3V0OA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-galnac derived inhibitor (4gw) and h-antigen acceptor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified donor analogues reveal novel dynamic features of a glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0oA00
3SXGA 1WSZA 1R7YA 2JCOA 4HO2A 1INIA 3RMVA 5C48A 2QKXA 1ZCTA 2WGZA 4CJ8A 1TZFA 2FYAA 2VS5A 3BCVA 1G23A 3IOHA 4AYLA 4Y7FA 4CVHA 1VH1A 5C8RA 1R7UA 4KC2A 1EYRA 1YP3A 1ZI3A 3V91A 5JQQA 5FYEA 1H5SB 1NHEB 3OGZA 3I0LA 1YROB 2FYCB 1OMXA 2AGDA 2AM3A 2Y4MA 2Z86A 4G3SA 1G9RA 2BO4A 2RJ9A 4AAWA 1H5RB 3RMWA 2D0JA 3DK5A 5C4CA 1S4OA 5CQNX 2ICYA 1GWVA 1GX0A 4EE5A 2RITA 4R7PA 1G8OA 5IDSA 1VZXA 1ZCUA 1HM9A 4FRMA 5AJPA 1JYKA 1EZIA 1FXJA 1TW5A 4AC3A 5CQOA 4XWIA 2BO8A 2NXVA 4NAKA 4EE4A 5C4EA 3I0GA 1H5TA 5EJ1A 1MP4A 2RJ4A 1WVCA 4FREA 2ZU9A 1WT1A 2VSIA 3I0IX 5DDVA 3I0DA 4HO3A 1LVWA 2GGOA 2WVKA 2XMEA 3EE5A 3ZLKA 3SX8A 5HS2A 1HJLA 1GQ9A 3QVBA 3F1YA 4E1KA 4B4GA 4LW3A 1MP5A 1O7QA 1ZIZA 3SXCA 1ZI1A 3V0QA 1JVGA 3Q7UA 5CMIA 4HCQA 1H4CA 1R7VA 5CMHA 5C4BA 1LZ0A 3USQA 2AECA 4CJBA 3V0MA 1G2VA 5CMGX 3D98A 4FRLA 3U0YA 1ZJPA 1NMMB 4ASYA 3JTJA 1MP3A 3ZGGA 3OC9A 4CJCA 1HV9A 1PZTA 1FO9A 5BXCA 2P73A 5C1HA 2RJ8A 3T7OA 4Y9XA 2I5KA 3OH0A 4DDZA 4FRAA 3DUVA 2PGYA 4HG6A 2FFVA 2RJ5A 5C38A 5CMFX 2Y6PA 1LZIA 3SX7A 1VZTA 2PA4A 1QGQA 2XWMA 4Y7GA 2I5EA 2FY7A 1VICA 5EIYA 1H7HA 4FQWA 3K8EA 3OH1A 1FZWA 4FCEA 2OI5A 4ASJA 4UEGA 2A8UA 2XWLA 2YQHA 1R81A 1WT3A 1FGGA 1H5TB 2RIYA 1PZYB 4EEMA 4EEAA 2X5SA 3I0FA 4FRPA 1ZJOA 1GA8A 1G95A 2RJ6A 3SPTA 1FR8A 2WE9A 3CKQA 1Z90A 1ZJ0A 2VFZA 2W0VA 1ZJ2A 1YP4A 3V90A 4JISA 4GBPA 4C2SA 1LZJA 1G3LA 3TZTA 2QH5A 4IRPA 2E3DA 3E26A 3SX5A 1IIMA 1R82A 1QWJA 5C36A 1H7TA 3I0JA 2DPWA 4KXOA 5FU0A 2V0KA 1I52A 3D5NA 3IOIA 4KT7A 5C3AA 1R7XA 5C3DA 3POLA 3U2WA 1JV3A 2OEFA 2X60A 5C1LA 2ZU7A 2D7IA 4Y7VA 3DJ4A 3V0NA 1IINA 2MZBA 1WT2A 1H7EA 1ZDFA 3U2TA 1VPAA 1H5SC 4K6RA 2ZU8A 2FFUA 2APCA 2FYDB 4D48A 2D7RA 1FGXA 4DE7A 1VM8A 1W55A 4FRDA 1NWGB 3CGXA 3V0LA 3CKNA 2O1FA 2VS3A 2AM5A 1G1LA 4L41C 1H5SD 2E8BA 3N9WA 1LL3A 2YQCA 2XMHA 5I1FA 1VGWA 4NALA 4G3QA 3D8VA 1LL0A 1XHBA 1ZI4A 3ZGFA 2I7BA 4EEGA 2RIXA 2UX8A 1TW1A 4NAIA 3PKQA 3RSBA 1R80A 5FTVA 4B4MA 2GGQA 1H3MA 2BO6A 4MYBA 1ZJ1A 1ZDGA 3Q80A 1FO8A 2OEGA 1ZCVA 3IOJA 2YC5A 4YS8A 4P02A 1NF5B 3KIAA 2XWNA 3CU0A 2YQJA 4Y6UA 2PX7A 1W57A 2VXMA 5IFYA 3OKRA 3SX3A 2QGIA 4BQHA 5IDTA 2WEEA 2AM4A 3U0XA 2FYBA 1ZJ3A 2X5ZA 1SS9A 3V0OA 4B2XA 1NKHB 4FRHA 2O1HA 1OQMB 2X65A 1H7GA 5C3BA 4BMAA 3T7NA 3K8DA 4HOCA 1ZCYA 2O1GA 2RIZA 3TQDA 1FG5N 2V0HA 4Y6NA 3ZF8A 4HO4A 5C4DA 5CQMX 4HO6A 4M2BA 2AESA 4ECMA 3OH2A 2V0IA 2AH9A 4P00A 3FOQA 2V0LA 1H4EA 2CU2A 1XZ6A 4KNRA 4DECA 1V83A 3R3IA 4ZDQA 4B5BA 4IRQA 3JUKA 1LL2A 3JUJA 2RJ0A 4EVWA 1H4DA 4EE3A 2W0WA 3HL3A 3V8ZA 5CQPA 2Y4JA 4HO9A 1ZI5A 1MC3A 2P6WA 1V82A 3USRA 3FWWA 1O0RA 4KQLA 2VXLA 4AYJA 1H7FA 3ZLLA 1HJJA 1O23B 3CKOA 2YQSA 2VD4A 2YC3A 3Q4SA 1VGUA 1JV1A 5C47A 3SXBA 3U2UA 5FV9A 2VSHA 4Y7TA 4JD0A 3SXAA 3O3PA 4KC1A 2A8WA 4ARWA 2Y7AA 4Y63A 4HO8A 5DDTA 2RJ7A 1JVDA 4FRBA 1FOAA 2WAWA 4M28A 1E5KA 3I0KA 5CMJA 3LW6A 2YCMA 2PGVA 3CKVA 1G93A 4NANA 2JCLA 4HO5A 3U2VA 2Y4KA 5EJZA 4FRQA 2JCJA 1OMZA 3I0HA 5C4FA 4Y7UA 1HM8A 2Z87A 4KNXA 4D11C 2OI6A 4G87A 4FROA 4D0TA 1GWWA 4LW6A 5AJNA 3U2XA 1VZUA 1FWYA 1FRWA 1S4NA 1TVYA 5FU8A 4MNDA 3OAMA 2BO7A 1S4PA 4KPZA 2JCKA 1ON6A 1VGTA 1H7QA 4B2WA 1ZHJA 4HO0A 3BRKX 5L6SA 4FCUA 4J18A 1K4VA 3OH4A 3PKPA 2P72A 3F1CA 5L6VA 1V84A 2Q4JA 1WT0A 1HM0A 5FTSA 3CKJA 2V0JA 3E25A 5FUHA 1VGZA 5J49A 4Y62A 1G97A 5C1GA 1H5SA 2Y4LA 4B3UA 1QGSA 1R7TA 4B4BA 4Y64A 1QG8A 3R2WA 2WVMA 1VH3A 1H5RA 1ON8A 1INJA 3SXDA 2YESA 3T7MA 1YP2A 3NGWA 2AE7A 4KRVA 1FXOA 2WVLA 3I0EA 5C49A 3I0CA 1W77A 4D0ZA 4D11A 1H7LA 1JYLA 2OI7A 3OH3A 4KC4A 4M2AA 3V0PA 1O7OA 1GQCA 5AJOA 2ICXA 2VS4A 2RJ1A 4KPXA 4B42A 3SXEA 3ST8A 1G0RA 4EEOA 4G3PA 1LZ7A 3V8YA 1KWSA 1NQIB 5CQLX 3PNNA 1GX4A 4M4KA 3GUEA 1FR9A
