1LZ0A

Glycosyltransferase a
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
265
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycosyltransferase A
publication title The structural basis for specificity in human ABO(H) blood group biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 265
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2002-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1lz0A00
4NALA 2RITA 4ASJA 1YP3A 1FG5N 3BCVA 4J18A 4CJBA 1FO9A 3V0PA 4CJCA 1ON6A 1FGGA 2XWNA 2DPWA 1VZUA 2QH5A 4HG6A 5FTSA 2APCA 1G97A 5EIYA 2AM5A 3T7OA 4Y62A 3T7NA 3ZGFA 4EEGA 4NANA 2AE7A 4D48A 3D5NA 4ZDQA 1O7QA 4KQLA 3DK5A 2XWMA 2WVKA 4C2SA 1FGXA 2JCKA 2AECA 2OEFA 2D7RA 1ZHJA 1ZIZA 1XHBA 4HO9A 4FRPA 5FYEA 1G8OA 4IRQA 2WEEA 3V0MA 2UX8A 4HO2A 3E25A 1R7TA 1G9RA 1ZDGA 2FYBA 3TQDA 1ZJ0A 5C3BA 1FXOA 5FU8A 3SX7A 5CMIA 5JQQA 3U2XA 1XZ6A 1MC3A 2PGVA 3N9WA 3SXEA 3R3IA 2W0VA 2VFZA 3CKVA 2JCLA 2V0HA 2Z86A 2A8UA 1MP3A 2Y7AA 3PKPA 2V0KA 2OEGA 3KIAA 1JVDA 3R2WA 5FU0A 3IOIA 5C47A 1VPAA 1MP5A 4Y7TA 1ZDFA 2Z87A 4HO8A 2Y4KA 1VGZA 1NMMB 1R7VA 3V91A 3I0GA 2ZU8A 4D11C 4B5BA 3ZF8A 5FUHA 1INIA 3JUKA 4ASYA 3OH3A 3OH1A 5C4DA 5C4BA 4EVWA 3I0DA 4B4GA 3USQA 1LL2A 2I5EA 1QWJA 1G1LA 3IOHA 1H5SA 4FRLA 1VH3A 2Y4JA 4M2AA 3ZLKA 5C1GA 1YP4A 2FYAA 3SXAA 1W55A 4HO3A 4KPZA 1ZJPA 1H3MA 3EE5A 1FRWA 1WT3A 1ZI4A 1NQIB 1YP2A 4GBPA 4AAWA 1GWWA 1VGUA 1MP4A 3E26A 1H4CA 4B2WA 3ZLLA 2VSIA 2RIYA 1GQ9A 5C4FA 3SX5A 5C1LA 1GQCA 4K6RA 5DDTA 2RJ4A 2W0WA 5C48A 2WE9A 1VZTA 4FQWA 2JCJA 2E8BA 4AYJA 4FCUA 3HL3A 1WT2A 2PX7A 2QKXA 2BO8A 2ICYA 4FRHA 2AESA 1ZCTA 3GUEA 5CQMX 2XMHA 4MNDA 2I5KA 2RJ6A 3I0KA 1V83A 3POLA 3U0YA 2RJ7A 1S4PA 2RJ1A 1H5SB 2FYCB 3RSBA 2PA4A 3ZGGA 3USRA 4HO4A 2AH9A 3V0QA 2WGZA 4Y7VA 1H7GA 2AGDA 1WT1A 4EE4A 4AYLA 1EYRA 1VM8A 2ICXA 5HS2A 1GX4A 1V84A 4JISA 1G93A 5FTVA 3PKQA 4Y63A 1ZJ3A 1W57A 3I0IX 1ZCYA 2Y6PA 4FCEA 1K4VA 1GX0A 1ZI5A 1VZXA 1QG8A 3U2WA 2O1FA 1VGWA 2RIXA 5BXCA 1ZCUA 4M28A 2FYDB 3JUJA 2BO4A 2CU2A 2RJ5A 4E1KA 5DDVA 2V0IA 4FRAA 3I0LA 4KT7A 2BO7A 1LL3A 2XMEA 1EZIA 3V90A 1R80A 3CU0A 2O1HA 1LVWA 2YQJA 2P73A 3CKQA 1H5RA 2AM4A 1INJA 5CMJA 2VXMA 3I0JA 1I52A 4HOCA 4HO5A 4KXOA 4KC4A 4MYBA 3ST8A 3Q7UA 1PZTA 3U2UA 2OI6A 2QGIA 3RMVA 2X5SA 5CQOA 1NKHB 1LZIA 1TW5A 5C8RA 3PNNA 2GGOA 1QGSA 2O1GA 4CJ8A 1NHEB 4AC3A 3OGZA 5C4EA 1LZ7A 4DECA 3U0XA 1JV3A 4FREA 4Y7UA 1R81A 1G2VA 1JVGA 4HO6A 5C1HA 3SX8A 2YCMA 2RIZA 1LL0A 4LW6A 1PZYB 1JYLA 2WVMA 3IOJA 4FRBA 4FRQA 2X5ZA 4ARWA 1GA8A 1H4EA 3DUVA 2V0LA 5CMHA 5FV9A 2P6WA 3FOQA 4B42A 1OQMB 4Y9XA 5I1FA 1ZJ2A 1H5SC 3O3PA 3SXBA 2V0JA 4KC1A 1HV9A 3OKRA 2GGQA 4FROA 4D0ZA 5C38A 1IINA 4P00A 1ZI1A 3CKJA 2VS5A 4EEAA 2VXLA 4G3SA 1LZJA 2YQHA 1S4OA 4DE7A 1ZJ1A 3U2TA 3I0FA 3I0HA 2I7BA 1H7TA 1FR8A 4HO0A 5J49A 1R7UA 2MZBA 1R82A 3V0OA 4EE5A 2A8WA 3FWWA 2OI7A 1OMZA 3DJ4A 4KNXA 4KPXA 1VGTA 2VSHA 4M4KA 5CQPA 5AJPA 2PGYA 1H5TA 2YQSA 3OAMA 5IFYA 3F1CA 4B4MA 2D7IA 1H7QA 4EE3A 5EJZA 1KWSA 1NWGB 4HCQA 2VS3A 2FY7A 3JTJA 1O7OA 4NAKA 1TW1A 4XWIA 3OH4A 1W77A 1ZI3A 3D8VA 1R7YA 1HM9A 1JYKA 1ON8A 2YC5A 3RMWA 2JCOA 3SXCA 1VICA 3SXDA 1IIMA 1FXJA 1O0RA 1H7LA 2Y4LA 4G3QA 1G95A 1TVYA 4UEGA 4B3UA 2WAWA 3OH0A 1HJJA 1H7EA 3CGXA 4NAIA 1E5KA 1FR9A 1NF5B 3I0CA 4KC2A 2Y4MA 5L6SA 2Q4JA 1WT0A 3U2VA 1VH1A 1H5TB 1FWYA 5AJNA 4CVHA 5L6VA 3K8DA 1H7HA 4Y64A 1R7XA 5C3AA 3NGWA 2YC3A 2D0JA 2WVLA 1JV1A 5CMFX 4KNRA 1OMXA 1HJLA 1WSZA 1YROB 1HM8A 4D11A 3CKNA 3SXGA 3K8EA 2X60A 4DDZA 1FZWA 1GWVA 3QVBA 1SS9A 3LW6A 3OH2A 3TZTA 3D98A 5IDSA 1H5SD 2X65A 1G23A 4Y7GA 4G87A 4EEOA 3SPTA 3T7MA 2YQCA 5IDTA 2RJ0A 4M2BA 1WVCA 5C3DA 3I0EA 1ZJOA 2ZU7A 1O23B 3V0NA 1FO8A 3V8ZA 3SX3A 3Q4SA 5CQNX 5CQLX 2VS4A 3CKOA 4EEMA 1FOAA 1HM0A 2RJ8A 3F1YA 4G3PA 4IRPA 1G0RA 4LW3A 5AJOA 4BMAA 5CMGX 2VD4A 3Q80A 4Y6UA 1QGQA 2FFVA 2XWLA 1H5RB 3OC9A 4ECMA 2BO6A 4KRVA 5C49A 1G3LA 1Z90A 2P72A 4FRMA 3V8YA 5EJ1A 1H7FA 2ZU9A 4D0TA 2E3DA 4Y6NA 3BRKX 4BQHA 3V0LA 4YS8A 1S4NA 1ZCVA 4FRDA 2RJ9A 1TZFA 2NXVA 5C4CA 4JD0A 2AM3A 1H4DA 2YESA 1V82A 4L41C 2OI5A 2FFUA 4R7PA 4Y7FA 4B2XA 5C36A 4P02A 1LZ0A 4B4BA
