3V0OA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-galnac derived inhibitor (4gw) and h-antigen acceptor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified donor analogues reveal novel dynamic features of a glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0oA00
1FG5N 1NQIB 2V0HA 3U2WA 1INIA 1LL2A 3T7MA 1PZYB 3SXAA 3R2WA 2YQSA 4Y63A 2D0JA 1H5SA 2V0IA 4Y7FA 1HV9A 4B4GA 1FO9A 5DDVA 1H7HA 2RJ0A 5FYEA 3USQA 4J18A 3RMVA 3SX7A 2QGIA 1JVDA 1G97A 1GA8A 2AH9A 5EJ1A 1VZXA 1ON6A 2A8UA 3Q80A 4B4MA 4JD0A 3NGWA 1ZHJA 4M2AA 5CQMX 1HJLA 3SXDA 3I0HA 3U2XA 4BMAA 4FRQA 2RIXA 1FR8A 4NALA 4MNDA 2E8BA 1V82A 1YROB 5CQNX 4FRMA 2RIZA 4HOCA 1WT3A 2RJ6A 1MP5A 1ZCUA 3CKNA 3ZLKA 3OH4A 1YP4A 2QH5A 5AJPA 2VSHA 1G2VA 1ZJ1A 5C4EA 1I52A 1QGQA 2WEEA 1MP3A 3K8DA 3PNNA 3Q4SA 5C8RA 2XMEA 1YP3A 4HO8A 3HL3A 1VGWA 3N9WA 4FCEA 3Q7UA 1Z90A 4Y64A 1JV3A 3I0GA 4FREA 1ZDFA 2X5ZA 3PKQA 2ICXA 1WT0A 1FXJA 2NXVA 5FTSA 3ZF8A 4KC2A 4Y7UA 2Y7AA 1KWSA 1HJJA 5C4DA 5CQPA 2Y4LA 1G23A 3CKOA 1H4DA 4NANA 3OH1A 3F1YA 2RITA 1G1LA 3GUEA 4EVWA 4P00A 4KC1A 1R7XA 2WVLA 1GQ9A 4FROA 3ZGFA 1S4NA 2VSIA 3U2VA 1E5KA 4MYBA 5C4FA 1VZUA 1FOAA 5CQOA 1VH1A 4B2XA 1H5RB 3OH3A 4BQHA 2WAWA 1JV1A 3JUJA 1QG8A 3QVBA 4EE5A 3KIAA 4DECA 4IRPA 4C2SA 2BO7A 3D98A 4M4KA 4LW6A 3OKRA 1LZIA 3V0LA 2XWMA 1V84A 2FY7A 4FRLA 2WE9A 3V0OA 2OEFA 1H3MA 4KPZA 4JISA 1VGTA 1NMMB 3SXGA 3TZTA 1QGSA 5C36A 2FFUA 2VFZA 3RSBA 3ST8A 1FGGA 3OGZA 3BCVA 4Y9XA 4ASJA 4CJBA 4EEMA 3F1CA 3RMWA 1H7GA 2Y4JA 4KNXA 2OI6A 3U0YA 3ZGGA 2W0VA 1H4EA 1ZI1A 1ZJOA 2V0LA 2YQCA 3SX3A 1LVWA 1ZCYA 3V8ZA 3DUVA 2VXMA 4B3UA 3I0FA 5C47A 5IFYA 4D0ZA 2YCMA 3SPTA 2PGYA 5DDTA 3SXCA 4NAIA 1ZI3A 4K6RA 2FYBA 1GQCA 3DJ4A 1R82A 2FYAA 4G3QA 2JCLA 1ZJ2A 1YP2A 1O7OA 2P6WA 1LZ0A 1VPAA 4EEGA 5HS2A 5L6VA 4Y6UA 1ZI4A 4FCUA 2RJ1A 1HM8A 3I0DA 2JCKA 4Y7VA 1SS9A 1W55A 3FWWA 2PX7A 3USRA 1VGZA 4HO9A 1ON8A 4HO3A 1ZJ3A 4B2WA 3I0KA 5C3AA 1MC3A 5BXCA 1EZIA 3IOIA 1FGXA 5C38A 3I0JA 2VD4A 1VZTA 5EIYA 2YESA 4P02A 1TVYA 5L6SA 2JCJA 1ZCTA 2Z86A 1JVGA 2X60A 4ARWA 1G9RA 2AM4A 4FRBA 2V0JA 1FRWA 1OQMB 1MP4A 3OAMA 2P73A 2X5SA 4ECMA 1H7FA 2FYDB 3CKQA 4AAWA 2FFVA 1FO8A 4D48A 1FR9A 1O0RA 4DDZA 4G3PA 3SXEA 1XZ6A 1ZCVA 1R7VA 3TQDA 2AESA 2PA4A 3E25A 4AYJA 4B4BA 4EE3A 3PKPA 3I0CA 3I0EA 1WSZA 5CMFX 1IINA 4ZDQA 1NWGB 1S4PA 1TW1A 3I0IX 2PGVA 4KQLA 2XWNA 5I1FA 4DE7A 5CMJA 2APCA 3O3PA 2WGZA 1LZ7A 3CGXA 4EE4A 3FOQA 2YQJA 4UEGA 2I7BA 3V0PA 1V83A 2FYCB 1FXOA 2OI7A 2Y4KA 3I0LA 1O23B 1XHBA 2WVMA 2RJ5A 2P72A 1ZI5A 4FRPA 2Z87A 1LL3A 1H5RA 1HM0A 5CMIA 2A8WA 1R7YA 2XWLA 2ZU7A 4GBPA 4R7PA 3U0XA 3OC9A 2O1FA 1WT1A 2YQHA 3D8VA 3V0QA 4CJCA 4AC3A 1WVCA 4YS8A 4KPXA 2YC5A 4Y7GA 3EE5A 4G3SA 2VXLA 2ICYA 3D5NA 1NF5B 3SX8A 4B5BA 2D7RA 2JCOA 3T7OA 5C48A 4HO2A 3LW6A 5EJZA 5IDTA 3BRKX 1LL0A 3SX5A 1K4VA 4LW3A 3ZLLA 5C49A 4L41C 2Q4JA 2QKXA 4CVHA 1G93A 3K8EA 2X65A 4EEOA 4G87A 1W77A 2VS4A 1FWYA 1H5SD 1R81A 5FV9A 2YC3A 4HO5A 1GWVA 3E26A 2XMHA 3T7NA 1H4CA 2RJ8A 1R7TA 2V0KA 1GX4A 2O1HA 3POLA 2Y4MA 4D0TA 2AM3A 2GGOA 4FRAA 3V90A 2E3DA 5CMHA 2AECA 2RIYA 1H5TB 3IOHA 2OEGA 5FU0A 4HO4A 4NAKA 2AE7A 1ZDGA 4FRHA 5FTVA 1EYRA 1GWWA 1H7LA 1VH3A 1WT2A 2WVKA 1VGUA 2VS5A 4Y6NA 1TZFA 4M28A 1QWJA 1H7EA 1H7TA 4M2BA 5C1GA 3SXBA 5C4CA 1VM8A 4D11A 1R7UA 3V8YA 2CU2A 2OI5A 2I5KA 5AJOA 5C3BA 3DK5A 3CKVA 1G8OA 4KT7A 4KXOA 5JQQA 3U2UA 4CJ8A 4HG6A 4ASYA 1W57A 1NHEB 1H5SC 3CU0A 5C1LA 1IIMA 1JYKA 5C4BA 2DPWA 1G3LA 4HO6A 3U2TA 2RJ7A 1OMZA 1H5TA 4KC4A 1PZTA 4HCQA 1ZJPA 4KRVA 1VICA 3V91A 5FU8A 4FRDA 2Y6PA 4B42A 3JTJA 1HM9A 5IDSA 2BO6A 2I5EA 1S4OA 2GGQA 2ZU9A 4FQWA 1O7QA 5CMGX 1G95A 1ZJ0A 2BO8A 2AM5A 1ZIZA 1H5SB 4AYLA 4Y7TA 1H7QA 4XWIA 1LZJA 2UX8A 5CQLX 2RJ4A 1INJA 4E1KA 4IRQA 1TW5A 2O1GA 2D7IA 5C1HA 1JYLA 5FUHA 2W0WA 2ZU8A 3V0MA 3CKJA 1OMXA 4EEAA 3OH2A 5AJNA 5C3DA 1FZWA 1G0RA 3IOJA 3V0NA 4Y62A 1R80A 4D11C 1GX0A 3R3IA 5J49A 3JUKA 2MZBA 4KNRA 1NKHB 2VS3A 4HO0A 2AGDA 2BO4A 3OH0A 2RJ9A