chains in the Genus database with same CATH superfamily
3SXGA 4FIXA 1WSZA 1R7YA 5D92A 2JCOA 4HO2A 1INIA 3RMVA 5C48A 2QKXA 1ZCTA 2WGZA 4CJ8A 1TZFA 2FYAA 2VS5A 3BCVA 1G23A 3IOHA 4AYLA 4Y7FA 4CVHA 1VH1A 5C8RA 1R7UA 4KC2A 1EYRA 1YP3A 1ZI3A 3V91A 5JQQA 5FYEA 1H5SB 1NHEB 3OGZA 3I0LA 1YROB 2FYCB 1OMXA 2AGDA 2AM3A 2Y4MA 2Z86A 4G3SA 1G9RA 2BO4A 2RJ9A 4AAWA 1H5RB 3RMWA 2D0JA 2VK9A 3DK5A 5C4CA 1S4OA 5CQNX 2ICYA 1GWVA 1GX0A 4EE5A 2RITA 4R7PA 1G8OA 5IDSA 1VZXA 1ZCUA 1HM9A 4FRMA 5AJPA 1JYKA 1EZIA 1FXJA 1TW5A 4AC3A 5CQOA 4XWIA 2BO8A 2NXVA 4NAKA 4EE4A 5C4EA 3I0GA 1H5TA 5EJ1A 1MP4A 2RJ4A 1WVCA 4FREA 2ZU9A 1WT1A 2VSIA 3I0IX 5DDVA 3I0DA 4HO3A 1LVWA 2GGOA 2WVKA 2XMEA 3EE5A 3ZLKA 3SX8A 5HS2A 1HJLA 1GQ9A 3QVBA 3F1YA 4E1KA 4B4GA 4LW3A 1MP5A 1O7QA 1ZIZA 3SXCA 1ZI1A 3V0QA 1JVGA 3Q7UA 5CMIA 4HCQA 1H4CA 1R7VA 5CMHA 5C4BA 1LZ0A 3USQA 2AECA 4CJBA 3V0MA 1G2VA 5D91A 5CMGX 3D98A 4FRLA 3U0YA 1ZJPA 1NMMB 4ASYA 3JTJA 1MP3A 3ZGGA 3OC9A 4CJCA 1HV9A 1PZTA 1FO9A 5BXCA 2P73A 5C1HA 2RJ8A 3T7OA 4Y9XA 2I5KA 3OH0A 4FIYA 4DDZA 4FRAA 3DUVA 2PGYA 4HG6A 2FFVA 2RJ5A 5C38A 5CMFX 2Y6PA 1LZIA 3SX7A 1VZTA 2PA4A 1QGQA 2XWMA 4Y7GA 2I5EA 2FY7A 1VICA 5EIYA 1H7HA 4FQWA 3K8EA 3OH1A 1FZWA 4FCEA 2OI5A 4ASJA 4UEGA 2A8UA 2XWLA 2YQHA 1R81A 1WT3A 1FGGA 1H5TB 2RIYA 1PZYB 4EEMA 4EEAA 2X5SA 3I0FA 4Q7CA 4FRPA 1ZJOA 1GA8A 1G95A 2RJ6A 3SPTA 1FR8A 2WE9A 3CKQA 1Z90A 1ZJ0A 2VFZA 2W0VA 1ZJ2A 1YP4A 4O6NA 3V90A 4JISA 4GBPA 4C2SA 1LZJA 1G3LA 3TZTA 2QH5A 4IRPA 2E3DA 3E26A 3SX5A 1IIMA 1R82A 1QWJA 5C36A 1H7TA 3I0JA 2DPWA 4KXOA 5FU0A 2V0KA 1I52A 3D5NA 3IOIA 4KT7A 5C3AA 1R7XA 5C3DA 3POLA 3U2WA 1JV3A 2OEFA 2X60A 5C1LA 2ZU7A 2D7IA 4Y7VA 3DJ4A 3V0NA 1IINA 2MZBA 1WT2A 1H7EA 1ZDFA 3U2TA 1VPAA 1H5SC 4K6RA 2ZU8A 2FFUA 2APCA 2FYDB 4D48A 2D7RA 1FGXA 4DE7A 1VM8A 1W55A 4FRDA 1NWGB 3CGXA 3V0LA 3CKNA 2O1FA 2VS3A 2AM5A 1G1LA 4L41C 1H5SD 2E8BA 3N9WA 1LL3A 2YQCA 2XMHA 5I1FA 1VGWA 4NALA 4G3QA 3D8VA 1LL0A 1XHBA 1ZI4A 2C0NA 3ZGFA 2I7BA 4EEGA 2RIXA 2UX8A 1TW1A 4NAIA 3PKQA 3RSBA 1R80A 5FTVA 4B4MA 2GGQA 1H3MA 2BO6A 4MYBA 1ZJ1A 1ZDGA 3Q80A 1FO8A 2OEGA 1ZCVA 3IOJA 2YC5A 4YS8A 4P02A 1NF5B 3KIAA 2XWNA 3CU0A 2YQJA 4Y6UA 2PX7A 1W57A 2VXMA 5IFYA 3OKRA 3SX3A 2QGIA 4BQHA 5IDTA 2WEEA 2AM4A 3U0XA 2FYBA 1ZJ3A 2X5ZA 1SS9A 3V0OA 4B2XA 1NKHB 4FRHA 2O1HA 1OQMB 2X65A 1H7GA 5C3BA 4BMAA 3T7NA 3K8DA 4HOCA 1ZCYA 2O1GA 2RIZA 3TQDA 1FG5N 2V0HA 4Y6NA 3ZF8A 4HO4A 5C4DA 5CQMX 4HO6A 4M2BA 2AESA 4ECMA 3OH2A 2V0IA 2AH9A 4P00A 3FOQA 2V0LA 1H4EA 2CU2A 1XZ6A 4KNRA 4DECA 1V83A 3R3IA 4ZDQA 4B5BA 4IRQA 3JUKA 1LL2A 3JUJA 2RJ0A 4EVWA 1H4DA 4EE3A 2W0WA 3HL3A 3V8ZA 5CQPA 2Y4JA 2J0BA 4HO9A 1ZI5A 1MC3A 2P6WA 1V82A 3USRA 3FWWA 1O0RA 4KQLA 2VXLA 4AYJA 1H7FA 3ZLLA 1HJJA 1O23B 3CKOA 2YQSA 2VD4A 2YC3A 3Q4SA 1VGUA 1JV1A 5C47A 3SXBA 3U2UA 5FV9A 2VSHA 4Y7TA 4JD0A 3SXAA 3O3PA 4KC1A 2A8WA 4ARWA 2Y7AA 4Y63A 4HO8A 5DDTA 2RJ7A 1JVDA 4FRBA 1FOAA 2WAWA 4M28A 1E5KA 3I0KA 5CMJA 3LW6A 2YCMA 2PGVA 3CKVA 1G93A 4NANA 2JCLA 4HO5A 3U2VA 2Y4KA 5EJZA 4FRQA 2JCJA 1OMZA 3I0HA 4MIXA 5C4FA 2J0AA 4Y7UA 1HM8A 2Z87A 4KNXA 4D11C 2OI6A 4G87A 4FROA 4D0TA 1GWWA 4LW6A 5AJNA 3U2XA 1VZUA 1FWYA 