chains in the Genus database with same CATH superfamily
4NALA 2RITA 4ASJA 1YP3A 1FG5N 3BCVA 4J18A 4CJBA 1FO9A 3V0PA 4CJCA 1ON6A 1FGGA 2XWNA 2DPWA 1VZUA 2QH5A 4HG6A 5FTSA 2APCA 1G97A 5EIYA 2AM5A 3T7OA 4Y62A 3T7NA 3ZGFA 4EEGA 4NANA 2AE7A 4D48A 3D5NA 4ZDQA 1O7QA 4KQLA 4O6NA 3DK5A 2XWMA 2WVKA 4C2SA 1FGXA 2JCKA 2AECA 2OEFA 2D7RA 1ZHJA 1ZIZA 1XHBA 4HO9A 4FRPA 5FYEA 1G8OA 4IRQA 2WEEA 3V0MA 2UX8A 4HO2A 3E25A 1R7TA 1G9RA 1ZDGA 2FYBA 3TQDA 1ZJ0A 5C3BA 1FXOA 5FU8A 3SX7A 5CMIA 5JQQA 3U2XA 1XZ6A 1MC3A 2PGVA 3N9WA 3SXEA 3R3IA 2W0VA 2VFZA 3CKVA 2JCLA 2V0HA 2Z86A 2A8UA 1MP3A 2Y7AA 3PKPA 2V0KA 2OEGA 3KIAA 1JVDA 3R2WA 5FU0A 3IOIA 5C47A 1VPAA 1MP5A 4Y7TA 1ZDFA 2Z87A 4HO8A 2Y4KA 4Q7CA 1VGZA 1NMMB 1R7VA 3V91A 3I0GA 2ZU8A 4D11C 4B5BA 3ZF8A 5FUHA 1INIA 3JUKA 4ASYA 3OH3A 3OH1A 5C4DA 5C4BA 4EVWA 3I0DA 2VK9A 4B4GA 3USQA 1LL2A 2I5EA 1QWJA 1G1LA 3IOHA 1H5SA 4FRLA 1VH3A 2Y4JA 4M2AA 3ZLKA 5C1GA 1YP4A 2FYAA 3SXAA 1W55A 4HO3A 4KPZA 1ZJPA 1H3MA 3EE5A 1FRWA 1WT3A 1ZI4A 1NQIB 1YP2A 4GBPA 4AAWA 1GWWA 1VGUA 1MP4A 3E26A 1H4CA 4B2WA 3ZLLA 2VSIA 2RIYA 4O6MA 1GQ9A 5C4FA 3SX5A 5C1LA 1GQCA 4K6RA 5DDTA 2RJ4A 2W0WA 5C48A 2WE9A 1VZTA 4FQWA 2JCJA 2E8BA 4AYJA 4FCUA 5D91A 3HL3A 1WT2A 2PX7A 4FIYA 2QKXA 2BO8A 2ICYA 4FRHA 2AESA 1ZCTA 3GUEA 5CQMX 2XMHA 4MNDA 2I5KA 2RJ6A 3I0KA 1V83A 3POLA 3U0YA 2RJ7A 1S4PA 2RJ1A 1H5SB 2FYCB 3RSBA 2PA4A 3ZGGA 3USRA 4HO4A 2AH9A 3V0QA 2WGZA 4Y7VA 1H7GA 2AGDA 1WT1A 4EE4A 4AYLA 1EYRA 1VM8A 2ICXA 5HS2A 1GX4A 1V84A 4JISA 1G93A 5FTVA 3PKQA 4Y63A 1ZJ3A 2J0AA 1W57A 3I0IX 1ZCYA 2Y6PA 4FCEA 1K4VA 1GX0A 1ZI5A 1VZXA 1QG8A 3U2WA 2O1FA 1VGWA 2RIXA 5BXCA 1ZCUA 4M28A 2FYDB 3JUJA 2BO4A 2CU2A 2RJ5A 4E1KA 5D92A 5DDVA 2V0IA 4FRAA 3I0LA 4KT7A 2C0NA 2BO7A 1LL3A 2XMEA 1EZIA 3V90A 1R80A 3CU0A 2O1HA 1LVWA 2YQJA 2P73A 3CKQA 1H5RA 2AM4A 1INJA 5CMJA 2VXMA 3I0JA 1I52A 4HOCA 4HO5A 4KXOA 4KC4A 4MYBA 3ST8A 3Q7UA 1PZTA 3U2UA 2OI6A 2QGIA 3RMVA 2X5SA 4FIXA 5CQOA 1NKHB 1LZIA 1TW5A 5C8RA 3PNNA 2GGOA 1QGSA 2O1GA 4CJ8A 1NHEB 4AC3A 3OGZA 5C4EA 1LZ7A 4DECA 3U0XA 1JV3A 4FREA 4Y7UA 1R81A 1G2VA 1JVGA 4HO6A 5C1HA 3SX8A 2YCMA 2RIZA 1LL0A 4LW6A 1PZYB 1JYLA 2WVMA 3IOJA 4FRBA 4FRQA 2X5ZA 4ARWA 1GA8A 1H4EA 3DUVA 2V0LA 5CMHA 5FV9A 2P6WA 3FOQA 4B42A 1OQMB 4Y9XA 5I1FA 1ZJ2A 1H5SC 3O3PA 3SXBA 2V0JA 4KC1A 1HV9A 3OKRA 2GGQA 4FROA 4D0ZA 5C38A 1IINA 4P00A 1ZI1A 3CKJA 2VS5A 4EEAA 2VXLA 4G3SA 1LZJA 4MIXA 2YQHA 1S4OA 4DE7A 1ZJ1A 3U2TA 3I0FA 3I0HA 2I7BA 1H7TA 1FR8A 4HO0A 5J49A 1R7UA 2MZBA 1R82A 3V0OA 4EE5A 2A8WA 3FWWA 2OI7A 1OMZA 3DJ4A 4KNXA 4KPXA 1VGTA 2VSHA 4M4KA 5CQPA 5AJPA 2PGYA 1H5TA 2YQSA 3OAMA 5IFYA 3F1CA 4B4MA 2D7IA 1H7QA 4EE3A 5EJZA 1KWSA 1NWGB 4HCQA 2VS3A 2FY7A 3JTJA 1O7OA 4NAKA 1TW1A 4XWIA 3OH4A 1W77A 1ZI3A 3D8VA 1R7YA 1HM9A 1JYKA 1ON8A 2YC5A 3RMWA 2JCOA 3SXCA 1VICA 3SXDA 1IIMA 1FXJA 1O0RA 1H7LA 2Y4LA 4G3QA 1G95A 1TVYA 4UEGA 4B3UA 2WAWA 3OH0A 1HJJA 1H7EA 3CGXA 4NAIA 1E5KA 1FR9A 1NF5B 3I0CA 4KC2A 2Y4MA 5L6SA 2Q4JA 1WT0A 3U2VA 1VH1A 1H5TB 1FWYA 5AJNA 4CVHA 5L6VA 3K8DA 1H7HA 4Y64A 