chains in the Genus database with same CATH superfamily
1FG5N 1NQIB 2V0HA 3U2WA 1INIA 1LL2A 3T7MA 1PZYB 3SXAA 3R2WA 2YQSA 4Y63A 2D0JA 1H5SA 2V0IA 4Y7FA 1HV9A 4B4GA 1FO9A 5DDVA 1H7HA 2RJ0A 5FYEA 3USQA 4J18A 3RMVA 3SX7A 2QGIA 1JVDA 1G97A 1GA8A 2AH9A 5EJ1A 1VZXA 1ON6A 2A8UA 3Q80A 4B4MA 4JD0A 5D92A 4FIXA 3NGWA 1ZHJA 4M2AA 5CQMX 1HJLA 3SXDA 3I0HA 3U2XA 4BMAA 4FRQA 2RIXA 1FR8A 4NALA 4MNDA 2E8BA 1V82A 1YROB 5CQNX 4FRMA 2RIZA 4HOCA 1WT3A 2RJ6A 1MP5A 1ZCUA 3CKNA 3ZLKA 3OH4A 4FIYA 1YP4A 2QH5A 5AJPA 2VSHA 1G2VA 1ZJ1A 5C4EA 4O6NA 1I52A 1QGQA 2WEEA 1MP3A 3K8DA 3PNNA 3Q4SA 5C8RA 2XMEA 1YP3A 4HO8A 3HL3A 1VGWA 3N9WA 4FCEA 3Q7UA 1Z90A 4Y64A 1JV3A 3I0GA 4FREA 1ZDFA 2X5ZA 3PKQA 2ICXA 1WT0A 1FXJA 2NXVA 5FTSA 3ZF8A 4KC2A 4Y7UA 2Y7AA 1KWSA 1HJJA 5C4DA 5CQPA 2Y4LA 1G23A 3CKOA 1H4DA 4NANA 3OH1A 3F1YA 2RITA 1G1LA 3GUEA 4EVWA 4P00A 4KC1A 1R7XA 2WVLA 1GQ9A 4FROA 3ZGFA 1S4NA 2VSIA 3U2VA 1E5KA 4MYBA 5C4FA 1VZUA 1FOAA 5CQOA 1VH1A 4B2XA 1H5RB 3OH3A 4BQHA 2WAWA 1JV1A 3JUJA 1QG8A 3QVBA 4EE5A 3KIAA 4Q7CA 4DECA 4IRPA 4C2SA 2BO7A 3D98A 4M4KA 4LW6A 3OKRA 1LZIA 3V0LA 2XWMA 2VK9A 1V84A 2FY7A 4FRLA 2WE9A 3V0OA 2OEFA 1H3MA 4KPZA 4JISA 1VGTA 1NMMB 3SXGA 3TZTA 1QGSA 5C36A 2FFUA 2VFZA 3RSBA 3ST8A 1FGGA 3OGZA 3BCVA 4Y9XA 4ASJA 4CJBA 4EEMA 3F1CA 3RMWA 1H7GA 2Y4JA 4KNXA 2OI6A 3U0YA 3ZGGA 2W0VA 1H4EA 1ZI1A 1ZJOA 2V0LA 2YQCA 3SX3A 1LVWA 1ZCYA 3V8ZA 3DUVA 2VXMA 4B3UA 3I0FA 5C47A 5IFYA 4D0ZA 2YCMA 3SPTA 2PGYA 5DDTA 3SXCA 4NAIA 1ZI3A 4K6RA 2FYBA 1GQCA 3DJ4A 1R82A 2FYAA 4G3QA 2JCLA 1ZJ2A 1YP2A 1O7OA 4O6MA 2P6WA 1LZ0A 1VPAA 4EEGA 5HS2A 5L6VA 4Y6UA 1ZI4A 4FCUA 2RJ1A 1HM8A 3I0DA 2JCKA 4Y7VA 1SS9A 1W55A 3FWWA 2PX7A 3USRA 2J0BA 1VGZA 4HO9A 1ON8A 4HO3A 1ZJ3A 4B2WA 3I0KA 5C3AA 1MC3A 5BXCA 1EZIA 3IOIA 1FGXA 5C38A 3I0JA 2VD4A 1VZTA 5EIYA 2YESA 4P02A 1TVYA 5L6SA 2JCJA 1ZCTA 2Z86A 5D91A 1JVGA 2X60A 4ARWA 1G9RA 2AM4A 4FRBA 2V0JA 1FRWA 1OQMB 1MP4A 3OAMA 2P73A 2X5SA 4ECMA 1H7FA 2FYDB 3CKQA 4AAWA 2FFVA 1FO8A 4D48A 1FR9A 1O0RA 4DDZA 4G3PA 3SXEA 1XZ6A 1ZCVA 1R7VA 3TQDA 2AESA 2PA4A 3E25A 4AYJA 4B4BA 4EE3A 3PKPA 3I0CA 3I0EA 1WSZA 5CMFX 1IINA 4ZDQA 1NWGB 1S4PA 1TW1A 3I0IX 2PGVA 4KQLA 2XWNA 5I1FA 4DE7A 5CMJA 2APCA 3O3PA 2WGZA 1LZ7A 3CGXA 4EE4A 3FOQA 2YQJA 4UEGA 2I7BA 3V0PA 1V83A 2FYCB 1FXOA 2OI7A 2Y4KA 3I0LA 1O23B 1XHBA 2WVMA 2RJ5A 2P72A 1ZI5A 4FRPA 2Z87A 1LL3A 1H5RA 1HM0A 5CMIA 2A8WA 1R7YA 2XWLA 2ZU7A 4GBPA 4R7PA 3U0XA 3OC9A 2O1FA 1WT1A 2YQHA 3D8VA 3V0QA 4CJCA 4AC3A 1WVCA 4YS8A 4KPXA 2YC5A 4Y7GA 3EE5A 4G3SA 2VXLA 2ICYA 3D5NA 1NF5B 3SX8A 4B5BA 2D7RA 2JCOA 3T7OA 5C48A 4HO2A 3LW6A 5EJZA 5IDTA 3BRKX 1LL0A 3SX5A 1K4VA 4LW3A 3ZLLA 5C49A 4L41C 2Q4JA 2QKXA 4CVHA 1G93A 3K8EA 2X65A 4EEOA 4G87A 1W77A 2VS4A 1FWYA 1H5SD 1R81A 5FV9A 2YC3A 4HO5A 1GWVA 3E26A 2XMHA 3T7NA 1H4CA 2RJ8A 1R7TA 2V0KA 1GX4A 2O1HA 3POLA 2Y4MA 4D0TA 2AM3A 2GGOA 4FRAA 3V90A 2E3DA 5CMHA 2C0NA 2AECA 2RIYA 1H5TB 3IOHA 2OEGA 5FU0A 4HO4A 4NAKA 2AE7A 1ZDGA 4FRHA 5FTVA 1EYRA 1GWWA 1H7LA 1VH3A 1WT2A 2WVKA 1VGUA 2VS5A 4Y6NA 1TZFA 4M28A 1QWJA 1H7EA 1H7TA 4M2BA 5C1GA 3SXBA 5C4CA 1VM8A 4D11A 1R7UA 3V8YA 2CU2A 2OI5A 2I5KA 5AJOA 5C3BA 3DK5A 