1FRWA 1S4NA 1TVYA 5FU8A 4MNDA 3OAMA 2BO7A 1S4PA 4KPZA 2JCKA 1ON6A 1VGTA 1H7QA 4B2WA 1ZHJA 4HO0A 3BRKX 5L6SA 4FCUA 4J18A 1K4VA 3OH4A 3PKPA 2P72A 3F1CA 5L6VA 1V84A 2Q4JA 1WT0A 1HM0A 5FTSA 3CKJA 2V0JA 3E25A 5FUHA 1VGZA 5J49A 4Y62A 1G97A 5C1GA 1H5SA 2Y4LA 4B3UA 1QGSA 1R7TA 4B4BA 4Y64A 1QG8A 3R2WA 2WVMA 1VH3A 1H5RA 1ON8A 1INJA 3SXDA 2YESA 3T7MA 1YP2A 3NGWA 2AE7A 4KRVA 1FXOA 2WVLA 3I0EA 5C49A 3I0CA 1W77A 4D0ZA 4D11A 1H7LA 1JYLA 2OI7A 3OH3A 4KC4A 4M2AA 3V0PA 1O7OA 1GQCA 4O6MA 5AJOA 2ICXA 2VS4A 2RJ1A 4KPXA 4B42A 3SXEA 3ST8A 1G0RA 4EEOA 4G3PA 1LZ7A 3V8YA 1KWSA 1NQIB 5CQLX 3PNNA 1GX4A 4M4KA 3GUEA 1FR9A
chains in the Genus database with same CATH topology
3SXGA 4FIXA 1WSZA 1R7YA 5D92A 2JCOA 4HO2A 1INIA 3RMVA 5C48A 2QKXA 1ZCTA 2WGZA 4CJ8A 1TZFA 2FYAA 2VS5A 3BCVA 1G23A 3IOHA 4AYLA 4Y7FA 4CVHA 1VH1A 5C8RA 1R7UA 4KC2A 1EYRA 1YP3A 1ZI3A 3V91A 5JQQA 5FYEA 1H5SB 1NHEB 3OGZA 3I0LA 1YROB 2FYCB 1OMXA 2AGDA 2AM3A 2Y4MA 2Z86A 4G3SA 1G9RA 2BO4A 2RJ9A 4AAWA 1H5RB 3RMWA 2D0JA 2VK9A 3DK5A 5C4CA 1S4OA 5CQNX 2ICYA 1GWVA 1GX0A 4EE5A 2RITA 4R7PA 1G8OA 5IDSA 1VZXA 1ZCUA 1HM9A 4FRMA 5AJPA 1JYKA 1EZIA 1FXJA 1TW5A 4AC3A 5CQOA 4XWIA 2BO8A 2NXVA 4NAKA 4EE4A 5C4EA 3I0GA 1H5TA 5EJ1A 1MP4A 2RJ4A 1WVCA 4FREA 2ZU9A 1WT1A 2VSIA 3I0IX 5DDVA 3I0DA 4HO3A 1LVWA 2GGOA 2WVKA 2XMEA 3EE5A 3ZLKA 3SX8A 5HS2A 1HJLA 1GQ9A 3QVBA 3F1YA 4E1KA 4B4GA 4LW3A 1MP5A 1O7QA 1ZIZA 3SXCA 1ZI1A 3V0QA 1JVGA 3Q7UA 5CMIA 4HCQA 1H4CA 1R7VA 5CMHA 5C4BA 1LZ0A 3USQA 2AECA 4CJBA 3V0MA 1G2VA 5D91A 5CMGX 3D98A 4FRLA 3U0YA 1ZJPA 1NMMB 4ASYA 3JTJA 1MP3A 3ZGGA 3OC9A 4CJCA 1HV9A 1PZTA 1FO9A 5BXCA 2P73A 5C1HA 2RJ8A 3T7OA 4Y9XA 2I5KA 3OH0A 4FIYA 4DDZA 4FRAA 3DUVA 2PGYA 4HG6A 2FFVA 2RJ5A 5C38A 5CMFX 2Y6PA 1LZIA 3SX7A 1VZTA 2PA4A 1QGQA 2XWMA 4Y7GA 2I5EA 2FY7A 1VICA 5EIYA 1H7HA 4FQWA 3K8EA 3OH1A 1FZWA 4FCEA 2OI5A 4ASJA 4UEGA 2A8UA 2XWLA 2YQHA 1R81A 1WT3A 1FGGA 1H5TB 2RIYA 1PZYB 4EEMA 4EEAA 2X5SA 3I0FA 4Q7CA 4FRPA 1ZJOA 1GA8A 1G95A 2RJ6A 3SPTA 1FR8A 2WE9A 3CKQA 1Z90A 1ZJ0A 2VFZA 2W0VA 1ZJ2A 1YP4A 4O6NA 3V90A 4JISA 4GBPA 4C2SA 1LZJA 1G3LA 3TZTA 2QH5A 4IRPA 2E3DA 3E26A 3SX5A 1IIMA 1R82A 1QWJA 5C36A 1H7TA 3I0JA 2DPWA 4KXOA 5FU0A 2V0KA 1I52A 3D5NA 3IOIA 4KT7A 5C3AA 1R7XA 5C3DA 3POLA 3U2WA 1JV3A 2OEFA 2X60A 5C1LA 2ZU7A 2D7IA 4Y7VA 3DJ4A 3V0NA 1IINA 2MZBA 1WT2A 1H7EA 1ZDFA 3U2TA 1VPAA 1H5SC 4K6RA 2ZU8A 2FFUA 2APCA 2FYDB 4D48A 2D7RA 1FGXA 4DE7A 1VM8A 1W55A 4FRDA 1NWGB 3CGXA 3V0LA 3CKNA 2O1FA 2VS3A 2AM5A 1G1LA 4L41C 1H5SD 2E8BA 3N9WA 1LL3A 2YQCA 2XMHA 5I1FA 1VGWA 4NALA 4G3QA 3D8VA 1LL0A 1XHBA 1ZI4A 2C0NA 3ZGFA 2I7BA 4EEGA 2RIXA 2UX8A 1TW1A 4NAIA 3PKQA 3RSBA 1R80A 5FTVA 4B4MA 2GGQA 1H3MA 2BO6A 4MYBA 1ZJ1A 1ZDGA 3Q80A 1FO8A 2OEGA 1ZCVA 3IOJA 2YC5A 4YS8A 4P02A 1NF5B 3KIAA 2XWNA 3CU0A 2YQJA 4Y6UA 2PX7A 1W57A 2VXMA 5IFYA 3OKRA 3SX3A 2QGIA 4BQHA 5IDTA 2WEEA 2AM4A 3U0XA 2FYBA 1ZJ3A 2X5ZA 1SS9A 3V0OA 4B2XA 1NKHB 4FRHA 2O1HA 1OQMB 2X65A 1H7GA 5C3BA 4BMAA 3T7NA 3K8DA 4HOCA 1ZCYA 2O1GA 2RIZA 3TQDA 1FG5N 2V0HA 4Y6NA 3ZF8A 4HO4A 5C4DA 5CQMX 4HO6A 4M2BA 2AESA 4ECMA 3OH2A 2V0IA 2AH9A 4P00A 3FOQA 2V0LA 1H4EA 2CU2A 1XZ6A 4KNRA 4DECA 1V83A 3R3IA 4ZDQA 4B5BA 4IRQA 3JUKA 1LL2A 3JUJA 2RJ0A 4EVWA 1H4DA 4EE3A 2W0WA 3HL3A 3V8ZA 5CQPA 2Y4JA 2J0BA 4HO9A 1ZI5A 1MC3A 2P6WA 1V82A 3USRA 3FWWA 1O0RA 4KQLA 2VXLA 4AYJA 1H7FA 3ZLLA 1HJJA 1O23B 3CKOA 2YQSA 2VD4A 2YC3A 3Q4SA 1VGUA 1JV1A 5C47A 3SXBA 3U2UA 5FV9A 2VSHA 4Y7TA 4JD0A 3SXAA 3O3PA 4KC1A 2A8WA 4ARWA 2Y7AA 4Y63A 4HO8A 5DDTA 2RJ7A 1JVDA 4FRBA 1FOAA 2WAWA 