  4EVW A;  3N9W A;  2VFZ A;  3GUE A;  3V0M A;  2OEF A;  3I0D A;  3Q4S A;  4KXO A;  3PKP A;  2JCL A;  3SXC A;  2W0W A;  1XZ6 A;  4HO8 A;  5C48 A;  1WT2 A;  3V0O A;  5EJZ A;  4AC3 A;  1FGX A;  4AAW A;  5C3D A;  4AYL A;  1QWJ A;  1G1L A;  1GX4 A;  1VH1 A;  1VGU A;  4D48 A;  2RJ1 A;  1R7X A;  1VIC A;  2Y6P A;  5C4C A;  2RJ4 A;  1S4O A;  2RIX A;  3OH3 A;  1H5S A;  4KRV A;  2Y4J A;  3K8E A;  4EE3 A;  4JIS A;  3V0L A;  4Y7V A;  3NGW A;  1FXO A;  3R3I A;  1HJJ A;  1H7H A;  2YQS A;  3TQD A;  1JV1 A;  3CKQ A;  5C8R A;  4B4B A;  3T7M A;  1MP5 A;  3JTJ A;  4DDZ A;  4AYJ A;  2FFU A;  4FRA A;  5FU0 A;  3T7O A;  1TW1 A;  2X5Z A;  4KNX A;  1ZJ3 A;  3USR A;  2JCK A;  1ZDF A;  2DPW A;  3Q7U A;  5AJO A;  5C4D A;  1H5T A;  2NXV A;  1MC3 A;  2Y4L A;  4M28 A;  4R7P A;  5HS2 A;  1ZI5 A;  1QGS A;  2ICY A;  4Y7F A;  2FYB A;  5C1G A;  5C4E A;  3U2X A;  1TZF A;  2AM3 A;  1LZI A;  2BO6 A;  5FV9 A;  1FOA A;  1LL3 A;  2YES A;  1YP4 A;  2VS5 A;  5CMF X;  1I52 A;  1PZT A;  4Y63 A;  5JQQ A;  3Q80 A;  4ZDQ A;  3ZLL A;  5FU8 A;  4NAI A;  3SX5 A;  1ZJO A;  2E3D A;  1H5R B;  3OH2 A;  4G3Q A;  4CJB A;  2BO7 A;  1HM8 A;  2P73 A;  1FRW A;  2OEG A;  2O1H A;  2W0V A;  2Z87 A;  3U0Y A;  1VH3 A;  1TVY A;  3F1Y A;  1G3L A;  1PZY B;  1IIN A;  2FYC B;  3U2T A;  2X5S A;  4D11 A;  3I0E A;  1ZJ1 A;  2YCM A;  1W57 A;  3SXA A;  2X60 A;  1W77 A;  4FRH A;  2FFV A;  1VM8 A;  3SX8 A;  5IFY A;  1HM0 A;  3I0I X;  3SXB A;  1ZCT A;  2OI6 A;  3D5N A;  2MZB A;  4M4K A;  2YQH A;  4Y7T A;  1Z90 A;  1ZDG A;  2YC3 A;  3OAM A;  1LZ7 A;  2I7B A;  4CJ8 A;  2JCO A;  1INJ A;  2WVL A;  1TW5 A;  2YC5 A;  2BO4 A;  5CMI A;  1JVG A;  1O23 B;  3PNN A;  1ZI1 A;  5CMH A;  4XWI A;  4C2S A;  1IIM A;  2V0H A;  1R81 A;  3IOJ A;  1INI A;  4YS8 A;  3LW6 A;  3CGX A;  2PGY A;  4JD0 A;  3O3P A;  3PKQ A;  3V0Q A;  1R80 A;  3SX3 A;  3SXD A;  1ZJP A;  1QG8 A;  1V82 A;  4CJC A;  4IRP A;  2PA4 A;  1VZT A;  2RIY A;  4BMA A;  2JCJ A;  4ECM A;  5C49 A;  5IDS A;  5FUH A;  4HO5 A;  2Y4K A;  5DDT A;  5C3A A;  1VPA A;  1G2V A;  1FGG A;  3BCV A;  3I0H A;  2A8U A;  4FRM A;  4FRD A;  5AJN A;  4ASY A;  1H4D A;  5C47 A;  1O0R A;  1G93 A;  1JVD A;  3SX7 A;  4ARW A;  4EE4 A;  1ON8 A;  1H5R A;  1H7T A;  