3CKVA 1G8OA 4KT7A 4KXOA 5JQQA 3U2UA 4CJ8A 4HG6A 4ASYA 1W57A 1NHEB 1H5SC 3CU0A 5C1LA 1IIMA 1JYKA 5C4BA 2DPWA 1G3LA 4HO6A 3U2TA 2RJ7A 2J0AA 1OMZA 1H5TA 4KC4A 1PZTA 4HCQA 1ZJPA 4KRVA 1VICA 3V91A 5FU8A 4FRDA 2Y6PA 4MIXA 3JTJA 4B42A 1HM9A 5IDSA 2BO6A 2I5EA 1S4OA 2GGQA 2ZU9A 4FQWA 1O7QA 5CMGX 1G95A 1ZJ0A 2BO8A 2AM5A 1ZIZA 1H5SB 4AYLA 4Y7TA 1H7QA 4XWIA 1LZJA 2UX8A 5CQLX 2RJ4A 1INJA 4E1KA 4IRQA 1TW5A 2O1GA 2D7IA 5C1HA 1JYLA 5FUHA 2W0WA 2ZU8A 3V0MA 3CKJA 1OMXA 4EEAA 3OH2A 5AJNA 5C3DA 1FZWA 1G0RA 3IOJA 3V0NA 4Y62A 1R80A 4D11C 1GX0A 3R3IA 5J49A 3JUKA 2MZBA 4KNRA 1NKHB 2VS3A 4HO0A 2AGDA 2BO4A 3OH0A 2RJ9A
chains in the Genus database with same CATH topology
1FG5N 1NQIB 2V0HA 3U2WA 1INIA 1LL2A 3T7MA 1PZYB 3SXAA 3R2WA 2YQSA 4Y63A 2D0JA 1H5SA 2V0IA 4Y7FA 1HV9A 4B4GA 1FO9A 5DDVA 1H7HA 2RJ0A 5FYEA 3USQA 4J18A 3RMVA 3SX7A 2QGIA 1JVDA 1G97A 1GA8A 2AH9A 5EJ1A 1VZXA 1ON6A 2A8UA 3Q80A 4B4MA 4JD0A 5D92A 4FIXA 3NGWA 1ZHJA 4M2AA 5CQMX 1HJLA 3SXDA 3I0HA 3U2XA 4BMAA 4FRQA 2RIXA 1FR8A 4NALA 4MNDA 2E8BA 1V82A 1YROB 5CQNX 4FRMA 2RIZA 4HOCA 1WT3A 2RJ6A 1MP5A 1ZCUA 3CKNA 3ZLKA 3OH4A 4FIYA 1YP4A 2QH5A 5AJPA 2VSHA 1G2VA 1ZJ1A 5C4EA 4O6NA 1I52A 1QGQA 2WEEA 1MP3A 3K8DA 3PNNA 3Q4SA 5C8RA 2XMEA 1YP3A 4HO8A 3HL3A 1VGWA 3N9WA 4FCEA 3Q7UA 1Z90A 4Y64A 1JV3A 3I0GA 4FREA 1ZDFA 2X5ZA 3PKQA 2ICXA 1WT0A 1FXJA 2NXVA 5FTSA 3ZF8A 4KC2A 4Y7UA 2Y7AA 1KWSA 1HJJA 5C4DA 5CQPA 2Y4LA 1G23A 3CKOA 1H4DA 4NANA 3OH1A 3F1YA 2RITA 1G1LA 3GUEA 4EVWA 4P00A 4KC1A 1R7XA 2WVLA 1GQ9A 4FROA 3ZGFA 1S4NA 2VSIA 3U2VA 1E5KA 4MYBA 5C4FA 1VZUA 1FOAA 5CQOA 1VH1A 4B2XA 1H5RB 3OH3A 4BQHA 2WAWA 1JV1A 3JUJA 1QG8A 3QVBA 4EE5A 3KIAA 4Q7CA 4DECA 4IRPA 4C2SA 2BO7A 3D98A 4M4KA 4LW6A 3OKRA 1LZIA 3V0LA 2XWMA 2VK9A 1V84A 2FY7A 4FRLA 2WE9A 3V0OA 2OEFA 1H3MA 4KPZA 4JISA 1VGTA 1NMMB 3SXGA 3TZTA 1QGSA 5C36A 2FFUA 2VFZA 3RSBA 3ST8A 1FGGA 3OGZA 3BCVA 4Y9XA 4ASJA 4CJBA 4EEMA 3F1CA 3RMWA 1H7GA 2Y4JA 4KNXA 2OI6A 3U0YA 3ZGGA 2W0VA 1H4EA 1ZI1A 1ZJOA 2V0LA 2YQCA 3SX3A 1LVWA 1ZCYA 3V8ZA 3DUVA 2VXMA 4B3UA 3I0FA 5C47A 5IFYA 4D0ZA 2YCMA 3SPTA 2PGYA 5DDTA 3SXCA 4NAIA 1ZI3A 4K6RA 2FYBA 1GQCA 3DJ4A 1R82A 2FYAA 4G3QA 2JCLA 1ZJ2A 1YP2A 1O7OA 4O6MA 2P6WA 1LZ0A 1VPAA 4EEGA 5HS2A 5L6VA 4Y6UA 1ZI4A 4FCUA 2RJ1A 1HM8A 3I0DA 2JCKA 4Y7VA 1SS9A 1W55A 3FWWA 2PX7A 3USRA 2J0BA 1VGZA 4HO9A 1ON8A 4HO3A 1ZJ3A 4B2WA 3I0KA 5C3AA 1MC3A 5BXCA 1EZIA 3IOIA 1FGXA 5C38A 3I0JA 2VD4A 1VZTA 5EIYA 2YESA 4P02A 1TVYA 5L6SA 2JCJA 1ZCTA 2Z86A 5D91A 1JVGA 2X60A 4ARWA 1G9RA 2AM4A 4FRBA 2V0JA 1FRWA 1OQMB 1MP4A 3OAMA 2P73A 2X5SA 4ECMA 1H7FA 2FYDB 3CKQA 4AAWA 2FFVA 1FO8A 4D48A 1FR9A 1O0RA 4DDZA 4G3PA 3SXEA 1XZ6A 1ZCVA 1R7VA 3TQDA 2AESA 2PA4A 3E25A 4AYJA 4B4BA 4EE3A 3PKPA 3I0CA 3I0EA 1WSZA 5CMFX 1IINA 4ZDQA 1NWGB 1S4PA 1TW1A 3I0IX 2PGVA 4KQLA 2XWNA 5I1FA 4DE7A 5CMJA 2APCA 3O3PA 2WGZA 1LZ7A 3CGXA 4EE4A 3FOQA 2YQJA 4UEGA 2I7BA 3V0PA 1V83A 2FYCB 1FXOA 2OI7A 2Y4KA 3I0LA 1O23B 1XHBA 2WVMA 2RJ5A 2P72A 1ZI5A 4FRPA 2Z87A 1LL3A 1H5RA 1HM0A 5CMIA 2A8WA 1R7YA 2XWLA 2ZU7A 4GBPA 4R7PA 3U0XA 3OC9A 2O1FA 1WT1A 2YQHA 3D8VA 3V0QA 4CJCA 4AC3A 1WVCA 4YS8A 4KPXA 2YC5A 4Y7GA 3EE5A 4G3SA 2VXLA 2ICYA 3D5NA 1NF5B 3SX8A 4B5BA 2D7RA 2JCOA 3T7OA 5C48A 4HO2A 3LW6A 5EJZA 5IDTA 3BRKX 1LL0A 3SX5A 1K4VA 4LW3A 3ZLLA 5C49A 4L41C 2Q4JA 2QKXA 4CVHA 1G93A 3K8EA 2X65A 4EEOA 4G87A 1W77A 2VS4A 1FWYA 1H5SD 1R81A 5FV9A 2YC3A 4HO5A 1GWVA 3E26A 2XMHA 3T7NA 1H4CA 2RJ8A 1R7TA 2V0KA 1GX4A 2O1HA 3POLA 2Y4MA 4D0TA 2AM3A 2GGOA 4FRAA 3V90A 2E3DA 5CMHA 2C0NA 2AECA 2RIYA 1H5TB 