1R7XA 5C3AA 3NGWA 2YC3A 2D0JA 2WVLA 1JV1A 5CMFX 4KNRA 1OMXA 1HJLA 1WSZA 1YROB 1HM8A 4D11A 3CKNA 3SXGA 3K8EA 2X60A 4DDZA 1FZWA 1GWVA 3QVBA 1SS9A 3LW6A 3OH2A 3TZTA 3D98A 5IDSA 1H5SD 2X65A 1G23A 4Y7GA 4G87A 4EEOA 3SPTA 3T7MA 2YQCA 5IDTA 2RJ0A 4M2BA 1WVCA 5C3DA 3I0EA 1ZJOA 2ZU7A 1O23B 3V0NA 1FO8A 3V8ZA 3SX3A 3Q4SA 5CQNX 5CQLX 2VS4A 3CKOA 4EEMA 1FOAA 1HM0A 2RJ8A 3F1YA 4G3PA 4IRPA 1G0RA 4LW3A 5AJOA 4BMAA 5CMGX 2VD4A 3Q80A 4Y6UA 1QGQA 2FFVA 2XWLA 1H5RB 3OC9A 4ECMA 2BO6A 4KRVA 2J0BA 5C49A 1G3LA 1Z90A 2P72A 4FRMA 3V8YA 5EJ1A 1H7FA 2ZU9A 4D0TA 2E3DA 4Y6NA 3BRKX 4BQHA 3V0LA 4YS8A 1S4NA 1ZCVA 4FRDA 2RJ9A 1TZFA 2NXVA 5C4CA 4JD0A 2AM3A 1H4DA 2YESA 1V82A 4L41C 2OI5A 2FFUA 4R7PA 4Y7FA 4B2XA 5C36A 4P02A 1LZ0A 4B4BA
chains in the Genus database with same CATH topology
4NALA 2RITA 4ASJA 1YP3A 1FG5N 3BCVA 4J18A 4CJBA 1FO9A 3V0PA 4CJCA 1ON6A 1FGGA 2XWNA 2DPWA 1VZUA 2QH5A 4HG6A 5FTSA 2APCA 1G97A 5EIYA 2AM5A 3T7OA 4Y62A 3T7NA 3ZGFA 4EEGA 4NANA 2AE7A 4D48A 3D5NA 4ZDQA 1O7QA 4KQLA 4O6NA 3DK5A 2XWMA 2WVKA 4C2SA 1FGXA 2JCKA 2AECA 2OEFA 2D7RA 1ZHJA 1ZIZA 1XHBA 4HO9A 4FRPA 5FYEA 1G8OA 4IRQA 2WEEA 3V0MA 2UX8A 4HO2A 3E25A 1R7TA 1G9RA 1ZDGA 2FYBA 3TQDA 1ZJ0A 5C3BA 1FXOA 5FU8A 3SX7A 5CMIA 5JQQA 3U2XA 1XZ6A 1MC3A 2PGVA 3N9WA 3SXEA 3R3IA 2W0VA 2VFZA 3CKVA 2JCLA 2V0HA 2Z86A 2A8UA 1MP3A 2Y7AA 3PKPA 2V0KA 2OEGA 3KIAA 1JVDA 3R2WA 5FU0A 3IOIA 5C47A 1VPAA 1MP5A 4Y7TA 1ZDFA 2Z87A 4HO8A 2Y4KA 4Q7CA 1VGZA 1NMMB 1R7VA 3V91A 3I0GA 2ZU8A 4D11C 4B5BA 3ZF8A 5FUHA 1INIA 3JUKA 4ASYA 3OH3A 3OH1A 5C4DA 5C4BA 4EVWA 3I0DA 2VK9A 4B4GA 3USQA 1LL2A 2I5EA 1QWJA 1G1LA 3IOHA 1H5SA 4FRLA 1VH3A 2Y4JA 4M2AA 3ZLKA 5C1GA 1YP4A 2FYAA 3SXAA 1W55A 4HO3A 4KPZA 1ZJPA 1H3MA 3EE5A 1FRWA 1WT3A 1ZI4A 1NQIB 1YP2A 4GBPA 4AAWA 1GWWA 1VGUA 1MP4A 3E26A 1H4CA 4B2WA 3ZLLA 2VSIA 2RIYA 4O6MA 1GQ9A 5C4FA 3SX5A 5C1LA 1GQCA 4K6RA 5DDTA 2RJ4A 2W0WA 5C48A 2WE9A 1VZTA 4FQWA 2JCJA 2E8BA 4AYJA 4FCUA 5D91A 3HL3A 1WT2A 2PX7A 4FIYA 2QKXA 2BO8A 2ICYA 4FRHA 2AESA 1ZCTA 3GUEA 5CQMX 2XMHA 4MNDA 2I5KA 2RJ6A 3I0KA 1V83A 3POLA 3U0YA 2RJ7A 1S4PA 2RJ1A 1H5SB 2FYCB 3RSBA 2PA4A 3ZGGA 3USRA 4HO4A 2AH9A 3V0QA 2WGZA 4Y7VA 1H7GA 2AGDA 1WT1A 4EE4A 4AYLA 1EYRA 1VM8A 2ICXA 5HS2A 1GX4A 1V84A 4JISA 1G93A 5FTVA 3PKQA 4Y63A 1ZJ3A 2J0AA 1W57A 3I0IX 1ZCYA 2Y6PA 4FCEA 1K4VA 1GX0A 1ZI5A 1VZXA 1QG8A 3U2WA 2O1FA 1VGWA 2RIXA 5BXCA 1ZCUA 4M28A 2FYDB 3JUJA 2BO4A 2CU2A 2RJ5A 4E1KA 5D92A 5DDVA 2V0IA 4FRAA 3I0LA 4KT7A 2C0NA 2BO7A 1LL3A 2XMEA 1EZIA 3V90A 1R80A 3CU0A 2O1HA 1LVWA 2YQJA 2P73A 3CKQA 1H5RA 2AM4A 1INJA 5CMJA 2VXMA 3I0JA 1I52A 4HOCA 4HO5A 4KXOA 4KC4A 4MYBA 3ST8A 3Q7UA 1PZTA 3U2UA 2OI6A 2QGIA 3RMVA 2X5SA 4FIXA 5CQOA 1NKHB 1LZIA 1TW5A 5C8RA 3PNNA 2GGOA 1QGSA 2O1GA 4CJ8A 1NHEB 4AC3A 3OGZA 5C4EA 1LZ7A 4DECA 3U0XA 1JV3A 4FREA 4Y7UA 1R81A 1G2VA 1JVGA 4HO6A 5C1HA 3SX8A 2YCMA 2RIZA 1LL0A 4LW6A 1PZYB 1JYLA 2WVMA 3IOJA 4FRBA 4FRQA 2X5ZA 4ARWA 1GA8A 1H4EA 3DUVA 2V0LA 5CMHA 5FV9A 2P6WA 3FOQA 4B42A 1OQMB 4Y9XA 5I1FA 1ZJ2A 1H5SC 3O3PA 3SXBA 2V0JA 4KC1A 1HV9A 3OKRA 2GGQA 4FROA 4D0ZA 5C38A 1IINA 4P00A 1ZI1A 3CKJA 2VS5A 4EEAA 2VXLA 4G3SA 1LZJA 4MIXA 2YQHA 1S4OA 4DE7A 1ZJ1A 3U2TA 3I0FA 3I0HA 2I7BA 1H7TA 1FR8A 4HO0A 5J49A 1R7UA 2MZBA 1R82A 3V0OA 4EE5A 2A8WA 3FWWA 2OI7A 1OMZA 3DJ4A 4KNXA 4KPXA 1VGTA 2VSHA 4M4KA 5CQPA 5AJPA 2PGYA 1H5TA 2YQSA 3OAMA 5IFYA 3F1CA 4B4MA 2D7IA 1H7QA 4EE3A 5EJZA 1KWSA 1NWGB 4HCQA 2VS3A 2FY7A 3JTJA 1O7OA 4NAKA 1TW1A 4XWIA 3OH4A 1W77A 1ZI3A 3D8VA 1R7YA 1HM9A 1JYKA 1ON8A 2YC5A 3RMWA 2JCOA 3SXCA 1VICA 3SXDA 1IIMA 1FXJA 