4FQW A;  5CQP A;  5J49 A;  1JYL A;  1OMX A;  3DUV A;  1G95 A;  2CU2 A;  2AM5 A;  2YQC A;  1G9R A;  2WGZ A;  3T7N A;  5CQM X;  1GWV A;  3TZT A;  2BO8 A;  3CKV A;  1H7Q A;  1JYK A;  2ZU7 A;  5BXC A;  1G23 A;  3CKN A;  3DK5 A;  2Y7A A;  1EZI A;  3I0C A;  4J18 A;  4G87 A;  1H5S C;  1VZU A;  1V84 A;  2P6W A;  3OGZ A;  1HJL A;  4EEO A;  2D7R A;  2RJ8 A;  3RMV A;  1R7U A;  2O1F A;  1H7F A;  1YRO B;  3ZGG A;  2VXL A;  5C36 A;  4B3U A;  2V0J A;  1GA8 A;  1G0R A;  1KWS A;  1O7O A;  3OKR A;  3V0N A;  1W55 A;  4Y7G A;  4HO9 A;  4D0Z A;  3D98 A;  1GQ9 A;  2V0K A;  2PX7 A;  2RIT A;  1JV3 A;  1NMM B;  1K4V A;  1LL0 A;  1HV9 A;  2Z86 A;  1E5K A;  1WT3 A;  4G3S A;  1WT1 A;  5C4F A;  2QGI A;  2AES A;  2WE9 A;  3OH4 A;  1ZHJ A;  4L41 C;  1FO9 A;  3ST8 A;  3I0G A;  2VD4 A;  4K6R A;  2VSI A;  4D0T A;  2FYA A;  1OMZ A;  2AM4 A;  1ON6 A;  3ZLK A;  4HOC A;  4HO4 A;  4LW6 A;  2D0J A;  2XMH A;  3E26 A;  1WVC A;  3OC9 A;  1ZCV A;  4EEA A;  1H7E A;  4Y7U A;  5EIY A;  1G97 A;  4Y64 A;  5FTS A;  2V0L A;  1H7L A;  1HM9 A;  4KQL A;  3SPT A;  4CVH A;  3JUJ A;  2UX8 A;  4KT7 A;  3I0J A;  4B2W A;  2APC A;  2GGQ A;  1ZI3 A;  5C1L A;  4D11 C;  3SXG A;  4P02 A;  4KNR A;  4HO6 A;  4B42 A;  1WT0 A;  4FRL A;  1OQM B;  3IOH A;  3FWW A;  2O1G A;  1LVW A;  3I0L A;  3QVB A;  1VZX A;  4HO0 A;  4LW3 A;  2VS3 A;  4MND A;  2I5E A;  2ZU9 A;  4FRO A;  3V8Y A;  2WEE A;  4HO2 A;  1NWG B;  4NAN A;  4DEC A;  1H3M A;  3K8D A;  2ZU8 A;  3KIA A;  5C4B A;  4FRQ A;  1ZI4 A;  4B4G A;  2AEC A;  2WAW A;  2VSH A;  2XWL A;  1NF5 B;  4DE7 A;  1ZIZ A;  3USQ A;  4EEG A;  1FR8 A;  2Q4J A;  2GGO A;  2I5K A;  2AE7 A;  3V0P A;  5EJ1 A;  2V0I A;  3CKJ A;  1GQC A;  4EEM A;  1G8O A;  5I1F A;  2XWM A;  3BRK X;  3RMW A;  1VGZ A;  3RSB A;  4HCQ A;  1GX0 A;  1FO8 A;  2QH5 A;  2X65 A;  2RJ0 A;  2OI5 A;  4G3P A;  1XHB A;  1ZCU A;  5CMJ A;  3FOQ A;  5IDT A;  1FG5 N;  2FYD B;  3IOI A;  3U2V A;  5C3B A;  5CQL X;  3V8Z A;  3D8V A;  4KPZ A;  1ZJ0 A;  3V90 A;  4NAL A;  3I0K A;  5C38 A;  4B5B A;  1H4E A;  1ZJ2 A;  2RJ5 A;  3CU0 A;  1R7T A;  2RJ9 A;  4GBP A;  4MYB A;  4IRQ A;  5CQN X;  1LZ0 A;  1FWY A;  2RJ6 A;  2QKX A;  5CMG X;  1FXJ A;  2WVK A;  1FZW A;  3HL3 A;  2YQJ A; 