4M28A 1E5KA 3I0KA 5CMJA 3LW6A 2YCMA 2PGVA 3CKVA 1G93A 4NANA 2JCLA 4HO5A 3U2VA 2Y4KA 5EJZA 4FRQA 2JCJA 1OMZA 3I0HA 4MIXA 5C4FA 2J0AA 4Y7UA 1HM8A 2Z87A 4KNXA 4D11C 2OI6A 4G87A 4FROA 4D0TA 1GWWA 4LW6A 5AJNA 3U2XA 1VZUA 1FWYA 1FRWA 1S4NA 1TVYA 5FU8A 4MNDA 3OAMA 2BO7A 1S4PA 4KPZA 2JCKA 1ON6A 1VGTA 1H7QA 4B2WA 1ZHJA 4HO0A 3BRKX 5L6SA 4FCUA 4J18A 1K4VA 3OH4A 3PKPA 2P72A 3F1CA 5L6VA 1V84A 2Q4JA 1WT0A 1HM0A 5FTSA 3CKJA 2V0JA 3E25A 5FUHA 1VGZA 5J49A 4Y62A 1G97A 5C1GA 1H5SA 2Y4LA 4B3UA 1QGSA 1R7TA 4B4BA 4Y64A 1QG8A 3R2WA 2WVMA 1VH3A 1H5RA 1ON8A 1INJA 3SXDA 2YESA 3T7MA 1YP2A 3NGWA 2AE7A 4KRVA 1FXOA 2WVLA 3I0EA 5C49A 3I0CA 1W77A 4D0ZA 4D11A 1H7LA 1JYLA 2OI7A 3OH3A 4KC4A 4M2AA 3V0PA 1O7OA 1GQCA 4O6MA 5AJOA 2ICXA 2VS4A 2RJ1A 4KPXA 4B42A 3SXEA 3ST8A 1G0RA 4EEOA 4G3PA 1LZ7A 3V8YA 1KWSA 1NQIB 5CQLX 3PNNA 1GX4A 4M4KA 3GUEA 1FR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXG A;  1WSZ A;  1R7Y A;  2JCO A;  4HO2 A;  1INI A;  3RMV A;  5C48 A;  2QKX A;  1ZCT A;  2WGZ A;  4CJ8 A;  1TZF A;  2FYA A;  2VS5 A;  3BCV A;  1G23 A;  3IOH A;  4AYL A;  4Y7F A;  4CVH A;  1VH1 A;  5C8R A;  1R7U A;  4KC2 A;  1EYR A;  1YP3 A;  1ZI3 A;  3V91 A;  5JQQ A;  5FYE A;  1H5S B;  1NHE B;  3OGZ A;  3I0L A;  1YRO B;  2FYC B;  1OMX A;  2AGD A;  2AM3 A;  2Y4M A;  2Z86 A;  4G3S A;  1G9R A;  2BO4 A;  2RJ9 A;  4AAW A;  1H5R B;  3RMW A;  2D0J A;  3DK5 A;  5C4C A;  1S4O A;  5CQN X;  2ICY A;  1GWV A;  1GX0 A;  4EE5 A;  2RIT A;  4R7P A;  1G8O A;  5IDS A;  1VZX A;  1ZCU A;  1HM9 A;  4FRM A;  5AJP A;  1JYK A;  1EZI A;  1FXJ A;  1TW5 A;  4AC3 A;  5CQO A;  4XWI A;  2BO8 A;  2NXV A;  4NAK A;  4EE4 A;  5C4E A;  3I0G A;  1H5T A;  5EJ1 A;  1MP4 A;  2RJ4 A;  1WVC A;  4FRE A;  2ZU9 A;  1WT1 A;  2VSI A;  3I0I X;  5DDV A;  3I0D A;  4HO3 A;  1LVW A;  2GGO A;  2WVK A;  2XME A;  3EE5 A;  3ZLK A;  3SX8 A;  5HS2 A;  1HJL A;  1GQ9 A;  3QVB A;  3F1Y A;  4E1K A;  4B4G A;  4LW3 A;  1MP5 A;  1O7Q A;  1ZIZ A;  3SXC A;  1ZI1 A;  3V0Q A;  1JVG A;  3Q7U A;  5CMI A;  4HCQ A;  1H4C A;  1R7V A;  5CMH A;  5C4B A;  1LZ0 A;  3USQ A;  2AEC A;  4CJB A;  3V0M A;  1G2V A;  5CMG X;  3D98 A;  4FRL A;  3U0Y A;  1ZJP A;  1NMM B;  4ASY A;  3JTJ A;  1MP3 A;  3ZGG A;  3OC9 A;  4CJC A;  1HV9 A;  1PZT A;  1FO9 A;  5BXC A;  2P73 A;  5C1H A;  2RJ8 A;  3T7O A;  4Y9X A;  2I5K A;  3OH0 A;  4DDZ A;  4FRA A;  3DUV A;  2PGY A;  4HG6 A;  2FFV A;  2RJ5 A;  5C38 A;  5CMF X;  2Y6P A;  1LZI A;  3SX7 A;  1VZT A;  2PA4 A;  1QGQ A;  2XWM A;  4Y7G A;  2I5E A;  2FY7 A;  1VIC A;  5EIY A;  1H7H A;  4FQW A;  3K8E A;  3OH1 A;  1FZW A;  4FCE A;  2OI5 A;  4ASJ A;  4UEG A;  2A8U A;  2XWL A;  2YQH A;  1R81 A;  1WT3 A;  1FGG A;  1H5T B;  2RIY A;  1PZY B;  4EEM A;  4EEA A;  2X5S A;  3I0F A;  4FRP A;  1ZJO A;  1GA8 A;  1G95 A;  2RJ6 A;  3SPT A;  1FR8 A;  2WE9 A;  3CKQ A;  1Z90 A;  1ZJ0 A;  2VFZ A;  2W0V A;  1ZJ2 A;  1YP4 A;  3V90 A;  4JIS A;  4GBP A;  4C2S A;  1LZJ A;  1G3L A;  3TZT A;  2QH5 A;  4IRP A;  2E3D A;  3E26 A;  3SX5 A;  1IIM A;  1R82 A;  1QWJ A;  5C36 A;  1H7T A;  3I0J A;  2DPW A;  4KXO A;  5FU0 A;  2V0K A;  1I52 A;  3D5N A;  3IOI A;  4KT7 A;  5C3A A;  1R7X A;  5C3D A;  3POL A;  3U2W A;  1JV3 A;  2OEF A;  2X60 A;  5C1L A;  2ZU7 A;  2D7I A;  4Y7V A;  3DJ4 A;  3V0N A;  1IIN A;  2MZB A;  1WT2 A;  1H7E A;  1ZDF A;  3U2T A;  1VPA A;  1H5S C;  4K6R A;  2ZU8 A;  2FFU A;  2APC A;  2FYD B;  4D48 A;  2D7R A;  1FGX A;  4DE7 A;  1VM8 A;  1W55 A;  4FRD A;  1NWG B;  3CGX A;  3V0L A;  3CKN A;  2O1F A;  2VS3 A;  