1O0RA 1H7LA 2Y4LA 4G3QA 1G95A 1TVYA 4UEGA 4B3UA 2WAWA 3OH0A 1HJJA 1H7EA 3CGXA 4NAIA 1E5KA 1FR9A 1NF5B 3I0CA 4KC2A 2Y4MA 5L6SA 2Q4JA 1WT0A 3U2VA 1VH1A 1H5TB 1FWYA 5AJNA 4CVHA 5L6VA 3K8DA 1H7HA 4Y64A 1R7XA 5C3AA 3NGWA 2YC3A 2D0JA 2WVLA 1JV1A 5CMFX 4KNRA 1OMXA 1HJLA 1WSZA 1YROB 1HM8A 4D11A 3CKNA 3SXGA 3K8EA 2X60A 4DDZA 1FZWA 1GWVA 3QVBA 1SS9A 3LW6A 3OH2A 3TZTA 3D98A 5IDSA 1H5SD 2X65A 1G23A 4Y7GA 4G87A 4EEOA 3SPTA 3T7MA 2YQCA 5IDTA 2RJ0A 4M2BA 1WVCA 5C3DA 3I0EA 1ZJOA 2ZU7A 1O23B 3V0NA 1FO8A 3V8ZA 3SX3A 3Q4SA 5CQNX 5CQLX 2VS4A 3CKOA 4EEMA 1FOAA 1HM0A 2RJ8A 3F1YA 4G3PA 4IRPA 1G0RA 4LW3A 5AJOA 4BMAA 5CMGX 2VD4A 3Q80A 4Y6UA 1QGQA 2FFVA 2XWLA 1H5RB 3OC9A 4ECMA 2BO6A 4KRVA 2J0BA 5C49A 1G3LA 1Z90A 2P72A 4FRMA 3V8YA 5EJ1A 1H7FA 2ZU9A 4D0TA 2E3DA 4Y6NA 3BRKX 4BQHA 3V0LA 4YS8A 1S4NA 1ZCVA 4FRDA 2RJ9A 1TZFA 2NXVA 5C4CA 4JD0A 2AM3A 1H4DA 2YESA 1V82A 4L41C 2OI5A 2FFUA 4R7PA 4Y7FA 4B2XA 5C36A 4P02A 1LZ0A 4B4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAL A;  2RIT A;  4ASJ A;  1YP3 A;  1FG5 N;  3BCV A;  4J18 A;  4CJB A;  1FO9 A;  3V0P A;  4CJC A;  1ON6 A;  1FGG A;  2XWN A;  2DPW A;  1VZU A;  2QH5 A;  4HG6 A;  5FTS A;  2APC A;  1G97 A;  5EIY A;  2AM5 A;  3T7O A;  4Y62 A;  3T7N A;  3ZGF A;  4EEG A;  4NAN A;  2AE7 A;  4D48 A;  3D5N A;  4ZDQ A;  1O7Q A;  4KQL A;  3DK5 A;  2XWM A;  2WVK A;  4C2S A;  1FGX A;  2JCK A;  2AEC A;  2OEF A;  2D7R A;  1ZHJ A;  1ZIZ A;  1XHB A;  4HO9 A;  4FRP A;  5FYE A;  1G8O A;  4IRQ A;  2WEE A;  3V0M A;  2UX8 A;  4HO2 A;  3E25 A;  1R7T A;  1G9R A;  1ZDG A;  2FYB A;  3TQD A;  1ZJ0 A;  5C3B A;  1FXO A;  5FU8 A;  3SX7 A;  5CMI A;  5JQQ A;  3U2X A;  1XZ6 A;  1MC3 A;  2PGV A;  3N9W A;  3SXE A;  3R3I A;  2W0V A;  2VFZ A;  3CKV A;  2JCL A;  2V0H A;  2Z86 A;  2A8U A;  1MP3 A;  2Y7A A;  3PKP A;  2V0K A;  2OEG A;  3KIA A;  1JVD A;  3R2W A;  5FU0 A;  3IOI A;  5C47 A;  1VPA A;  1MP5 A;  4Y7T A;  1ZDF A;  2Z87 A;  4HO8 A;  2Y4K A;  1VGZ A;  1NMM B;  1R7V A;  3V91 A;  3I0G A;  2ZU8 A;  4D11 C;  4B5B A;  3ZF8 A;  5FUH A;  1INI A;  3JUK A;  4ASY A;  3OH3 A;  3OH1 A;  5C4D A;  5C4B A;  4EVW A;  3I0D A;  4B4G A;  3USQ A;  1LL2 A;  2I5E A;  1QWJ A;  1G1L A;  3IOH A;  1H5S A;  4FRL A;  1VH3 A;  2Y4J A;  4M2A A;  3ZLK A;  5C1G A;  1YP4 A;  2FYA A;  3SXA A;  1W55 A;  4HO3 A;  4KPZ A;  1ZJP A;  1H3M A;  3EE5 A;  1FRW A;  1WT3 A;  1ZI4 A;  1NQI B;  1YP2 A;  4GBP A;  4AAW A;  1GWW A;  1VGU A;  1MP4 A;  3E26 A;  1H4C A;  4B2W A;  3ZLL A;  2VSI A;  2RIY A;  1GQ9 A;  5C4F A;  3SX5 A;  5C1L A;  1GQC A;  4K6R A;  5DDT A;  2RJ4 A;  2W0W A;  5C48 A;  2WE9 A;  1VZT A;  4FQW A;  2JCJ A;  2E8B A;  4AYJ A;  4FCU A;  3HL3 A;  1WT2 A;  2PX7 A;  2QKX A;  2BO8 A;  2ICY A;  4FRH A;  2AES A;  1ZCT A;  3GUE A;  5CQM X;  2XMH A;  4MND A;  2I5K A;  2RJ6 A;  3I0K A;  1V83 A;  3POL A;  3U0Y A;  2RJ7 A;  1S4P A;  2RJ1 A;  1H5S B;  2FYC B;  3RSB A;  2PA4 A;  3ZGG A;  3USR A;  4HO4 A;  2AH9 A;  3V0Q A;  2WGZ A;  4Y7V A;  1H7G A;  2AGD A;  1WT1 A;  4EE4 A;  4AYL A;  1EYR A;  1VM8 A;  2ICX A;  5HS2 A;  1GX4 A;  1V84 A;  4JIS A;  1G93 A;  5FTV A;  3PKQ A;  4Y63 A;  1ZJ3 A;  1W57 A;  3I0I X;  1ZCY A;  2Y6P A;  4FCE A;  1K4V A;  1GX0 A;  1ZI5 A;  1VZX A;  1QG8 A;  3U2W A;  2O1F A;  1VGW A;  2RIX A;  5BXC A;  1ZCU A;  4M28 A;  2FYD B;  3JUJ A;  2BO4 A;  2CU2 A;  2RJ5 A;  4E1K A;  5DDV A;  2V0I A;  4FRA A;  3I0L A;  4KT7 A;  2BO7 A;  1LL3 A;  2XME A;  1EZI A;  3V90 A;  1R80 A;  3CU0 A;  2O1H A;  1LVW A;  2YQJ A;  2P73 A;  3CKQ A;  1H5R A;  