#chains in the Genus database with same CATH topology
 3OH0 A;  3E25 A;  2E8B A;  3U2U A;  4ASJ A;  4FRP A;  2AH9 A;  1S4P A;  4KPX A;  4UEG A;  2VS4 A;  4Y6N A;  5C1H A;  3ZF8 A;  1WSZ A;  1MP4 A;  3R2W A;  4Y6U A;  4NAK A;  1S4N A;  2VXM A;  4M2A A;  3V91 A;  4M2B A;  3U2W A;  5L6S A;  5FYE A;  1SS9 A;  4FIY A;  1MP3 A;  2FY7 A;  5L6V A;  1V83 A;  2ICX A;  2RJ7 A;  1H5S B;  3U0X A;  5DDV A;  1NKH B;  4KC4 A;  1QGQ A;  2OI7 A;  5FTV A;  4FCU A;  1R82 A;  1NQI B;  4E1K A;  3DJ4 A;  4KC2 A;  2WVM A;  1FR9 A;  3I0F A;  1GWW A;  3F1C A;  1NHE B;  5D92 A;  1H5T B;  2XME A;  2XWN A;  1LZJ A;  3CKO A;  4EE5 A;  2AGD A;  3POL A;  2D7I A;  4FRE A;  3ZGF A;  1H4C A;  1R7Y A;  1H7G A;  4FRB A;  3JUK A;  2PGV A;  1YP3 A;  4Y62 A;  1H5S D;  2RIZ A;  4Y9X A;  4HO3 A;  4BQH A;  1EYR A;  1ZCY A;  1YP2 A;  2J0A A;  4B2X A;  2A8W A;  4FCE A;  1VGT A;  3EE5 A;  3OH1 A;  1VGW A;  5CQO A;  4P00 A;  3SXE A;  2Y4M A;  2P72 A;  1O7Q A;  4HG6 A;  4B4M A;  1LL2 A;  5AJP A;  1R7V A;  4KC1 A;  4EVW A;  3N9W A;  2VFZ A;  3GUE A;  3V0M A;  2OEF A;  3I0D A;  3Q4S A;  4KXO A;  3PKP A;  2JCL A;  3SXC A;  2W0W A;  1XZ6 A;  4HO8 A;  5C48 A;  1WT2 A;  3V0O A;  5EJZ A;  4AC3 A;  1FGX A;  4AAW A;  5C3D A;  4AYL A;  1QWJ A;  1G1L A;  1GX4 A;  1VH1 A;  1VGU A;  4D48 A;  2RJ1 A;  1R7X A;  1VIC A;  2Y6P A;  5C4C A;  2RJ4 A;  1S4O A;  2RIX A;  3OH3 A;  1H5S A;  4KRV A;  2Y4J A;  3K8E A;  4EE3 A;  4JIS A;  3V0L A;  4Y7V A;  3NGW A;  1FXO A;  3R3I A;  1HJJ A;  1H7H A;  2YQS A;  3TQD A;  1JV1 A;  3CKQ A;  5C8R A;  4B4B A;  3T7M A;  1MP5 A;  3JTJ A;  4DDZ A;  4AYJ A;  2FFU A;  4FRA A;  4O6N A;  5FU0 A;  3T7O A;  1TW1 A;  2X5Z A;  4KNX A;  1ZJ3 A;  3USR A;  2JCK A;  1ZDF A;  2DPW A;  3Q7U A;  5AJO A;  5C4D A;  1H5T A;  2NXV A;  1MC3 A;  2Y4L A;  4M28 A;  4R7P A;  5HS2 A;  1ZI5 A;  1QGS A;  2ICY A;  4Y7F A;  2FYB A;  5C1G A;  5C4E A;  3U2X A;  1TZF A;  2AM3 A;  1LZI A;  2BO6 A;  5FV9 A;  1FOA A;  1LL3 A;  2YES A;  1YP4 A;  2VS5 A;  5CMF X;  1I52 A;  1PZT A;  4Y63 A;  5JQQ A;  3Q80 A;  4ZDQ A;  3ZLL A;  5FU8 A;  4NAI A;  3SX5 A;  1ZJO A;  2VK9 A;  2E3D A;  1H5R B;  3OH2 A;  4G3Q A;  4CJB A;  2BO7 A;  1HM8 A;  2P73 A;  1FRW A;  2OEG A;  2O1H A;  2W0V A;  2Z87 