3IOHA 2OEGA 5FU0A 4HO4A 4NAKA 2AE7A 1ZDGA 4FRHA 5FTVA 1EYRA 1GWWA 1H7LA 1VH3A 1WT2A 2WVKA 1VGUA 2VS5A 4Y6NA 1TZFA 4M28A 1QWJA 1H7EA 1H7TA 4M2BA 5C1GA 3SXBA 5C4CA 1VM8A 4D11A 1R7UA 3V8YA 2CU2A 2OI5A 2I5KA 5AJOA 5C3BA 3DK5A 3CKVA 1G8OA 4KT7A 4KXOA 5JQQA 3U2UA 4CJ8A 4HG6A 4ASYA 1W57A 1NHEB 1H5SC 3CU0A 5C1LA 1IIMA 1JYKA 5C4BA 2DPWA 1G3LA 4HO6A 3U2TA 2RJ7A 2J0AA 1OMZA 1H5TA 4KC4A 1PZTA 4HCQA 1ZJPA 4KRVA 1VICA 3V91A 5FU8A 4FRDA 2Y6PA 4MIXA 3JTJA 4B42A 1HM9A 5IDSA 2BO6A 2I5EA 1S4OA 2GGQA 2ZU9A 4FQWA 1O7QA 5CMGX 1G95A 1ZJ0A 2BO8A 2AM5A 1ZIZA 1H5SB 4AYLA 4Y7TA 1H7QA 4XWIA 1LZJA 2UX8A 5CQLX 2RJ4A 1INJA 4E1KA 4IRQA 1TW5A 2O1GA 2D7IA 5C1HA 1JYLA 5FUHA 2W0WA 2ZU8A 3V0MA 3CKJA 1OMXA 4EEAA 3OH2A 5AJNA 5C3DA 1FZWA 1G0RA 3IOJA 3V0NA 4Y62A 1R80A 4D11C 1GX0A 3R3IA 5J49A 3JUKA 2MZBA 4KNRA 1NKHB 2VS3A 4HO0A 2AGDA 2BO4A 3OH0A 2RJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FG5 N;  1NQI B;  2V0H A;  3U2W A;  1INI A;  1LL2 A;  3T7M A;  1PZY B;  3SXA A;  3R2W A;  2YQS A;  4Y63 A;  2D0J A;  1H5S A;  2V0I A;  4Y7F A;  1HV9 A;  4B4G A;  1FO9 A;  5DDV A;  1H7H A;  2RJ0 A;  5FYE A;  3USQ A;  4J18 A;  3RMV A;  3SX7 A;  2QGI A;  1JVD A;  1G97 A;  1GA8 A;  2AH9 A;  5EJ1 A;  1VZX A;  1ON6 A;  2A8U A;  3Q80 A;  4B4M A;  4JD0 A;  3NGW A;  1ZHJ A;  4M2A A;  5CQM X;  1HJL A;  3SXD A;  3I0H A;  3U2X A;  4BMA A;  4FRQ A;  2RIX A;  1FR8 A;  4NAL A;  4MND A;  2E8B A;  1V82 A;  1YRO B;  5CQN X;  4FRM A;  2RIZ A;  4HOC A;  1WT3 A;  2RJ6 A;  1MP5 A;  1ZCU A;  3CKN A;  3ZLK A;  3OH4 A;  1YP4 A;  2QH5 A;  5AJP A;  2VSH A;  1G2V A;  1ZJ1 A;  5C4E A;  1I52 A;  1QGQ A;  2WEE A;  1MP3 A;  3K8D A;  3PNN A;  3Q4S A;  5C8R A;  2XME A;  1YP3 A;  4HO8 A;  3HL3 A;  1VGW A;  3N9W A;  4FCE A;  3Q7U A;  1Z90 A;  4Y64 A;  1JV3 A;  3I0G A;  4FRE A;  1ZDF A;  2X5Z A;  3PKQ A;  2ICX A;  1WT0 A;  1FXJ A;  2NXV A;  5FTS A;  3ZF8 A;  4KC2 A;  4Y7U A;  2Y7A A;  1KWS A;  1HJJ A;  5C4D A;  5CQP A;  2Y4L A;  1G23 A;  3CKO A;  1H4D A;  4NAN A;  3OH1 A;  3F1Y A;  2RIT A;  1G1L A;  3GUE A;  4EVW A;  4P00 A;  4KC1 A;  1R7X A;  2WVL A;  1GQ9 A;  4FRO A;  3ZGF A;  1S4N A;  2VSI A;  3U2V A;  1E5K A;  4MYB A;  5C4F A;  1VZU A;  1FOA A;  5CQO A;  1VH1 A;  4B2X A;  1H5R B;  3OH3 A;  4BQH A;  2WAW A;  1JV1 A;  3JUJ A;  1QG8 A;  3QVB A;  4EE5 A;  3KIA A;  4DEC A;  4IRP A;  4C2S A;  2BO7 A;  3D98 A;  4M4K A;  4LW6 A;  3OKR A;  1LZI A;  3V0L A;  2XWM A;  1V84 A;  2FY7 A;  4FRL A;  2WE9 A;  3V0O A;  2OEF A;  1H3M A;  4KPZ A;  4JIS A;  1VGT A;  1NMM B;  3SXG A;  3TZT A;  1QGS A;  5C36 A;  2FFU A;  2VFZ A;  3RSB A;  3ST8 A;  1FGG A;  3OGZ A;  3BCV A;  4Y9X A;  4ASJ A;  4CJB A;  4EEM A;  3F1C A;  3RMW A;  1H7G A;  2Y4J A;  4KNX A;  2OI6 A;  3U0Y A;  3ZGG A;  2W0V A;  1H4E A;  1ZI1 A;  1ZJO A;  2V0L A;  2YQC A;  3SX3 A;  1LVW A;  1ZCY A;  3V8Z A;  3DUV A;  2VXM A;  4B3U A;  3I0F A;  5C47 A;  5IFY A;  4D0Z A;  2YCM A;  3SPT A;  2PGY A;  5DDT A;  3SXC A;  4NAI A;  1ZI3 A;  4K6R A;  2FYB A;  1GQC A;  3DJ4 A;  1R82 A;  2FYA A;  4G3Q A;  2JCL A;  1ZJ2 A;  1YP2 A;  1O7O A;  2P6W A;  1LZ0 A;  1VPA A;  4EEG A;  5HS2 A;  5L6V A;  4Y6U A;  1ZI4 A;  4FCU A;  2RJ1 A;  1HM8 A;  3I0D A;  2JCK A;  4Y7V A;  1SS9 A;  1W55 A;  3FWW A;  2PX7 A;  3USR A;  1VGZ A;  4HO9 A;  1ON8 A;  4HO3 A;  1ZJ3 A;  4B2W A;  3I0K A;  5C3A A;  1MC3 A;  5BXC A;  1EZI A;  3IOI A;  1FGX A;  5C38 A;  3I0J A;  2VD4 A;  1VZT A;  5EIY A;  2YES A;  4P02 A;  1TVY A;  5L6S A;  2JCJ A;  1ZCT A;  2Z86 A;  1JVG A;  