2AM4 A;  1INJ A;  5CMJ A;  2VXM A;  3I0J A;  1I52 A;  4HOC A;  4HO5 A;  4KXO A;  4KC4 A;  4MYB A;  3ST8 A;  3Q7U A;  1PZT A;  3U2U A;  2OI6 A;  2QGI A;  3RMV A;  2X5S A;  5CQO A;  1NKH B;  1LZI A;  1TW5 A;  5C8R A;  3PNN A;  2GGO A;  1QGS A;  2O1G A;  4CJ8 A;  1NHE B;  4AC3 A;  3OGZ A;  5C4E A;  1LZ7 A;  4DEC A;  3U0X A;  1JV3 A;  4FRE A;  4Y7U A;  1R81 A;  1G2V A;  1JVG A;  4HO6 A;  5C1H A;  3SX8 A;  2YCM A;  2RIZ A;  1LL0 A;  4LW6 A;  1PZY B;  1JYL A;  2WVM A;  3IOJ A;  4FRB A;  4FRQ A;  2X5Z A;  4ARW A;  1GA8 A;  1H4E A;  3DUV A;  2V0L A;  5CMH A;  5FV9 A;  2P6W A;  3FOQ A;  4B42 A;  1OQM B;  4Y9X A;  5I1F A;  1ZJ2 A;  1H5S C;  3O3P A;  3SXB A;  2V0J A;  4KC1 A;  1HV9 A;  3OKR A;  2GGQ A;  4FRO A;  4D0Z A;  5C38 A;  1IIN A;  4P00 A;  1ZI1 A;  3CKJ A;  2VS5 A;  4EEA A;  2VXL A;  4G3S A;  1LZJ A;  2YQH A;  1S4O A;  4DE7 A;  1ZJ1 A;  3U2T A;  3I0F A;  3I0H A;  2I7B A;  1H7T A;  1FR8 A;  4HO0 A;  5J49 A;  1R7U A;  2MZB A;  1R82 A;  3V0O A;  4EE5 A;  2A8W A;  3FWW A;  2OI7 A;  1OMZ A;  3DJ4 A;  4KNX A;  4KPX A;  1VGT A;  2VSH A;  4M4K A;  5CQP A;  5AJP A;  2PGY A;  1H5T A;  2YQS A;  3OAM A;  5IFY A;  3F1C A;  4B4M A;  2D7I A;  1H7Q A;  4EE3 A;  5EJZ A;  1KWS A;  1NWG B;  4HCQ A;  2VS3 A;  2FY7 A;  3JTJ A;  1O7O A;  4NAK A;  1TW1 A;  4XWI A;  3OH4 A;  1W77 A;  1ZI3 A;  3D8V A;  1R7Y A;  1HM9 A;  1JYK A;  1ON8 A;  2YC5 A;  3RMW A;  2JCO A;  3SXC A;  1VIC A;  3SXD A;  1IIM A;  1FXJ A;  1O0R A;  1H7L A;  2Y4L A;  4G3Q A;  1G95 A;  1TVY A;  4UEG A;  4B3U A;  2WAW A;  3OH0 A;  1HJJ A;  1H7E A;  3CGX A;  4NAI A;  1E5K A;  1FR9 A;  1NF5 B;  3I0C A;  4KC2 A;  2Y4M A;  5L6S A;  2Q4J A;  1WT0 A;  3U2V A;  1VH1 A;  1H5T B;  1FWY A;  5AJN A;  4CVH A;  5L6V A;  3K8D A;  1H7H A;  4Y64 A;  1R7X A;  5C3A A;  3NGW A;  2YC3 A;  2D0J A;  2WVL A;  1JV1 A;  5CMF X;  4KNR A;  1OMX A;  1HJL A;  1WSZ A;  1YRO B;  1HM8 A;  4D11 A;  3CKN A;  3SXG A;  3K8E A;  2X60 A;  4DDZ A;  1FZW A;  1GWV A;  3QVB A;  1SS9 A;  3LW6 A;  3OH2 A;  3TZT A;  3D98 A;  5IDS A;  1H5S D;  2X65 A;  1G23 A;  4Y7G A;  4G87 A;  4EEO A;  3SPT A;  3T7M A;  2YQC A;  5IDT A;  2RJ0 A;  4M2B A;  1WVC A;  5C3D A;  3I0E A;  1ZJO A;  2ZU7 A;  1O23 B;  3V0N A;  1FO8 A;  3V8Z A;  3SX3 A;  3Q4S A;  5CQN X;  5CQL X;  2VS4 A;  3CKO A;  4EEM A;  1FOA A;  1HM0 A;  2RJ8 A;  3F1Y A;  4G3P A;  4IRP A;  1G0R A;  4LW3 A;  5AJO A;  4BMA A;  5CMG X;  2VD4 A;  3Q80 A;  4Y6U A;  1QGQ A;  2FFV A;  2XWL A;  1H5R B;  3OC9 A;  4ECM A;  2BO6 A;  4KRV A;  5C49 A;  1G3L A;  1Z90 A;  2P72 A;  4FRM A;  3V8Y A;  5EJ1 A;  1H7F A;  2ZU9 A;  4D0T A;  2E3D A;  4Y6N A;  3BRK X;  4BQH A;  3V0L A;  4YS8 A;  1S4N A;  1ZCV A;  4FRD A;  2RJ9 A;  1TZF A;  2NXV A;  5C4C A;  4JD0 A;  2AM3 A;  1H4D A;  2YES A;  1V82 A;  4L41 C;  2OI5 A;  2FFU A;  4R7P A;  4Y7F A;  4B2X A;  5C36 A;  4P02 A;  1LZ0 A;  4B4B A; 
#chains in the Genus database with same CATH topology
 4NAL A;  2RIT A;  4ASJ A;  1YP3 A;  1FG5 N;  3BCV A;  4J18 A;  4CJB A;  1FO9 A;  3V0P A;  4CJC A;  1ON6 A;  1FGG A;  2XWN A;  2DPW A;  1VZU A;  2QH5 A;  4HG6 A;  5FTS A;  2APC A;  1G97 A;  5EIY A;  2AM5 A;  3T7O A;  4Y62 A;  3T7N A;  3ZGF A;  4EEG A;  4NAN A;  2AE7 A;  4D48 A;  3D5N A;  4ZDQ A;  1O7Q A;  4KQL A;  4O6N A;  3DK5 A;  2XWM A;  2WVK A;  4C2S A;  1FGX A;  2JCK A;  2AEC A;  2OEF A;  2D7R A;  1ZHJ A;  1ZIZ A;  1XHB A;  4HO9 A;  4FRP A;  5FYE A;  1G8O A;  4IRQ A;  2WEE A;  3V0M A;  2UX8 A;  4HO2 A;  3E25 A;  1R7T A;  1G9R A;  1ZDG A;  2FYB