A;  3U0Y A;  1VH3 A;  1TVY A;  3F1Y A;  1G3L A;  1PZY B;  1IIN A;  2FYC B;  3U2T A;  2X5S A;  4D11 A;  3I0E A;  1ZJ1 A;  2J0B A;  1W57 A;  2YCM A;  3SXA A;  2X60 A;  1W77 A;  4FRH A;  2FFV A;  1VM8 A;  3SX8 A;  5IFY A;  1HM0 A;  3I0I X;  3SXB A;  1ZCT A;  2OI6 A;  3D5N A;  2MZB A;  4M4K A;  2YQH A;  4Y7T A;  1Z90 A;  1ZDG A;  2YC3 A;  3OAM A;  1LZ7 A;  2I7B A;  2C0N A;  4CJ8 A;  2JCO A;  1INJ A;  2WVL A;  1TW5 A;  2YC5 A;  2BO4 A;  5CMI A;  1JVG A;  1O23 B;  3PNN A;  1ZI1 A;  5CMH A;  4XWI A;  4C2S A;  1IIM A;  2V0H A;  1R81 A;  3IOJ A;  1INI A;  4YS8 A;  3LW6 A;  3CGX A;  2PGY A;  4JD0 A;  3O3P A;  3PKQ A;  3V0Q A;  1R80 A;  3SX3 A;  3SXD A;  1ZJP A;  1QG8 A;  1V82 A;  4CJC A;  4IRP A;  2PA4 A;  1VZT A;  2RIY A;  4BMA A;  2JCJ A;  4ECM A;  5C49 A;  5IDS A;  5FUH A;  4HO5 A;  2Y4K A;  5DDT A;  5C3A A;  1VPA A;  1G2V A;  1FGG A;  3BCV A;  3I0H A;  2A8U A;  4FRM A;  4FRD A;  5AJN A;  4ASY A;  1H4D A;  5C47 A;  1O0R A;  1G93 A;  1JVD A;  3SX7 A;  4ARW A;  4EE4 A;  1ON8 A;  1H5R A;  1H7T A;  4FQW A;  5CQP A;  5J49 A;  1JYL A;  1OMX A;  3DUV A;  1G95 A;  2CU2 A;  2AM5 A;  2YQC A;  1G9R A;  2WGZ A;  3T7N A;  5CQM X;  1GWV A;  3TZT A;  2BO8 A;  3CKV A;  1H7Q A;  1JYK A;  2ZU7 A;  5BXC A;  1G23 A;  3CKN A;  3DK5 A;  2Y7A A;  1EZI A;  3I0C A;  4J18 A;  4G87 A;  4Q7C A;  1H5S C;  1VZU A;  1V84 A;  2P6W A;  3OGZ A;  1HJL A;  4EEO A;  2D7R A;  2RJ8 A;  3RMV A;  1R7U A;  2O1F A;  1H7F A;  1YRO B;  3ZGG A;  2VXL A;  5C36 A;  4B3U A;  2V0J A;  1GA8 A;  1G0R A;  1KWS A;  1O7O A;  3OKR A;  3V0N A;  1W55 A;  4Y7G A;  4HO9 A;  4D0Z A;  3D98 A;  1GQ9 A;  2V0K A;  2PX7 A;  2RIT A;  1JV3 A;  1NMM B;  1K4V A;  1LL0 A;  1HV9 A;  2Z86 A;  1E5K A;  1WT3 A;  4G3S A;  1WT1 A;  5C4F A;  2QGI A;  2AES A;  2WE9 A;  3OH4 A;  1ZHJ A;  4L41 C;  1FO9 A;  3ST8 A;  3I0G A;  2VD4 A;  5D91 A;  4K6R A;  2VSI A;  4D0T A;  2FYA A;  1OMZ A;  2AM4 A;  1ON6 A;  3ZLK A;  4HOC A;  4HO4 A;  4LW6 A;  2D0J A;  2XMH A;  3E26 A;  1WVC A;  3OC9 A;  1ZCV A;  4EEA A;  1H7E A;  4Y7U A;  4MIX A;  5EIY A;  1G97 A;  4Y64 A;  5FTS A;  2V0L A;  1H7L A;  1HM9 A;  4KQL A;  3SPT A;  4CVH A;  3JUJ A;  2UX8 A;  4KT7 A;  3I0J A;  4B2W A;  2APC A;  2GGQ A;  1ZI3 A;  