2X60 A;  4ARW A;  1G9R A;  2AM4 A;  4FRB A;  2V0J A;  1FRW A;  1OQM B;  1MP4 A;  3OAM A;  2P73 A;  2X5S A;  4ECM A;  1H7F A;  2FYD B;  3CKQ A;  4AAW A;  2FFV A;  1FO8 A;  4D48 A;  1FR9 A;  1O0R A;  4DDZ A;  4G3P A;  3SXE A;  1XZ6 A;  1ZCV A;  1R7V A;  3TQD A;  2AES A;  2PA4 A;  3E25 A;  4AYJ A;  4B4B A;  4EE3 A;  3PKP A;  3I0C A;  3I0E A;  1WSZ A;  5CMF X;  1IIN A;  4ZDQ A;  1NWG B;  1S4P A;  1TW1 A;  3I0I X;  2PGV A;  4KQL A;  2XWN A;  5I1F A;  4DE7 A;  5CMJ A;  2APC A;  3O3P A;  2WGZ A;  1LZ7 A;  3CGX A;  4EE4 A;  3FOQ A;  2YQJ A;  4UEG A;  2I7B A;  3V0P A;  1V83 A;  2FYC B;  1FXO A;  2OI7 A;  2Y4K A;  3I0L A;  1O23 B;  1XHB A;  2WVM A;  2RJ5 A;  2P72 A;  1ZI5 A;  4FRP A;  2Z87 A;  1LL3 A;  1H5R A;  1HM0 A;  5CMI A;  2A8W A;  1R7Y A;  2XWL A;  2ZU7 A;  4GBP A;  4R7P A;  3U0X A;  3OC9 A;  2O1F A;  1WT1 A;  2YQH A;  3D8V A;  3V0Q A;  4CJC A;  4AC3 A;  1WVC A;  4YS8 A;  4KPX A;  2YC5 A;  4Y7G A;  3EE5 A;  4G3S A;  2VXL A;  2ICY A;  3D5N A;  1NF5 B;  3SX8 A;  4B5B A;  2D7R A;  2JCO A;  3T7O A;  5C48 A;  4HO2 A;  3LW6 A;  5EJZ A;  5IDT A;  3BRK X;  1LL0 A;  3SX5 A;  1K4V A;  4LW3 A;  3ZLL A;  5C49 A;  4L41 C;  2Q4J A;  2QKX A;  4CVH A;  1G93 A;  3K8E A;  2X65 A;  4EEO A;  4G87 A;  1W77 A;  2VS4 A;  1FWY A;  1H5S D;  1R81 A;  5FV9 A;  2YC3 A;  4HO5 A;  1GWV A;  3E26 A;  2XMH A;  3T7N A;  1H4C A;  2RJ8 A;  1R7T A;  2V0K A;  1GX4 A;  2O1H A;  3POL A;  2Y4M A;  4D0T A;  2AM3 A;  2GGO A;  4FRA A;  3V90 A;  2E3D A;  5CMH A;  2AEC A;  2RIY A;  1H5T B;  3IOH A;  2OEG A;  5FU0 A;  4HO4 A;  4NAK A;  2AE7 A;  1ZDG A;  4FRH A;  5FTV A;  1EYR A;  1GWW A;  1H7L A;  1VH3 A;  1WT2 A;  2WVK A;  1VGU A;  2VS5 A;  4Y6N A;  1TZF A;  4M28 A;  1QWJ A;  1H7E A;  1H7T A;  4M2B A;  5C1G A;  3SXB A;  5C4C A;  1VM8 A;  4D11 A;  1R7U A;  3V8Y A;  2CU2 A;  2OI5 A;  2I5K A;  5AJO A;  5C3B A;  3DK5 A;  3CKV A;  1G8O A;  4KT7 A;  4KXO A;  5JQQ A;  3U2U A;  4CJ8 A;  4HG6 A;  4ASY A;  1W57 A;  1NHE B;  1H5S C;  3CU0 A;  5C1L A;  1IIM A;  1JYK A;  5C4B A;  2DPW A;  1G3L A;  4HO6 A;  3U2T A;  2RJ7 A;  1OMZ A;  1H5T A;  4KC4 A;  1PZT A;  4HCQ A;  1ZJP A;  4KRV A;  1VIC A;  3V91 A;  5FU8 A;  4FRD A;  2Y6P A;  4B42 A;  3JTJ A;  1HM9 A;  5IDS A;  2BO6 A;  2I5E A;  1S4O A;  2GGQ A;  2ZU9 A;  4FQW A;  1O7Q A;  5CMG X;  1G95 A;  1ZJ0 A;  2BO8 A;  2AM5 A;  1ZIZ A;  1H5S B;  4AYL A;  4Y7T A;  1H7Q A;  4XWI A;  1LZJ A;  2UX8 A;  5CQL X;  2RJ4 A;  1INJ A;  4E1K A;  4IRQ A;  1TW5 A;  2O1G A;  2D7I A;  5C1H A;  1JYL A;  5FUH A;  2W0W A;  2ZU8 A;  3V0M A;  3CKJ A;  1OMX A;  4EEA A;  3OH2 A;  5AJN A;  5C3D A;  1FZW A;  1G0R A;  3IOJ A;  3V0N A;  4Y62 A;  1R80 A;  4D11 C;  1GX0 A;  3R3I A;  5J49 A;  3JUK A;  2MZB A;  4KNR A;  1NKH B;  2VS3 A;  4HO0 A;  2AGD A;  2BO4 A;  3OH0 A;  2RJ9 A; 
#chains in the Genus database with same CATH topology
 1FG5 N;  1NQI B;  2V0H A;  3U2W A;  1INI A;  1LL2 A;  3T7M A;  1PZY B;  3SXA A;  3R2W A;  2YQS A;  4Y63 A;  2D0J A;  1H5S A;  2V0I A;  4Y7F A;  1HV9 A;  4B4G A;  1FO9 A;  5DDV A;  1H7H A;  2RJ0 A;  5FYE A;  3USQ A;  4J18 A;  3RMV A;  3SX7 A;  2QGI A;  1JVD A;  1G97 A;  1GA8 A;  2AH9 A;  5EJ1 A;  1VZX A;  1ON6 A;  2A8U A;  3Q80 A;  4B4M A;  4JD0 A;  5D92 A;  4FIX A;  3NGW A;  1ZHJ A;  4M2A A;  5CQM X;  1HJL A;  3SXD A;  3I0H A;  3U2X A;  4BMA A;  4FRQ A;  2RIX A;  1FR8 A;  4NAL A;  4MND A;  2E8B A;  1V82 A;  1YRO B;  5CQN X;  4FRM A;  2RIZ A;  4HOC A;  1WT3 A;  2RJ6 A;  1MP5 A;  1ZCU A;  3CKN A;  