A;  3TQD A;  1ZJ0 A;  5C3B A;  1FXO A;  5FU8 A;  3SX7 A;  5CMI A;  5JQQ A;  3U2X A;  1XZ6 A;  1MC3 A;  2PGV A;  3N9W A;  3SXE A;  3R3I A;  2W0V A;  2VFZ A;  3CKV A;  2JCL A;  2V0H A;  2Z86 A;  2A8U A;  1MP3 A;  2Y7A A;  3PKP A;  2V0K A;  2OEG A;  3KIA A;  1JVD A;  3R2W A;  5FU0 A;  3IOI A;  5C47 A;  1VPA A;  1MP5 A;  4Y7T A;  1ZDF A;  2Z87 A;  4HO8 A;  2Y4K A;  4Q7C A;  1VGZ A;  1NMM B;  1R7V A;  3V91 A;  3I0G A;  2ZU8 A;  4D11 C;  4B5B A;  3ZF8 A;  5FUH A;  1INI A;  3JUK A;  4ASY A;  3OH3 A;  3OH1 A;  5C4D A;  5C4B A;  4EVW A;  3I0D A;  2VK9 A;  4B4G A;  3USQ A;  1LL2 A;  2I5E A;  1QWJ A;  1G1L A;  3IOH A;  1H5S A;  4FRL A;  1VH3 A;  2Y4J A;  4M2A A;  3ZLK A;  5C1G A;  1YP4 A;  2FYA A;  3SXA A;  1W55 A;  4HO3 A;  4KPZ A;  1ZJP A;  1H3M A;  3EE5 A;  1FRW A;  1WT3 A;  1ZI4 A;  1NQI B;  1YP2 A;  4GBP A;  4AAW A;  1GWW A;  1VGU A;  1MP4 A;  3E26 A;  1H4C A;  4B2W A;  3ZLL A;  2VSI A;  2RIY A;  4O6M A;  1GQ9 A;  5C4F A;  3SX5 A;  5C1L A;  1GQC A;  4K6R A;  5DDT A;  2RJ4 A;  2W0W A;  5C48 A;  2WE9 A;  1VZT A;  4FQW A;  2JCJ A;  2E8B A;  4AYJ A;  4FCU A;  5D91 A;  3HL3 A;  1WT2 A;  2PX7 A;  4FIY A;  2QKX A;  2BO8 A;  2ICY A;  4FRH A;  2AES A;  1ZCT A;  3GUE A;  5CQM X;  2XMH A;  4MND A;  2I5K A;  2RJ6 A;  3I0K A;  1V83 A;  3POL A;  3U0Y A;  2RJ7 A;  1S4P A;  2RJ1 A;  1H5S B;  2FYC B;  3RSB A;  2PA4 A;  3ZGG A;  3USR A;  4HO4 A;  2AH9 A;  3V0Q A;  2WGZ A;  4Y7V A;  1H7G A;  2AGD A;  1WT1 A;  4EE4 A;  4AYL A;  1EYR A;  1VM8 A;  2ICX A;  5HS2 A;  1GX4 A;  1V84 A;  4JIS A;  1G93 A;  5FTV A;  3PKQ A;  4Y63 A;  1ZJ3 A;  2J0A A;  1W57 A;  3I0I X;  1ZCY A;  2Y6P A;  4FCE A;  1K4V A;  1GX0 A;  1ZI5 A;  1VZX A;  1QG8 A;  3U2W A;  2O1F A;  1VGW A;  2RIX A;  5BXC A;  1ZCU A;  4M28 A;  2FYD B;  3JUJ A;  2BO4 A;  2CU2 A;  2RJ5 A;  4E1K A;  5D92 A;  5DDV A;  2V0I A;  4FRA A;  3I0L A;  4KT7 A;  2C0N A;  2BO7 A;  1LL3 A;  2XME A;  1EZI A;  3V90 A;  1R80 A;  3CU0 A;  2O1H A;  1LVW A;  2YQJ A;  2P73 A;  3CKQ A;  1H5R A;  2AM4 A;  1INJ A;  5CMJ A;  2VXM A;  3I0J A;  1I52 A;  4HOC A;  4HO5 A;  4KXO A;  4KC4 A;  4MYB A;  3ST8 A;  3Q7U A;  1PZT A;  3U2U A;  2OI6 A;  2QGI A;  3RMV A;  2X5S A;  4FIX A;  5CQO A;  1NKH B;  1LZI A;  1TW5 A;  5C8R A;  3PNN A;  2GGO A;  1QGS A;  2O1G A;  4CJ8 A;  1NHE B;  4AC3 A;  3OGZ A;  5C4E A;  1LZ7 A;  4DEC A;  3U0X A;  1JV3 A;  4FRE A;  4Y7U A;  1R81 A;  1G2V A;  1JVG A;  4HO6 A;  5C1H A;  3SX8 A;  2YCM A;  2RIZ A;  1LL0 A;  4LW6 A;  1PZY B;  1JYL A;  2WVM A;  3IOJ A;  4FRB A;  4FRQ A;  2X5Z A;  4ARW A;  1GA8 A;  1H4E A;  3DUV A;  2V0L A;  5CMH A;  5FV9 A;  2P6W A;  3FOQ A;  4B42 A;  1OQM B;  4Y9X A;  5I1F A;  1ZJ2 A;  1H5S C;  3O3P A;  3SXB A;  2V0J A;  4KC1 A;  1HV9 A;  3OKR A;  2GGQ A;  4FRO A;  4D0Z A;  5C38 A;  1IIN A;  4P00 A;  1ZI1 A;  3CKJ A;  2VS5 A;  4EEA A;  2VXL A;  4G3S A;  1LZJ A;  4MIX A;  2YQH A;  1S4O A;  4DE7 A;  1ZJ1 A;  3U2T A;  3I0F A;  3I0H A;  2I7B A;  1H7T A;  1FR8 A;  4HO0 A;  5J49 A;  1R7U A;  2MZB A;  1R82 A;  3V0O A;  4EE5 A;  2A8W A;  3FWW A;  2OI7 A;  1OMZ A;  3DJ4 A;  4KNX A;  4KPX A;  1VGT A;  2VSH A;  4M4K A;  5CQP A;  5AJP A;  2PGY A;  1H5T A;  2YQS A;  3OAM A;  5IFY A;  3F1C A;  4B4M A;  2D7I A;  1H7Q A;  4EE3 A;  5EJZ A;  1KWS A;  1NWG B;  4HCQ A;  2VS3 A;  2FY7 A;  3JTJ A;  1O7O A;  4NAK A;  1TW1 A;  4XWI A;  3OH4 A;  1W77 A;  1ZI3 A;  3D8V A;  1R7Y A;  1HM9 A;  1JYK A;  1ON8 A;  2YC5 A;  3RMW A;  2JCO A;  3SXC A;  1VIC A;  3SXD A;  1IIM A;  1FXJ A;  1O0R A;  