5C1L A;  4D11 C;  3SXG A;  4P02 A;  4KNR A;  4HO6 A;  4B42 A;  1WT0 A;  4FRL A;  1OQM B;  3IOH A;  3FWW A;  2O1G A;  1LVW A;  3I0L A;  3QVB A;  1VZX A;  4HO0 A;  4LW3 A;  2VS3 A;  4MND A;  2I5E A;  2ZU9 A;  4FRO A;  3V8Y A;  2WEE A;  4HO2 A;  1NWG B;  4NAN A;  4DEC A;  1H3M A;  3K8D A;  2ZU8 A;  3KIA A;  5C4B A;  4FRQ A;  1ZI4 A;  4B4G A;  2AEC A;  2WAW A;  2VSH A;  2XWL A;  1NF5 B;  4DE7 A;  1ZIZ A;  3USQ A;  4EEG A;  1FR8 A;  2Q4J A;  2GGO A;  2I5K A;  2AE7 A;  3V0P A;  5EJ1 A;  2V0I A;  3CKJ A;  1GQC A;  4EEM A;  1G8O A;  5I1F A;  2XWM A;  3BRK X;  3RMW A;  1VGZ A;  3RSB A;  4HCQ A;  1GX0 A;  1FO8 A;  2QH5 A;  2X65 A;  2RJ0 A;  2OI5 A;  4G3P A;  1XHB A;  1ZCU A;  4O6M A;  5CMJ A;  3FOQ A;  5IDT A;  1FG5 N;  2FYD B;  3IOI A;  3U2V A;  5C3B A;  5CQL X;  3V8Z A;  3D8V A;  4KPZ A;  1ZJ0 A;  3V90 A;  4NAL A;  3I0K A;  5C38 A;  4B5B A;  1H4E A;  1ZJ2 A;  2RJ5 A;  3CU0 A;  1R7T A;  2RJ9 A;  4GBP A;  4MYB A;  4IRQ A;  5CQN X;  1LZ0 A;  1FWY A;  2RJ6 A;  2QKX A;  5CMG X;  1FXJ A;  2WVK A;  4FIX A;  1FZW A;  3HL3 A;  2YQJ A; 
#chains in the Genus database with same CATH homology
 3OH0 A;  3E25 A;  2E8B A;  3U2U A;  4ASJ A;  4FRP A;  2AH9 A;  1S4P A;  4KPX A;  4UEG A;  2VS4 A;  4Y6N A;  5C1H A;  3ZF8 A;  1WSZ A;  1MP4 A;  3R2W A;  4Y6U A;  4NAK A;  1S4N A;  2VXM A;  4M2A A;  3V91 A;  4M2B A;  3U2W A;  5L6S A;  5FYE A;  1SS9 A;  4FIY A;  1MP3 A;  2FY7 A;  5L6V A;  1V83 A;  2ICX A;  2RJ7 A;  1H5S B;  3U0X A;  5DDV A;  1NKH B;  4KC4 A;  1QGQ A;  2OI7 A;  5FTV A;  4FCU A;  1R82 A;  1NQI B;  4E1K A;  3DJ4 A;  4KC2 A;  2WVM A;  1FR9 A;  3I0F A;  1GWW A;  3F1C A;  1NHE B;  5D92 A;  1H5T B;  2XME A;  2XWN A;  1LZJ A;  3CKO A;  4EE5 A;  2AGD A;  3POL A;  2D7I A;  4FRE A;  3ZGF A;  1H4C A;  1R7Y A;  1H7G A;  4FRB A;  3JUK A;  2PGV A;  1YP3 A;  4Y62 A;  1H5S D;  2RIZ A;  4Y9X A;  4HO3 A;  4BQH A;  1EYR A;  1ZCY A;  1YP2 A;  2J0A A;  4B2X A;  2A8W A;  4FCE A;  1VGT A;  3EE5 A;  3OH1 A;  1VGW A;  5CQO A;  4P00 A;  3SXE A;  2Y4M A;  2P72 A;  1O7Q A;  4HG6 A;  4B4M A;  1LL2 A;  5AJP A;  1R7V A;  4KC1 A;  4EVW A;  3N9W A;  2VFZ A;  3GUE A;  3V0M A;  2OEF A;  3I0D A;  3Q4S A;  4KXO A;  3PKP A;  2JCL A;  3SXC A;  2W0W A;  