2AM5 A;  1G1L A;  4L41 C;  1H5S D;  2E8B A;  3N9W A;  1LL3 A;  2YQC A;  2XMH A;  5I1F A;  1VGW A;  4NAL A;  4G3Q A;  3D8V A;  1LL0 A;  1XHB A;  1ZI4 A;  3ZGF A;  2I7B A;  4EEG A;  2RIX A;  2UX8 A;  1TW1 A;  4NAI A;  3PKQ A;  3RSB A;  1R80 A;  5FTV A;  4B4M A;  2GGQ A;  1H3M A;  2BO6 A;  4MYB A;  1ZJ1 A;  1ZDG A;  3Q80 A;  1FO8 A;  2OEG A;  1ZCV A;  3IOJ A;  2YC5 A;  4YS8 A;  4P02 A;  1NF5 B;  3KIA A;  2XWN A;  3CU0 A;  2YQJ A;  4Y6U A;  2PX7 A;  1W57 A;  2VXM A;  5IFY A;  3OKR A;  3SX3 A;  2QGI A;  4BQH A;  5IDT A;  2WEE A;  2AM4 A;  3U0X A;  2FYB A;  1ZJ3 A;  2X5Z A;  1SS9 A;  3V0O A;  4B2X A;  1NKH B;  4FRH A;  2O1H A;  1OQM B;  2X65 A;  1H7G A;  5C3B A;  4BMA A;  3T7N A;  3K8D A;  4HOC A;  1ZCY A;  2O1G A;  2RIZ A;  3TQD A;  1FG5 N;  2V0H A;  4Y6N A;  3ZF8 A;  4HO4 A;  5C4D A;  5CQM X;  4HO6 A;  4M2B A;  2AES A;  4ECM A;  3OH2 A;  2V0I A;  2AH9 A;  4P00 A;  3FOQ A;  2V0L A;  1H4E A;  2CU2 A;  1XZ6 A;  4KNR A;  4DEC A;  1V83 A;  3R3I A;  4ZDQ A;  4B5B A;  4IRQ A;  3JUK A;  1LL2 A;  3JUJ A;  2RJ0 A;  4EVW A;  1H4D A;  4EE3 A;  2W0W A;  3HL3 A;  3V8Z A;  5CQP A;  2Y4J A;  4HO9 A;  1ZI5 A;  1MC3 A;  2P6W A;  1V82 A;  3USR A;  3FWW A;  1O0R A;  4KQL A;  2VXL A;  4AYJ A;  1H7F A;  3ZLL A;  1HJJ A;  1O23 B;  3CKO A;  2YQS A;  2VD4 A;  2YC3 A;  3Q4S A;  1VGU A;  1JV1 A;  5C47 A;  3SXB A;  3U2U A;  5FV9 A;  2VSH A;  4Y7T A;  4JD0 A;  3SXA A;  3O3P A;  4KC1 A;  2A8W A;  4ARW A;  2Y7A A;  4Y63 A;  4HO8 A;  5DDT A;  2RJ7 A;  1JVD A;  4FRB A;  1FOA A;  2WAW A;  4M28 A;  1E5K A;  3I0K A;  5CMJ A;  3LW6 A;  2YCM A;  2PGV A;  3CKV A;  1G93 A;  4NAN A;  2JCL A;  4HO5 A;  3U2V A;  2Y4K A;  5EJZ A;  4FRQ A;  2JCJ A;  1OMZ A;  3I0H A;  5C4F A;  4Y7U A;  1HM8 A;  2Z87 A;  4KNX A;  4D11 C;  2OI6 A;  4G87 A;  4FRO A;  4D0T A;  1GWW A;  4LW6 A;  5AJN A;  3U2X A;  1VZU A;  1FWY A;  1FRW A;  1S4N A;  1TVY A;  5FU8 A;  4MND A;  3OAM A;  2BO7 A;  1S4P A;  4KPZ A;  2JCK A;  1ON6 A;  1VGT A;  1H7Q A;  4B2W A;  1ZHJ A;  4HO0 A;  3BRK X;  5L6S A;  4FCU A;  4J18 A;  1K4V A;  3OH4 A;  3PKP A;  2P72 A;  3F1C A;  5L6V A;  1V84 A;  2Q4J A;  1WT0 A;  1HM0 A;  5FTS A;  3CKJ A;  2V0J A;  3E25 A;  5FUH A;  1VGZ A;  5J49 A;  4Y62 A;  1G97 A;  5C1G A;  1H5S A;  2Y4L A;  4B3U A;  1QGS A;  1R7T A;  4B4B A;  4Y64 A;  1QG8 A;  3R2W A;  2WVM A;  1VH3 A;  1H5R A;  1ON8 A;  1INJ A;  3SXD A;  2YES A;  3T7M A;  1YP2 A;  3NGW A;  2AE7 A;  4KRV A;  1FXO A;  2WVL A;  3I0E A;  5C49 A;  3I0C A;  1W77 A;  4D0Z A;  4D11 A;  1H7L A;  1JYL A;  2OI7 A;  3OH3 A;  4KC4 A;  4M2A A;  3V0P A;  1O7O A;  1GQC A;  5AJO A;  2ICX A;  2VS4 A;  2RJ1 A;  4KPX A;  4B42 A;  3SXE A;  3ST8 A;  1G0R A;  4EEO A;  4G3P A;  1LZ7 A;  3V8Y A;  1KWS A;  1NQI B;  5CQL X;  3PNN A;  1GX4 A;  4M4K A;  3GUE A;  1FR9 A; 
#chains in the Genus database with same CATH topology
 3SXG A;  4FIX A;  1WSZ A;  1R7Y A;  5D92 A;  2JCO A;  4HO2 A;  1INI A;  3RMV A;  5C48 A;  2QKX A;  1ZCT A;  2WGZ A;  4CJ8 A;  1TZF A;  2FYA A;  2VS5 A;  3BCV A;  1G23 A;  3IOH A;  4AYL A;  4Y7F A;  4CVH A;  1VH1 A;  5C8R A;  1R7U A;  4KC2 A;  1EYR A;  1YP3 A;  1ZI3 A;  3V91 A;  5JQQ A;  5FYE A;  1H5S B;  1NHE B;  3OGZ A;  3I0L A;  1YRO B;  2FYC B;  1OMX A;  2AGD A;  2AM3 A;  2Y4M A;  2Z86 A;  4G3S A;  1G9R A;  2BO4 A;  2RJ9 A;  4AAW A;  1H5R B;  3RMW A;  2D0J A;  2VK9 A;  3DK5 A;  5C4C A;  1S4O A;  5CQN X;  2ICY A;  1GWV A;  1GX0 A;  4EE5 A;  2RIT A;  4R7P A;  1G8O A;  5IDS A;  1VZX A;  1ZCU A;  1HM9 