1H7L A;  2Y4L A;  4G3Q A;  1G95 A;  1TVY A;  4UEG A;  4B3U A;  2WAW A;  3OH0 A;  1HJJ A;  1H7E A;  3CGX A;  4NAI A;  1E5K A;  1FR9 A;  1NF5 B;  3I0C A;  4KC2 A;  2Y4M A;  5L6S A;  2Q4J A;  1WT0 A;  3U2V A;  1VH1 A;  1H5T B;  1FWY A;  5AJN A;  4CVH A;  5L6V A;  3K8D A;  1H7H A;  4Y64 A;  1R7X A;  5C3A A;  3NGW A;  2YC3 A;  2D0J A;  2WVL A;  1JV1 A;  5CMF X;  4KNR A;  1OMX A;  1HJL A;  1WSZ A;  1YRO B;  1HM8 A;  4D11 A;  3CKN A;  3SXG A;  3K8E A;  2X60 A;  4DDZ A;  1FZW A;  1GWV A;  3QVB A;  1SS9 A;  3LW6 A;  3OH2 A;  3TZT A;  3D98 A;  5IDS A;  1H5S D;  2X65 A;  1G23 A;  4Y7G A;  4G87 A;  4EEO A;  3SPT A;  3T7M A;  2YQC A;  5IDT A;  2RJ0 A;  4M2B A;  1WVC A;  5C3D A;  3I0E A;  1ZJO A;  2ZU7 A;  1O23 B;  3V0N A;  1FO8 A;  3V8Z A;  3SX3 A;  3Q4S A;  5CQN X;  5CQL X;  2VS4 A;  3CKO A;  4EEM A;  1FOA A;  1HM0 A;  2RJ8 A;  3F1Y A;  4G3P A;  4IRP A;  1G0R A;  4LW3 A;  5AJO A;  4BMA A;  5CMG X;  2VD4 A;  3Q80 A;  4Y6U A;  1QGQ A;  2FFV A;  2XWL A;  1H5R B;  3OC9 A;  4ECM A;  2BO6 A;  4KRV A;  2J0B A;  5C49 A;  1G3L A;  1Z90 A;  2P72 A;  4FRM A;  3V8Y A;  5EJ1 A;  1H7F A;  2ZU9 A;  4D0T A;  2E3D A;  4Y6N A;  3BRK X;  4BQH A;  3V0L A;  4YS8 A;  1S4N A;  1ZCV A;  4FRD A;  2RJ9 A;  1TZF A;  2NXV A;  5C4C A;  4JD0 A;  2AM3 A;  1H4D A;  2YES A;  1V82 A;  4L41 C;  2OI5 A;  2FFU A;  4R7P A;  4Y7F A;  4B2X A;  5C36 A;  4P02 A;  1LZ0 A;  4B4B A; 
#chains in the Genus database with same CATH homology
 4NAL A;  2RIT A;  4ASJ A;  1YP3 A;  1FG5 N;  3BCV A;  4J18 A;  4CJB A;  1FO9 A;  3V0P A;  4CJC A;  1ON6 A;  1FGG A;  2XWN A;  2DPW A;  1VZU A;  2QH5 A;  4HG6 A;  5FTS A;  2APC A;  1G97 A;  5EIY A;  2AM5 A;  3T7O A;  4Y62 A;  3T7N A;  3ZGF A;  4EEG A;  4NAN A;  2AE7 A;  4D48 A;  3D5N A;  4ZDQ A;  1O7Q A;  4KQL A;  4O6N A;  3DK5 A;  2XWM A;  2WVK A;  4C2S A;  1FGX A;  2JCK A;  2AEC A;  2OEF A;  2D7R A;  1ZHJ A;  1ZIZ A;  1XHB A;  4HO9 A;  4FRP A;  5FYE A;  1G8O A;  4IRQ A;  2WEE A;  3V0M A;  2UX8 A;  4HO2 A;  3E25 A;  1R7T A;  1G9R A;  1ZDG A;  2FYB A;  3TQD A;  1ZJ0 A;  5C3B A;  1FXO A;  5FU8 A;  3SX7 A;  5CMI A;  5JQQ A;  3U2X A;  1XZ6 A;  1MC3 A;  2PGV A;  3N9W A;  3SXE A;  3R3I A;  2W0V A;  2VFZ A;  3CKV A;  2JCL A;  2V0H A;  2Z86 A;  2A8U A;  1MP3 A;  2Y7A A;  3PKP A;  2V0K A;  2OEG A;  3KIA A;  1JVD A;  3R2W A;  5FU0 A;  3IOI A;  5C47 A;  1VPA A;  1MP5 A;  4Y7T A;  1ZDF A;  2Z87 A;  4HO8 A;  2Y4K A;  4Q7C A;  1VGZ A;  1NMM B;  1R7V A;  3V91 A;  3I0G A;  2ZU8 A;  4D11 C;  4B5B A;  3ZF8 A;  5FUH A;  1INI A;  3JUK A;  4ASY A;  3OH3 A;  3OH1 A;  5C4D A;  5C4B A;  4EVW A;  3I0D A;  2VK9 A;  4B4G A;  3USQ A;  1LL2 A;  2I5E A;  1QWJ A;  1G1L A;  3IOH A;  1H5S A;  4FRL A;  1VH3 A;  2Y4J A;  4M2A A;  3ZLK A;  5C1G A;  1YP4 A;  2FYA A;  3SXA A;  1W55 A;  4HO3 A;  4KPZ A;  1ZJP A;  1H3M A;  3EE5 A;  1FRW A;  1WT3 A;  1ZI4 A;  1NQI B;  1YP2 A;  4GBP A;  4AAW A;  1GWW A;  1VGU A;  1MP4 A;  3E26 A;  1H4C A;  4B2W A;  3ZLL A;  2VSI A;  2RIY A;  4O6M A;  1GQ9 A;  5C4F A;  3SX5 A;  5C1L A;  1GQC A;  4K6R A;  5DDT A;  2RJ4 A;  2W0W A;  5C48 A;  2WE9 A;  1VZT A;  4FQW A;  2JCJ A;  2E8B A;  4AYJ A;  4FCU A;  5D91 A;  3HL3 A;  1WT2 A;  2PX7 A;  4FIY A;  2QKX A;  2BO8 A;  2ICY A;  4FRH A;  2AES A;  1ZCT A;  3GUE A;  5CQM X;  2XMH A;  4MND A;  2I5K A;  2RJ6 A;  3I0K A;  1V83 A;  3POL A;  3U0Y A;  2RJ7 A;  1S4P A;  2RJ1 A;  1H5S B;  2FYC B;  3RSB A;  2PA4 A;  3ZGG A;  3USR A;  4HO4 A;  2AH9 A;  3V0Q A;  2WGZ A;  4Y7V A;  1H7G A;  2AGD A;  