3ZLK A;  3OH4 A;  4FIY A;  1YP4 A;  2QH5 A;  5AJP A;  2VSH A;  1G2V A;  1ZJ1 A;  5C4E A;  4O6N A;  1I52 A;  1QGQ A;  2WEE A;  1MP3 A;  3K8D A;  3PNN A;  3Q4S A;  5C8R A;  2XME A;  1YP3 A;  4HO8 A;  3HL3 A;  1VGW A;  3N9W A;  4FCE A;  3Q7U A;  1Z90 A;  4Y64 A;  1JV3 A;  3I0G A;  4FRE A;  1ZDF A;  2X5Z A;  3PKQ A;  2ICX A;  1WT0 A;  1FXJ A;  2NXV A;  5FTS A;  3ZF8 A;  4KC2 A;  4Y7U A;  2Y7A A;  1KWS A;  1HJJ A;  5C4D A;  5CQP A;  2Y4L A;  1G23 A;  3CKO A;  1H4D A;  4NAN A;  3OH1 A;  3F1Y A;  2RIT A;  1G1L A;  3GUE A;  4EVW A;  4P00 A;  4KC1 A;  1R7X A;  2WVL A;  1GQ9 A;  4FRO A;  3ZGF A;  1S4N A;  2VSI A;  3U2V A;  1E5K A;  4MYB A;  5C4F A;  1VZU A;  1FOA A;  5CQO A;  1VH1 A;  4B2X A;  1H5R B;  3OH3 A;  4BQH A;  2WAW A;  1JV1 A;  3JUJ A;  1QG8 A;  3QVB A;  4EE5 A;  3KIA A;  4Q7C A;  4DEC A;  4IRP A;  4C2S A;  2BO7 A;  3D98 A;  4M4K A;  4LW6 A;  3OKR A;  1LZI A;  3V0L A;  2XWM A;  2VK9 A;  1V84 A;  2FY7 A;  4FRL A;  2WE9 A;  3V0O A;  2OEF A;  1H3M A;  4KPZ A;  4JIS A;  1VGT A;  1NMM B;  3SXG A;  3TZT A;  1QGS A;  5C36 A;  2FFU A;  2VFZ A;  3RSB A;  3ST8 A;  1FGG A;  3OGZ A;  3BCV A;  4Y9X A;  4ASJ A;  4CJB A;  4EEM A;  3F1C A;  3RMW A;  1H7G A;  2Y4J A;  4KNX A;  2OI6 A;  3U0Y A;  3ZGG A;  2W0V A;  1H4E A;  1ZI1 A;  1ZJO A;  2V0L A;  2YQC A;  3SX3 A;  1LVW A;  1ZCY A;  3V8Z A;  3DUV A;  2VXM A;  4B3U A;  3I0F A;  5C47 A;  5IFY A;  4D0Z A;  2YCM A;  3SPT A;  2PGY A;  5DDT A;  3SXC A;  4NAI A;  1ZI3 A;  4K6R A;  2FYB A;  1GQC A;  3DJ4 A;  1R82 A;  2FYA A;  4G3Q A;  2JCL A;  1ZJ2 A;  1YP2 A;  1O7O A;  4O6M A;  2P6W A;  1LZ0 A;  1VPA A;  4EEG A;  5HS2 A;  5L6V A;  4Y6U A;  1ZI4 A;  4FCU A;  2RJ1 A;  1HM8 A;  3I0D A;  2JCK A;  4Y7V A;  1SS9 A;  1W55 A;  3FWW A;  2PX7 A;  3USR A;  2J0B A;  1VGZ A;  4HO9 A;  1ON8 A;  4HO3 A;  1ZJ3 A;  4B2W A;  3I0K A;  5C3A A;  1MC3 A;  5BXC A;  1EZI A;  3IOI A;  1FGX A;  5C38 A;  3I0J A;  2VD4 A;  1VZT A;  5EIY A;  2YES A;  4P02 A;  1TVY A;  5L6S A;  2JCJ A;  1ZCT A;  2Z86 A;  5D91 A;  1JVG A;  2X60 A;  4ARW A;  1G9R A;  2AM4 A;  4FRB A;  2V0J A;  1FRW A;  1OQM B;  1MP4 A;  3OAM A;  2P73 A;  2X5S A;  4ECM A;  1H7F A;  2FYD B;  3CKQ A;  4AAW A;  2FFV A;  1FO8 A;  4D48 A;  1FR9 A;  1O0R A;  4DDZ A;  4G3P A;  3SXE A;  1XZ6 A;  1ZCV A;  1R7V A;  3TQD A;  2AES A;  2PA4 A;  3E25 A;  4AYJ A;  4B4B A;  4EE3 A;  3PKP A;  3I0C A;  3I0E A;  1WSZ A;  5CMF X;  1IIN A;  4ZDQ A;  1NWG B;  1S4P A;  1TW1 A;  3I0I X;  2PGV A;  4KQL A;  2XWN A;  5I1F A;  4DE7 A;  5CMJ A;  2APC A;  3O3P A;  2WGZ A;  1LZ7 A;  3CGX A;  4EE4 A;  3FOQ A;  2YQJ A;  4UEG A;  2I7B A;  3V0P A;  1V83 A;  2FYC B;  1FXO A;  2OI7 A;  2Y4K A;  3I0L A;  1O23 B;  1XHB A;  2WVM A;  2RJ5 A;  2P72 A;  1ZI5 A;  4FRP A;  2Z87 A;  1LL3 A;  1H5R A;  1HM0 A;  5CMI A;  2A8W A;  1R7Y A;  2XWL A;  2ZU7 A;  4GBP A;  4R7P A;  3U0X A;  3OC9 A;  2O1F A;  1WT1 A;  2YQH A;  3D8V A;  3V0Q A;  4CJC A;  4AC3 A;  1WVC A;  4YS8 A;  4KPX A;  2YC5 A;  4Y7G A;  3EE5 A;  4G3S A;  2VXL A;  2ICY A;  3D5N A;  1NF5 B;  3SX8 A;  4B5B A;  2D7R A;  2JCO A;  3T7O A;  5C48 A;  4HO2 A;  3LW6 A;  5EJZ A;  5IDT A;  3BRK X;  1LL0 A;  3SX5 A;  1K4V A;  4LW3 A;  3ZLL A;  5C49 A;  4L41 C;  2Q4J A;  2QKX A;  4CVH A;  1G93 A;  3K8E A;  2X65 A;  4EEO A;  4G87 A;  1W77 A;  2VS4 A;  1FWY A;  1H5S D;  1R81 A;  5FV9 A;  2YC3 A;  4HO5 A;  1GWV A;  3E26 A;  2XMH A;  3T7N A;  1H4C A;  2RJ8 A;  1R7T A;  2V0K A;  1GX4 A;  2O1H A;  3POL A;  2Y4M A;  4D0T A;  2AM3 