A;  4FRM A;  5AJP A;  1JYK A;  1EZI A;  1FXJ A;  1TW5 A;  4AC3 A;  5CQO A;  4XWI A;  2BO8 A;  2NXV A;  4NAK A;  4EE4 A;  5C4E A;  3I0G A;  1H5T A;  5EJ1 A;  1MP4 A;  2RJ4 A;  1WVC A;  4FRE A;  2ZU9 A;  1WT1 A;  2VSI A;  3I0I X;  5DDV A;  3I0D A;  4HO3 A;  1LVW A;  2GGO A;  2WVK A;  2XME A;  3EE5 A;  3ZLK A;  3SX8 A;  5HS2 A;  1HJL A;  1GQ9 A;  3QVB A;  3F1Y A;  4E1K A;  4B4G A;  4LW3 A;  1MP5 A;  1O7Q A;  1ZIZ A;  3SXC A;  1ZI1 A;  3V0Q A;  1JVG A;  3Q7U A;  5CMI A;  4HCQ A;  1H4C A;  1R7V A;  5CMH A;  5C4B A;  1LZ0 A;  3USQ A;  2AEC A;  4CJB A;  3V0M A;  1G2V A;  5D91 A;  5CMG X;  3D98 A;  4FRL A;  3U0Y A;  1ZJP A;  1NMM B;  4ASY A;  3JTJ A;  1MP3 A;  3ZGG A;  3OC9 A;  4CJC A;  1HV9 A;  1PZT A;  1FO9 A;  5BXC A;  2P73 A;  5C1H A;  2RJ8 A;  3T7O A;  4Y9X A;  2I5K A;  3OH0 A;  4FIY A;  4DDZ A;  4FRA A;  3DUV A;  2PGY A;  4HG6 A;  2FFV A;  2RJ5 A;  5C38 A;  5CMF X;  2Y6P A;  1LZI A;  3SX7 A;  1VZT A;  2PA4 A;  1QGQ A;  2XWM A;  4Y7G A;  2I5E A;  2FY7 A;  1VIC A;  5EIY A;  1H7H A;  4FQW A;  3K8E A;  3OH1 A;  1FZW A;  4FCE A;  2OI5 A;  4ASJ A;  4UEG A;  2A8U A;  2XWL A;  2YQH A;  1R81 A;  1WT3 A;  1FGG A;  1H5T B;  2RIY A;  1PZY B;  4EEM A;  4EEA A;  2X5S A;  3I0F A;  4Q7C A;  4FRP A;  1ZJO A;  1GA8 A;  1G95 A;  2RJ6 A;  3SPT A;  1FR8 A;  2WE9 A;  3CKQ A;  1Z90 A;  1ZJ0 A;  2VFZ A;  2W0V A;  1ZJ2 A;  1YP4 A;  4O6N A;  3V90 A;  4JIS A;  4GBP A;  4C2S A;  1LZJ A;  1G3L A;  3TZT A;  2QH5 A;  4IRP A;  2E3D A;  3E26 A;  3SX5 A;  1IIM A;  1R82 A;  1QWJ A;  5C36 A;  1H7T A;  3I0J A;  2DPW A;  4KXO A;  5FU0 A;  2V0K A;  1I52 A;  3D5N A;  3IOI A;  4KT7 A;  5C3A A;  1R7X A;  5C3D A;  3POL A;  3U2W A;  1JV3 A;  2OEF A;  2X60 A;  5C1L A;  2ZU7 A;  2D7I A;  4Y7V A;  3DJ4 A;  3V0N A;  1IIN A;  2MZB A;  1WT2 A;  1H7E A;  1ZDF A;  3U2T A;  1VPA A;  1H5S C;  4K6R A;  2ZU8 A;  2FFU A;  2APC A;  2FYD B;  4D48 A;  2D7R A;  1FGX A;  4DE7 A;  1VM8 A;  1W55 A;  4FRD A;  1NWG B;  3CGX A;  3V0L A;  3CKN A;  2O1F A;  2VS3 A;  2AM5 A;  1G1L A;  4L41 C;  1H5S D;  2E8B A;  3N9W A;  1LL3 A;  2YQC A;  2XMH A;  5I1F A;  1VGW A;  4NAL A;  4G3Q A;  3D8V A;  1LL0 A;  1XHB A;  1ZI4 A;  2C0N A;  3ZGF A;  2I7B A;  4EEG A;  2RIX A;  2UX8 A;  1TW1 A;  4NAI A;  3PKQ A;  3RSB A;  1R80 A;  5FTV A;  4B4M A;  2GGQ A;  1H3M A;  2BO6 A;  4MYB A;  1ZJ1 A;  1ZDG A;  3Q80 A;  1FO8 A;  2OEG A;  1ZCV A;  3IOJ A;  2YC5 A;  4YS8 A;  4P02 A;  1NF5 B;  3KIA A;  2XWN A;  3CU0 A;  2YQJ A;  4Y6U A;  2PX7 A;  1W57 A;  2VXM A;  5IFY A;  3OKR A;  3SX3 A;  2QGI A;  4BQH A;  5IDT A;  2WEE A;  2AM4 A;  3U0X A;  2FYB A;  1ZJ3 A;  2X5Z A;  1SS9 A;  3V0O A;  4B2X A;  1NKH B;  4FRH A;  2O1H A;  1OQM B;  2X65 A;  1H7G A;  5C3B A;  4BMA A;  3T7N A;  3K8D A;  4HOC A;  1ZCY A;  2O1G A;  2RIZ A;  3TQD A;  1FG5 N;  2V0H A;  4Y6N A;  3ZF8 A;  4HO4 A;  5C4D A;  5CQM X;  4HO6 A;  4M2B A;  2AES A;  4ECM A;  3OH2 A;  2V0I A;  2AH9 A;  4P00 A;  3FOQ A;  2V0L A;  1H4E A;  2CU2 A;  1XZ6 A;  4KNR A;  4DEC A;  1V83 A;  3R3I A;  4ZDQ A;  4B5B A;  4IRQ A;  3JUK A;  1LL2 A;  3JUJ A;  2RJ0 A;  4EVW A;  1H4D A;  4EE3 A;  2W0W A;  3HL3 A;  3V8Z A;  5CQP A;  2Y4J A;  2J0B A;  4HO9 A;  1ZI5 A;  1MC3 A;  2P6W A;  1V82 A;  3USR A;  3FWW A;  1O0R A;  4KQL A;  2VXL A;  4AYJ A;  1H7F A;  3ZLL A;  1HJJ A;  1O23 B;  3CKO A;  2YQS A;  2VD4 A;  2YC3 A;  3Q4S A;  1VGU A;  1JV1 A;  5C47 A;  3SXB A;  3U2U A;  5FV9 A;  2VSH A;  4Y7T A;  4JD0 A;  3SXA A;  3O3P A;  4KC1 A;  2A8W A;  4ARW