1WT1 A;  4EE4 A;  4AYL A;  1EYR A;  1VM8 A;  2ICX A;  5HS2 A;  1GX4 A;  1V84 A;  4JIS A;  1G93 A;  5FTV A;  3PKQ A;  4Y63 A;  1ZJ3 A;  2J0A A;  1W57 A;  3I0I X;  1ZCY A;  2Y6P A;  4FCE A;  1K4V A;  1GX0 A;  1ZI5 A;  1VZX A;  1QG8 A;  3U2W A;  2O1F A;  1VGW A;  2RIX A;  5BXC A;  1ZCU A;  4M28 A;  2FYD B;  3JUJ A;  2BO4 A;  2CU2 A;  2RJ5 A;  4E1K A;  5D92 A;  5DDV A;  2V0I A;  4FRA A;  3I0L A;  4KT7 A;  2C0N A;  2BO7 A;  1LL3 A;  2XME A;  1EZI A;  3V90 A;  1R80 A;  3CU0 A;  2O1H A;  1LVW A;  2YQJ A;  2P73 A;  3CKQ A;  1H5R A;  2AM4 A;  1INJ A;  5CMJ A;  2VXM A;  3I0J A;  1I52 A;  4HOC A;  4HO5 A;  4KXO A;  4KC4 A;  4MYB A;  3ST8 A;  3Q7U A;  1PZT A;  3U2U A;  2OI6 A;  2QGI A;  3RMV A;  2X5S A;  4FIX A;  5CQO A;  1NKH B;  1LZI A;  1TW5 A;  5C8R A;  3PNN A;  2GGO A;  1QGS A;  2O1G A;  4CJ8 A;  1NHE B;  4AC3 A;  3OGZ A;  5C4E A;  1LZ7 A;  4DEC A;  3U0X A;  1JV3 A;  4FRE A;  4Y7U A;  1R81 A;  1G2V A;  1JVG A;  4HO6 A;  5C1H A;  3SX8 A;  2YCM A;  2RIZ A;  1LL0 A;  4LW6 A;  1PZY B;  1JYL A;  2WVM A;  3IOJ A;  4FRB A;  4FRQ A;  2X5Z A;  4ARW A;  1GA8 A;  1H4E A;  3DUV A;  2V0L A;  5CMH A;  5FV9 A;  2P6W A;  3FOQ A;  4B42 A;  1OQM B;  4Y9X A;  5I1F A;  1ZJ2 A;  1H5S C;  3O3P A;  3SXB A;  2V0J A;  4KC1 A;  1HV9 A;  3OKR A;  2GGQ A;  4FRO A;  4D0Z A;  5C38 A;  1IIN A;  4P00 A;  1ZI1 A;  3CKJ A;  2VS5 A;  4EEA A;  2VXL A;  4G3S A;  1LZJ A;  4MIX A;  2YQH A;  1S4O A;  4DE7 A;  1ZJ1 A;  3U2T A;  3I0F A;  3I0H A;  2I7B A;  1H7T A;  1FR8 A;  4HO0 A;  5J49 A;  1R7U A;  2MZB A;  1R82 A;  3V0O A;  4EE5 A;  2A8W A;  3FWW A;  2OI7 A;  1OMZ A;  3DJ4 A;  4KNX A;  4KPX A;  1VGT A;  2VSH A;  4M4K A;  5CQP A;  5AJP A;  2PGY A;  1H5T A;  2YQS A;  3OAM A;  5IFY A;  3F1C A;  4B4M A;  2D7I A;  1H7Q A;  4EE3 A;  5EJZ A;  1KWS A;  1NWG B;  4HCQ A;  2VS3 A;  2FY7 A;  3JTJ A;  1O7O A;  4NAK A;  1TW1 A;  4XWI A;  3OH4 A;  1W77 A;  1ZI3 A;  3D8V A;  1R7Y A;  1HM9 A;  1JYK A;  1ON8 A;  2YC5 A;  3RMW A;  2JCO A;  3SXC A;  1VIC A;  3SXD A;  1IIM A;  1FXJ A;  1O0R A;  1H7L A;  2Y4L A;  4G3Q A;  1G95 A;  1TVY A;  4UEG A;  4B3U A;  2WAW A;  3OH0 A;  1HJJ A;  1H7E A;  3CGX A;  4NAI A;  1E5K A;  1FR9 A;  1NF5 B;  3I0C A;  4KC2 A;  2Y4M A;  5L6S A;  2Q4J A;  1WT0 A;  3U2V A;  1VH1 A;  1H5T B;  1FWY A;  5AJN A;  4CVH A;  5L6V A;  3K8D A;  1H7H A;  4Y64 A;  1R7X A;  5C3A A;  3NGW A;  2YC3 A;  2D0J A;  2WVL A;  1JV1 A;  5CMF X;  4KNR A;  1OMX A;  1HJL A;  1WSZ A;  1YRO B;  1HM8 A;  4D11 A;  3CKN A;  3SXG A;  3K8E A;  2X60 A;  4DDZ A;  1FZW A;  1GWV A;  3QVB A;  1SS9 A;  3LW6 A;  3OH2 A;  3TZT A;  3D98 A;  5IDS A;  1H5S D;  2X65 A;  1G23 A;  4Y7G A;  4G87 A;  4EEO A;  3SPT A;  3T7M A;  2YQC A;  5IDT A;  2RJ0 A;  4M2B A;  1WVC A;  5C3D A;  3I0E A;  1ZJO A;  2ZU7 A;  1O23 B;  3V0N A;  1FO8 A;  3V8Z A;  3SX3 A;  3Q4S A;  5CQN X;  5CQL X;  2VS4 A;  3CKO A;  4EEM A;  1FOA A;  1HM0 A;  2RJ8 A;  3F1Y A;  4G3P A;  4IRP A;  1G0R A;  4LW3 A;  5AJO A;  4BMA A;  5CMG X;  2VD4 A;  3Q80 A;  4Y6U A;  1QGQ A;  2FFV A;  2XWL A;  1H5R B;  3OC9 A;  4ECM A;  2BO6 A;  4KRV A;  2J0B A;  5C49 A;  1G3L A;  1Z90 A;  2P72 A;  4FRM A;  3V8Y A;  5EJ1 A;  1H7F A;  2ZU9 A;  4D0T A;  2E3D A;  4Y6N A;  3BRK X;  4BQH A;  3V0L A;  4YS8 A;  1S4N A;  1ZCV A;  4FRD A;  2RJ9 A;  1TZF A;  2NXV A;  5C4C A;  4JD0 A;  2AM3 A;  1H4D A;  2YES A;  1V82 A;  4L41 C;  2OI5 A;  2FFU A;  4R7P A;  4Y7F A;  4B2X A;  5C36 A;  4P02 A;  1LZ0 A;  4B4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...