A;  2GGO A;  4FRA A;  3V90 A;  2E3D A;  5CMH A;  2C0N A;  2AEC A;  2RIY A;  1H5T B;  3IOH A;  2OEG A;  5FU0 A;  4HO4 A;  4NAK A;  2AE7 A;  1ZDG A;  4FRH A;  5FTV A;  1EYR A;  1GWW A;  1H7L A;  1VH3 A;  1WT2 A;  2WVK A;  1VGU A;  2VS5 A;  4Y6N A;  1TZF A;  4M28 A;  1QWJ A;  1H7E A;  1H7T A;  4M2B A;  5C1G A;  3SXB A;  5C4C A;  1VM8 A;  4D11 A;  1R7U A;  3V8Y A;  2CU2 A;  2OI5 A;  2I5K A;  5AJO A;  5C3B A;  3DK5 A;  3CKV A;  1G8O A;  4KT7 A;  4KXO A;  5JQQ A;  3U2U A;  4CJ8 A;  4HG6 A;  4ASY A;  1W57 A;  1NHE B;  1H5S C;  3CU0 A;  5C1L A;  1IIM A;  1JYK A;  5C4B A;  2DPW A;  1G3L A;  4HO6 A;  3U2T A;  2RJ7 A;  2J0A A;  1OMZ A;  1H5T A;  4KC4 A;  1PZT A;  4HCQ A;  1ZJP A;  4KRV A;  1VIC A;  3V91 A;  5FU8 A;  4FRD A;  2Y6P A;  4MIX A;  3JTJ A;  4B42 A;  1HM9 A;  5IDS A;  2BO6 A;  2I5E A;  1S4O A;  2GGQ A;  2ZU9 A;  4FQW A;  1O7Q A;  5CMG X;  1G95 A;  1ZJ0 A;  2BO8 A;  2AM5 A;  1ZIZ A;  1H5S B;  4AYL A;  4Y7T A;  1H7Q A;  4XWI A;  1LZJ A;  2UX8 A;  5CQL X;  2RJ4 A;  1INJ A;  4E1K A;  4IRQ A;  1TW5 A;  2O1G A;  2D7I A;  5C1H A;  1JYL A;  5FUH A;  2W0W A;  2ZU8 A;  3V0M A;  3CKJ A;  1OMX A;  4EEA A;  3OH2 A;  5AJN A;  5C3D A;  1FZW A;  1G0R A;  3IOJ A;  3V0N A;  4Y62 A;  1R80 A;  4D11 C;  1GX0 A;  3R3I A;  5J49 A;  3JUK A;  2MZB A;  4KNR A;  1NKH B;  2VS3 A;  4HO0 A;  2AGD A;  2BO4 A;  3OH0 A;  2RJ9 A; 
#chains in the Genus database with same CATH homology
 1FG5 N;  1NQI B;  2V0H A;  3U2W A;  1INI A;  1LL2 A;  3T7M A;  1PZY B;  3SXA A;  3R2W A;  2YQS A;  4Y63 A;  2D0J A;  1H5S A;  2V0I A;  4Y7F A;  1HV9 A;  4B4G A;  1FO9 A;  5DDV A;  1H7H A;  2RJ0 A;  5FYE A;  3USQ A;  4J18 A;  3RMV A;  3SX7 A;  2QGI A;  1JVD A;  1G97 A;  1GA8 A;  2AH9 A;  5EJ1 A;  1VZX A;  1ON6 A;  2A8U A;  3Q80 A;  4B4M A;  4JD0 A;  5D92 A;  4FIX A;  3NGW A;  1ZHJ A;  4M2A A;  5CQM X;  1HJL A;  3SXD A;  3I0H A;  3U2X A;  4BMA A;  4FRQ A;  2RIX A;  1FR8 A;  4NAL A;  4MND A;  2E8B A;  1V82 A;  1YRO B;  5CQN X;  4FRM A;  2RIZ A;  4HOC A;  1WT3 A;  2RJ6 A;  1MP5 A;  1ZCU A;  3CKN A;  3ZLK A;  3OH4 A;  4FIY A;  1YP4 A;  2QH5 A;  5AJP A;  2VSH A;  1G2V A;  1ZJ1 A;  5C4E A;  4O6N A;  1I52 A;  1QGQ A;  2WEE A;  1MP3 A;  3K8D A;  3PNN A;  3Q4S A;  5C8R A;  2XME A;  1YP3 A;  4HO8 A;  3HL3 A;  1VGW A;  3N9W A;  4FCE A;  3Q7U A;  1Z90 A;  4Y64 A;  1JV3 A;  3I0G A;  4FRE A;  1ZDF A;  2X5Z A;  3PKQ A;  2ICX A;  1WT0 A;  1FXJ A;  2NXV A;  5FTS A;  3ZF8 A;  4KC2 A;  4Y7U A;  2Y7A A;  1KWS A;  1HJJ A;  5C4D A;  5CQP A;  2Y4L A;  1G23 A;  3CKO A;  1H4D A;  4NAN A;  3OH1 A;  3F1Y A;  2RIT A;  1G1L A;  3GUE A;  4EVW A;  4P00 A;  4KC1 A;  1R7X A;  2WVL A;  1GQ9 A;  4FRO A;  3ZGF A;  1S4N A;  2VSI A;  3U2V A;  1E5K A;  4MYB A;  5C4F A;  1VZU A;  1FOA A;  5CQO A;  1VH1 A;  4B2X A;  1H5R B;  3OH3 A;  4BQH A;  2WAW A;  1JV1 A;  3JUJ A;  1QG8 A;  3QVB A;  4EE5 A;  3KIA A;  4Q7C A;  4DEC A;  4IRP A;  4C2S A;  2BO7 A;  3D98 A;  4M4K A;  4LW6 A;  3OKR A;  1LZI A;  3V0L A;  2XWM A;  2VK9 A;  1V84 A;  2FY7 A;  4FRL A;  2WE9 A;  3V0O A;  2OEF A;  1H3M A;  4KPZ A;  4JIS A;  1VGT A;  1NMM B;  3SXG A;  3TZT A;  1QGS A;  5C36 A;  2FFU A;  2VFZ A;  3RSB A;  3ST8 A;  1FGG A;  3OGZ A;  3BCV A;  4Y9X A;  4ASJ A;  4CJB A;  4EEM A;  3F1C A;  3RMW A;  1H7G A;  2Y4J A;  4KNX A;  2OI6 A;  3U0Y A;  3ZGG A;  2W0V A;  1H4E A;  1ZI1 A;  1ZJO A;  2V0L A;  2YQC A;  3SX3 A;  1LVW A;  1ZCY A;  3V8Z A;  3DUV A;  2VXM A;  4B3U A;  3I0F A;  5C47 A;  5IFY A;  4D0Z A;  2YCM A;  