A;  2Y7A A;  4Y63 A;  4HO8 A;  5DDT A;  2RJ7 A;  1JVD A;  4FRB A;  1FOA A;  2WAW A;  4M28 A;  1E5K A;  3I0K A;  5CMJ A;  3LW6 A;  2YCM A;  2PGV A;  3CKV A;  1G93 A;  4NAN A;  2JCL A;  4HO5 A;  3U2V A;  2Y4K A;  5EJZ A;  4FRQ A;  2JCJ A;  1OMZ A;  3I0H A;  4MIX A;  5C4F A;  2J0A A;  4Y7U A;  1HM8 A;  2Z87 A;  4KNX A;  4D11 C;  2OI6 A;  4G87 A;  4FRO A;  4D0T A;  1GWW A;  4LW6 A;  5AJN A;  3U2X A;  1VZU A;  1FWY A;  1FRW A;  1S4N A;  1TVY A;  5FU8 A;  4MND A;  3OAM A;  2BO7 A;  1S4P A;  4KPZ A;  2JCK A;  1ON6 A;  1VGT A;  1H7Q A;  4B2W A;  1ZHJ A;  4HO0 A;  3BRK X;  5L6S A;  4FCU A;  4J18 A;  1K4V A;  3OH4 A;  3PKP A;  2P72 A;  3F1C A;  5L6V A;  1V84 A;  2Q4J A;  1WT0 A;  1HM0 A;  5FTS A;  3CKJ A;  2V0J A;  3E25 A;  5FUH A;  1VGZ A;  5J49 A;  4Y62 A;  1G97 A;  5C1G A;  1H5S A;  2Y4L A;  4B3U A;  1QGS A;  1R7T A;  4B4B A;  4Y64 A;  1QG8 A;  3R2W A;  2WVM A;  1VH3 A;  1H5R A;  1ON8 A;  1INJ A;  3SXD A;  2YES A;  3T7M A;  1YP2 A;  3NGW A;  2AE7 A;  4KRV A;  1FXO A;  2WVL A;  3I0E A;  5C49 A;  3I0C A;  1W77 A;  4D0Z A;  4D11 A;  1H7L A;  1JYL A;  2OI7 A;  3OH3 A;  4KC4 A;  4M2A A;  3V0P A;  1O7O A;  1GQC A;  4O6M A;  5AJO A;  2ICX A;  2VS4 A;  2RJ1 A;  4KPX A;  4B42 A;  3SXE A;  3ST8 A;  1G0R A;  4EEO A;  4G3P A;  1LZ7 A;  3V8Y A;  1KWS A;  1NQI B;  5CQL X;  3PNN A;  1GX4 A;  4M4K A;  3GUE A;  1FR9 A; 
#chains in the Genus database with same CATH homology
 3SXG A;  4FIX A;  1WSZ A;  1R7Y A;  5D92 A;  2JCO A;  4HO2 A;  1INI A;  3RMV A;  5C48 A;  2QKX A;  1ZCT A;  2WGZ A;  4CJ8 A;  1TZF A;  2FYA A;  2VS5 A;  3BCV A;  1G23 A;  3IOH A;  4AYL A;  4Y7F A;  4CVH A;  1VH1 A;  5C8R A;  1R7U A;  4KC2 A;  1EYR A;  1YP3 A;  1ZI3 A;  3V91 A;  5JQQ A;  5FYE A;  1H5S B;  1NHE B;  3OGZ A;  3I0L A;  1YRO B;  2FYC B;  1OMX A;  2AGD A;  2AM3 A;  2Y4M A;  2Z86 A;  4G3S A;  1G9R A;  2BO4 A;  2RJ9 A;  4AAW A;  1H5R B;  3RMW A;  2D0J A;  2VK9 A;  3DK5 A;  5C4C A;  1S4O A;  5CQN X;  2ICY A;  1GWV A;  1GX0 A;  4EE5 A;  2RIT A;  4R7P A;  1G8O A;  5IDS A;  1VZX A;  1ZCU A;  1HM9 A;  4FRM A;  5AJP A;  1JYK A;  1EZI A;  1FXJ A;  1TW5 A;  4AC3 A;  5CQO A;  4XWI A;  2BO8 A;  2NXV A;  4NAK A;  4EE4 A;  5C4E A;  3I0G A;  1H5T A;  5EJ1 A;  1MP4 A;  2RJ4 A;  1WVC A;  4FRE A;  2ZU9 A;  1WT1 A;  2VSI A;  3I0I X;  5DDV A;  3I0D A;  4HO3 A;  1LVW A;  2GGO A;  2WVK A;  2XME A;  3EE5 A;  3ZLK A;  3SX8 A;  5HS2 A;  1HJL A;  1GQ9 A;  3QVB A;  3F1Y A;  4E1K A;  4B4G A;  4LW3 A;  1MP5 A;  1O7Q A;  1ZIZ A;  3SXC A;  1ZI1 A;  3V0Q A;  1JVG A;  3Q7U A;  5CMI A;  4HCQ A;  1H4C A;  1R7V A;  5CMH A;  5C4B A;  1LZ0 A;  3USQ A;  2AEC A;  4CJB A;  3V0M A;  1G2V A;  5D91 A;  5CMG X;  3D98 A;  4FRL A;  3U0Y A;  1ZJP A;  1NMM B;  4ASY A;  3JTJ A;  1MP3 A;  3ZGG A;  3OC9 A;  4CJC A;  1HV9 A;  1PZT A;  1FO9 A;  5BXC A;  2P73 A;  5C1H A;  2RJ8 A;  3T7O A;  4Y9X A;  2I5K A;  3OH0 A;  4FIY A;  4DDZ A;  4FRA A;  3DUV A;  2PGY A;  4HG6 A;  2FFV A;  2RJ5 A;  5C38 A;  5CMF X;  2Y6P A;  1LZI A;  3SX7 A;  1VZT A;  2PA4 A;  1QGQ A;  2XWM A;  4Y7G A;  2I5E A;  2FY7 A;  1VIC A;  5EIY A;  1H7H A;  4FQW A;  3K8E A;  3OH1 A;  1FZW A;  4FCE A;  2OI5 A;  4ASJ A;  4UEG A;  2A8U A;  2XWL A;  2YQH A;  1R81 A;  1WT3 A;  1FGG A;  1H5T B;  2RIY A;  1PZY B;  4EEM A;  4EEA A;  2X5S A;  3I0F A;  4Q7C A;  4FRP A;  1ZJO A;  1GA8 A;  1G95 A;  2RJ6 A;  3SPT A;  1FR8 A;  2WE9 A;  3CKQ A;  1Z90 A;  1ZJ0 A;  2VFZ A;  2W0V A;  1ZJ2 A;  1YP4 A;  4O6N A;  3V90 A;  4JIS A;  4GBP A;  