1XZ6 A;  4HO8 A;  5C48 A;  1WT2 A;  3V0O A;  5EJZ A;  4AC3 A;  1FGX A;  4AAW A;  5C3D A;  4AYL A;  1QWJ A;  1G1L A;  1GX4 A;  1VH1 A;  1VGU A;  4D48 A;  2RJ1 A;  1R7X A;  1VIC A;  2Y6P A;  5C4C A;  2RJ4 A;  1S4O A;  2RIX A;  3OH3 A;  1H5S A;  4KRV A;  2Y4J A;  3K8E A;  4EE3 A;  4JIS A;  3V0L A;  4Y7V A;  3NGW A;  1FXO A;  3R3I A;  1HJJ A;  1H7H A;  2YQS A;  3TQD A;  1JV1 A;  3CKQ A;  5C8R A;  4B4B A;  3T7M A;  1MP5 A;  3JTJ A;  4DDZ A;  4AYJ A;  2FFU A;  4FRA A;  4O6N A;  5FU0 A;  3T7O A;  1TW1 A;  2X5Z A;  4KNX A;  1ZJ3 A;  3USR A;  2JCK A;  1ZDF A;  2DPW A;  3Q7U A;  5AJO A;  5C4D A;  1H5T A;  2NXV A;  1MC3 A;  2Y4L A;  4M28 A;  4R7P A;  5HS2 A;  1ZI5 A;  1QGS A;  2ICY A;  4Y7F A;  2FYB A;  5C1G A;  5C4E A;  3U2X A;  1TZF A;  2AM3 A;  1LZI A;  2BO6 A;  5FV9 A;  1FOA A;  1LL3 A;  2YES A;  1YP4 A;  2VS5 A;  5CMF X;  1I52 A;  1PZT A;  4Y63 A;  5JQQ A;  3Q80 A;  4ZDQ A;  3ZLL A;  5FU8 A;  4NAI A;  3SX5 A;  1ZJO A;  2VK9 A;  2E3D A;  1H5R B;  3OH2 A;  4G3Q A;  4CJB A;  2BO7 A;  1HM8 A;  2P73 A;  1FRW A;  2OEG A;  2O1H A;  2W0V A;  2Z87 A;  3U0Y A;  1VH3 A;  1TVY A;  3F1Y A;  1G3L A;  1PZY B;  1IIN A;  2FYC B;  3U2T A;  2X5S A;  4D11 A;  3I0E A;  1ZJ1 A;  2J0B A;  1W57 A;  2YCM A;  3SXA A;  2X60 A;  1W77 A;  4FRH A;  2FFV A;  1VM8 A;  3SX8 A;  5IFY A;  1HM0 A;  3I0I X;  3SXB A;  1ZCT A;  2OI6 A;  3D5N A;  2MZB A;  4M4K A;  2YQH A;  4Y7T A;  1Z90 A;  1ZDG A;  2YC3 A;  3OAM A;  1LZ7 A;  2I7B A;  2C0N A;  4CJ8 A;  2JCO A;  1INJ A;  2WVL A;  1TW5 A;  2YC5 A;  2BO4 A;  5CMI A;  1JVG A;  1O23 B;  3PNN A;  1ZI1 A;  5CMH A;  4XWI A;  4C2S A;  1IIM A;  2V0H A;  1R81 A;  3IOJ A;  1INI A;  4YS8 A;  3LW6 A;  3CGX A;  2PGY A;  4JD0 A;  3O3P A;  3PKQ A;  3V0Q A;  1R80 A;  3SX3 A;  3SXD A;  1ZJP A;  1QG8 A;  1V82 A;  4CJC A;  4IRP A;  2PA4 A;  1VZT A;  2RIY A;  4BMA A;  2JCJ A;  4ECM A;  5C49 A;  5IDS A;  5FUH A;  4HO5 A;  2Y4K A;  5DDT A;  5C3A A;  1VPA A;  1G2V A;  1FGG A;  3BCV A;  3I0H A;  2A8U A;  4FRM A;  4FRD A;  5AJN A;  4ASY A;  1H4D A;  5C47 A;  1O0R A;  1G93 A;  1JVD A;  3SX7 A;  4ARW A;  4EE4 A;  1ON8 A;  1H5R A;  1H7T A;  4FQW A;  5CQP A;  5J49 A;  1JYL A;  1OMX A;  3DUV A;  1G95 A;  2CU2 A;  2AM5 A;  