3SPT A;  2PGY A;  5DDT A;  3SXC A;  4NAI A;  1ZI3 A;  4K6R A;  2FYB A;  1GQC A;  3DJ4 A;  1R82 A;  2FYA A;  4G3Q A;  2JCL A;  1ZJ2 A;  1YP2 A;  1O7O A;  4O6M A;  2P6W A;  1LZ0 A;  1VPA A;  4EEG A;  5HS2 A;  5L6V A;  4Y6U A;  1ZI4 A;  4FCU A;  2RJ1 A;  1HM8 A;  3I0D A;  2JCK A;  4Y7V A;  1SS9 A;  1W55 A;  3FWW A;  2PX7 A;  3USR A;  2J0B A;  1VGZ A;  4HO9 A;  1ON8 A;  4HO3 A;  1ZJ3 A;  4B2W A;  3I0K A;  5C3A A;  1MC3 A;  5BXC A;  1EZI A;  3IOI A;  1FGX A;  5C38 A;  3I0J A;  2VD4 A;  1VZT A;  5EIY A;  2YES A;  4P02 A;  1TVY A;  5L6S A;  2JCJ A;  1ZCT A;  2Z86 A;  5D91 A;  1JVG A;  2X60 A;  4ARW A;  1G9R A;  2AM4 A;  4FRB A;  2V0J A;  1FRW A;  1OQM B;  1MP4 A;  3OAM A;  2P73 A;  2X5S A;  4ECM A;  1H7F A;  2FYD B;  3CKQ A;  4AAW A;  2FFV A;  1FO8 A;  4D48 A;  1FR9 A;  1O0R A;  4DDZ A;  4G3P A;  3SXE A;  1XZ6 A;  1ZCV A;  1R7V A;  3TQD A;  2AES A;  2PA4 A;  3E25 A;  4AYJ A;  4B4B A;  4EE3 A;  3PKP A;  3I0C A;  3I0E A;  1WSZ A;  5CMF X;  1IIN A;  4ZDQ A;  1NWG B;  1S4P A;  1TW1 A;  3I0I X;  2PGV A;  4KQL A;  2XWN A;  5I1F A;  4DE7 A;  5CMJ A;  2APC A;  3O3P A;  2WGZ A;  1LZ7 A;  3CGX A;  4EE4 A;  3FOQ A;  2YQJ A;  4UEG A;  2I7B A;  3V0P A;  1V83 A;  2FYC B;  1FXO A;  2OI7 A;  2Y4K A;  3I0L A;  1O23 B;  1XHB A;  2WVM A;  2RJ5 A;  2P72 A;  1ZI5 A;  4FRP A;  2Z87 A;  1LL3 A;  1H5R A;  1HM0 A;  5CMI A;  2A8W A;  1R7Y A;  2XWL A;  2ZU7 A;  4GBP A;  4R7P A;  3U0X A;  3OC9 A;  2O1F A;  1WT1 A;  2YQH A;  3D8V A;  3V0Q A;  4CJC A;  4AC3 A;  1WVC A;  4YS8 A;  4KPX A;  2YC5 A;  4Y7G A;  3EE5 A;  4G3S A;  2VXL A;  2ICY A;  3D5N A;  1NF5 B;  3SX8 A;  4B5B A;  2D7R A;  2JCO A;  3T7O A;  5C48 A;  4HO2 A;  3LW6 A;  5EJZ A;  5IDT A;  3BRK X;  1LL0 A;  3SX5 A;  1K4V A;  4LW3 A;  3ZLL A;  5C49 A;  4L41 C;  2Q4J A;  2QKX A;  4CVH A;  1G93 A;  3K8E A;  2X65 A;  4EEO A;  4G87 A;  1W77 A;  2VS4 A;  1FWY A;  1H5S D;  1R81 A;  5FV9 A;  2YC3 A;  4HO5 A;  1GWV A;  3E26 A;  2XMH A;  3T7N A;  1H4C A;  2RJ8 A;  1R7T A;  2V0K A;  1GX4 A;  2O1H A;  3POL A;  2Y4M A;  4D0T A;  2AM3 A;  2GGO A;  4FRA A;  3V90 A;  2E3D A;  5CMH A;  2C0N A;  2AEC A;  2RIY A;  1H5T B;  3IOH A;  2OEG A;  5FU0 A;  4HO4 A;  4NAK A;  2AE7 A;  1ZDG A;  4FRH A;  5FTV A;  1EYR A;  1GWW A;  1H7L A;  1VH3 A;  1WT2 A;  2WVK A;  1VGU A;  2VS5 A;  4Y6N A;  1TZF A;  4M28 A;  1QWJ A;  1H7E A;  1H7T A;  4M2B A;  5C1G A;  3SXB A;  5C4C A;  1VM8 A;  4D11 A;  1R7U A;  3V8Y A;  2CU2 A;  2OI5 A;  2I5K A;  5AJO A;  5C3B A;  3DK5 A;  3CKV A;  1G8O A;  4KT7 A;  4KXO A;  5JQQ A;  3U2U A;  4CJ8 A;  4HG6 A;  4ASY A;  1W57 A;  1NHE B;  1H5S C;  3CU0 A;  5C1L A;  1IIM A;  1JYK A;  5C4B A;  2DPW A;  1G3L A;  4HO6 A;  3U2T A;  2RJ7 A;  2J0A A;  1OMZ A;  1H5T A;  4KC4 A;  1PZT A;  4HCQ A;  1ZJP A;  4KRV A;  1VIC A;  3V91 A;  5FU8 A;  4FRD A;  2Y6P A;  4MIX A;  3JTJ A;  4B42 A;  1HM9 A;  5IDS A;  2BO6 A;  2I5E A;  1S4O A;  2GGQ A;  2ZU9 A;  4FQW A;  1O7Q A;  5CMG X;  1G95 A;  1ZJ0 A;  2BO8 A;  2AM5 A;  1ZIZ A;  1H5S B;  4AYL A;  4Y7T A;  1H7Q A;  4XWI A;  1LZJ A;  2UX8 A;  5CQL X;  2RJ4 A;  1INJ A;  4E1K A;  4IRQ A;  1TW5 A;  2O1G A;  2D7I A;  5C1H A;  1JYL A;  5FUH A;  2W0W A;  2ZU8 A;  3V0M A;  3CKJ A;  1OMX A;  4EEA A;  3OH2 A;  5AJN A;  5C3D A;  1FZW A;  1G0R A;  3IOJ A;  3V0N A;  4Y62 A;  1R80 A;  4D11 C;  1GX0 A;  3R3I A;  5J49 A;  3JUK A;  2MZB A;  4KNR A;  1NKH B;  2VS3 A;  4HO0 A;  2AGD A;  2BO4 A;  3OH0 A;  2RJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...