4C2S A;  1LZJ A;  1G3L A;  3TZT A;  2QH5 A;  4IRP A;  2E3D A;  3E26 A;  3SX5 A;  1IIM A;  1R82 A;  1QWJ A;  5C36 A;  1H7T A;  3I0J A;  2DPW A;  4KXO A;  5FU0 A;  2V0K A;  1I52 A;  3D5N A;  3IOI A;  4KT7 A;  5C3A A;  1R7X A;  5C3D A;  3POL A;  3U2W A;  1JV3 A;  2OEF A;  2X60 A;  5C1L A;  2ZU7 A;  2D7I A;  4Y7V A;  3DJ4 A;  3V0N A;  1IIN A;  2MZB A;  1WT2 A;  1H7E A;  1ZDF A;  3U2T A;  1VPA A;  1H5S C;  4K6R A;  2ZU8 A;  2FFU A;  2APC A;  2FYD B;  4D48 A;  2D7R A;  1FGX A;  4DE7 A;  1VM8 A;  1W55 A;  4FRD A;  1NWG B;  3CGX A;  3V0L A;  3CKN A;  2O1F A;  2VS3 A;  2AM5 A;  1G1L A;  4L41 C;  1H5S D;  2E8B A;  3N9W A;  1LL3 A;  2YQC A;  2XMH A;  5I1F A;  1VGW A;  4NAL A;  4G3Q A;  3D8V A;  1LL0 A;  1XHB A;  1ZI4 A;  2C0N A;  3ZGF A;  2I7B A;  4EEG A;  2RIX A;  2UX8 A;  1TW1 A;  4NAI A;  3PKQ A;  3RSB A;  1R80 A;  5FTV A;  4B4M A;  2GGQ A;  1H3M A;  2BO6 A;  4MYB A;  1ZJ1 A;  1ZDG A;  3Q80 A;  1FO8 A;  2OEG A;  1ZCV A;  3IOJ A;  2YC5 A;  4YS8 A;  4P02 A;  1NF5 B;  3KIA A;  2XWN A;  3CU0 A;  2YQJ A;  4Y6U A;  2PX7 A;  1W57 A;  2VXM A;  5IFY A;  3OKR A;  3SX3 A;  2QGI A;  4BQH A;  5IDT A;  2WEE A;  2AM4 A;  3U0X A;  2FYB A;  1ZJ3 A;  2X5Z A;  1SS9 A;  3V0O A;  4B2X A;  1NKH B;  4FRH A;  2O1H A;  1OQM B;  2X65 A;  1H7G A;  5C3B A;  4BMA A;  3T7N A;  3K8D A;  4HOC A;  1ZCY A;  2O1G A;  2RIZ A;  3TQD A;  1FG5 N;  2V0H A;  4Y6N A;  3ZF8 A;  4HO4 A;  5C4D A;  5CQM X;  4HO6 A;  4M2B A;  2AES A;  4ECM A;  3OH2 A;  2V0I A;  2AH9 A;  4P00 A;  3FOQ A;  2V0L A;  1H4E A;  2CU2 A;  1XZ6 A;  4KNR A;  4DEC A;  1V83 A;  3R3I A;  4ZDQ A;  4B5B A;  4IRQ A;  3JUK A;  1LL2 A;  3JUJ A;  2RJ0 A;  4EVW A;  1H4D A;  4EE3 A;  2W0W A;  3HL3 A;  3V8Z A;  5CQP A;  2Y4J A;  2J0B A;  4HO9 A;  1ZI5 A;  1MC3 A;  2P6W A;  1V82 A;  3USR A;  3FWW A;  1O0R A;  4KQL A;  2VXL A;  4AYJ A;  1H7F A;  3ZLL A;  1HJJ A;  1O23 B;  3CKO A;  2YQS A;  2VD4 A;  2YC3 A;  3Q4S A;  1VGU A;  1JV1 A;  5C47 A;  3SXB A;  3U2U A;  5FV9 A;  2VSH A;  4Y7T A;  4JD0 A;  3SXA A;  3O3P A;  4KC1 A;  2A8W A;  4ARW A;  2Y7A A;  4Y63 A;  4HO8 A;  5DDT A;  2RJ7 A;  1JVD A;  4FRB A;  1FOA A;  2WAW A;  4M28 A;  1E5K A;  3I0K A;  5CMJ A;  3LW6 A;  2YCM A;  2PGV A;  3CKV A;  1G93 A;  4NAN A;  2JCL A;  4HO5 A;  3U2V A;  2Y4K A;  5EJZ A;  4FRQ A;  2JCJ A;  1OMZ A;  3I0H A;  4MIX A;  5C4F A;  2J0A A;  4Y7U A;  1HM8 A;  2Z87 A;  4KNX A;  4D11 C;  2OI6 A;  4G87 A;  4FRO A;  4D0T A;  1GWW A;  4LW6 A;  5AJN A;  3U2X A;  1VZU A;  1FWY A;  1FRW A;  1S4N A;  1TVY A;  5FU8 A;  4MND A;  3OAM A;  2BO7 A;  1S4P A;  4KPZ A;  2JCK A;  1ON6 A;  1VGT A;  1H7Q A;  4B2W A;  1ZHJ A;  4HO0 A;  3BRK X;  5L6S A;  4FCU A;  4J18 A;  1K4V A;  3OH4 A;  3PKP A;  2P72 A;  3F1C A;  5L6V A;  1V84 A;  2Q4J A;  1WT0 A;  1HM0 A;  5FTS A;  3CKJ A;  2V0J A;  3E25 A;  5FUH A;  1VGZ A;  5J49 A;  4Y62 A;  1G97 A;  5C1G A;  1H5S A;  2Y4L A;  4B3U A;  1QGS A;  1R7T A;  4B4B A;  4Y64 A;  1QG8 A;  3R2W A;  2WVM A;  1VH3 A;  1H5R A;  1ON8 A;  1INJ A;  3SXD A;  2YES A;  3T7M A;  1YP2 A;  3NGW A;  2AE7 A;  4KRV A;  1FXO A;  2WVL A;  3I0E A;  5C49 A;  3I0C A;  1W77 A;  4D0Z A;  4D11 A;  1H7L A;  1JYL A;  2OI7 A;  3OH3 A;  4KC4 A;  4M2A A;  3V0P A;  1O7O A;  1GQC A;  4O6M A;  5AJO A;  2ICX A;  2VS4 A;  2RJ1 A;  4KPX A;  4B42 A;  3SXE A;  3ST8 A;  1G0R A;  4EEO A;  4G3P A;  1LZ7 A;  3V8Y A;  1KWS A;  1NQI B;  5CQL X;  3PNN A;  1GX4 A;  4M4K A;  3GUE A;  1FR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...