2YQC A;  1G9R A;  2WGZ A;  3T7N A;  5CQM X;  1GWV A;  3TZT A;  2BO8 A;  3CKV A;  1H7Q A;  1JYK A;  2ZU7 A;  5BXC A;  1G23 A;  3CKN A;  3DK5 A;  2Y7A A;  1EZI A;  3I0C A;  4J18 A;  4G87 A;  4Q7C A;  1H5S C;  1VZU A;  1V84 A;  2P6W A;  3OGZ A;  1HJL A;  4EEO A;  2D7R A;  2RJ8 A;  3RMV A;  1R7U A;  2O1F A;  1H7F A;  1YRO B;  3ZGG A;  2VXL A;  5C36 A;  4B3U A;  2V0J A;  1GA8 A;  1G0R A;  1KWS A;  1O7O A;  3OKR A;  3V0N A;  1W55 A;  4Y7G A;  4HO9 A;  4D0Z A;  3D98 A;  1GQ9 A;  2V0K A;  2PX7 A;  2RIT A;  1JV3 A;  1NMM B;  1K4V A;  1LL0 A;  1HV9 A;  2Z86 A;  1E5K A;  1WT3 A;  4G3S A;  1WT1 A;  5C4F A;  2QGI A;  2AES A;  2WE9 A;  3OH4 A;  1ZHJ A;  4L41 C;  1FO9 A;  3ST8 A;  3I0G A;  2VD4 A;  5D91 A;  4K6R A;  2VSI A;  4D0T A;  2FYA A;  1OMZ A;  2AM4 A;  1ON6 A;  3ZLK A;  4HOC A;  4HO4 A;  4LW6 A;  2D0J A;  2XMH A;  3E26 A;  1WVC A;  3OC9 A;  1ZCV A;  4EEA A;  1H7E A;  4Y7U A;  4MIX A;  5EIY A;  1G97 A;  4Y64 A;  5FTS A;  2V0L A;  1H7L A;  1HM9 A;  4KQL A;  3SPT A;  4CVH A;  3JUJ A;  2UX8 A;  4KT7 A;  3I0J A;  4B2W A;  2APC A;  2GGQ A;  1ZI3 A;  5C1L A;  4D11 C;  3SXG A;  4P02 A;  4KNR A;  4HO6 A;  4B42 A;  1WT0 A;  4FRL A;  1OQM B;  3IOH A;  3FWW A;  2O1G A;  1LVW A;  3I0L A;  3QVB A;  1VZX A;  4HO0 A;  4LW3 A;  2VS3 A;  4MND A;  2I5E A;  2ZU9 A;  4FRO A;  3V8Y A;  2WEE A;  4HO2 A;  1NWG B;  4NAN A;  4DEC A;  1H3M A;  3K8D A;  2ZU8 A;  3KIA A;  5C4B A;  4FRQ A;  1ZI4 A;  4B4G A;  2AEC A;  2WAW A;  2VSH A;  2XWL A;  1NF5 B;  4DE7 A;  1ZIZ A;  3USQ A;  4EEG A;  1FR8 A;  2Q4J A;  2GGO A;  2I5K A;  2AE7 A;  3V0P A;  5EJ1 A;  2V0I A;  3CKJ A;  1GQC A;  4EEM A;  1G8O A;  5I1F A;  2XWM A;  3BRK X;  3RMW A;  1VGZ A;  3RSB A;  4HCQ A;  1GX0 A;  1FO8 A;  2QH5 A;  2X65 A;  2RJ0 A;  2OI5 A;  4G3P A;  1XHB A;  1ZCU A;  4O6M A;  5CMJ A;  3FOQ A;  5IDT A;  1FG5 N;  2FYD B;  3IOI A;  3U2V A;  5C3B A;  5CQL X;  3V8Z A;  3D8V A;  4KPZ A;  1ZJ0 A;  3V90 A;  4NAL A;  3I0K A;  5C38 A;  4B5B A;  1H4E A;  1ZJ2 A;  2RJ5 A;  3CU0 A;  1R7T A;  2RJ9 A;  4GBP A;  4MYB A;  4IRQ A;  5CQN X;  1LZ0 A;  1FWY A;  2RJ6 A;  2QKX A;  5CMG X;  1FXJ A;  2WVK A;  4FIX A;  1FZW A;  3HL3 A;  2YQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...