2O1HA

Naturally occurring mutation of humna abo(h) galactosyltransferase in complex with udp: gtb/m214t_udp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
284
structure length
262
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRFLSEVDYLVCVDVDTEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO glycosyltransferase
publication title Structural effects of naturally occurring human blood group B galactosyltransferase mutations adjacent to the DXD motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 262
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2006-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2o1hA00
1K4VA 1WVCA 4HO3A 4HO2A 2FYBA 4XWIA 1H5SC 5CMHA 5DDVA 4EE4A 1EYRA 1XHBA 1VGWA 2V0LA 1NQIB 4AYJA 1FGXA 3I0FA 4M4KA 2WEEA 3U2VA 2NXVA 2PGVA 3SXDA 1ZCYA 2QKXA 4B4MA 5CQPA 2YC5A 3PKQA 3TQDA 1I52A 4HO8A 4J18A 1ZDGA 4CJCA 1H5SA 2YQHA 4FRQA 4AAWA 1LL2A 4Y9XA 5EJ1A 5C48A 1V82A 2Y4KA 3DK5A 1NWGB 4KC1A 1LZJA 1QWJA 2DPWA 3OGZA 1H5TA 1GX0A 1H7FA 4M28A 1WT2A 4B2WA 4KC2A 2RJ7A 3Q80A 4G3SA 1MP3A 2VS4A 4Y7UA 3TZTA 4HO6A 2WAWA 1GQ9A 2ZU8A 1QGQA 1ZJPA 1VZXA 3R3IA 1H7QA 1VICA 1JYLA 1JV1A 4FREA 3V0OA 4ECMA 4Y7TA 2YCMA 1W57A 4ASYA 2JCJA 1WT3A 1YROB 3O3PA 2AM3A 5IFYA 4ARWA 2RJ1A 1MP4A 3N9WA 3K8EA 4G3PA 3JUJA 1G93A 4DE7A 1GX4A 2VSHA 1INIA 2Z86A 4FCEA 3I0KA 4EEGA 1O7OA 1VM8A 2X5SA 2APCA 1R7YA 5CQOA 4G3QA 3SXCA 1VH1A 3CKJA 2E8BA 2Z87A 3V0LA 5C4FA 1S4NA 1LVWA 3OH2A 2VFZA 1H7EA 1VPAA 3IOHA 2VXMA 5EJZA 5C47A 4D0ZA 3BRKX 2W0WA 1VGUA 5CMIA 3U0XA 1H5RA 3I0JA 2PX7A 4ASJA 5L6VA 3SX3A 2V0JA 4HO5A 2I5EA 2E3DA 1NMMB 2I7BA 3V90A 3HL3A 4B4BA 3Q7UA 2P73A 4KC4A 4NAKA 5AJPA 1VGTA 1GWWA 3LW6A 2ZU7A 3R2WA 4L41C 3ST8A 1VZTA 1GA8A 3F1CA 4Y6UA 3Q4SA 1JYKA 3SX8A 4NANA 1R7VA 2XWMA 4Y63A 5C1GA 2FYAA 2AE7A 1YP4A 5C4CA 3E26A 3SX5A 3F1YA 5EIYA 3NGWA 1Z90A 3CU0A 1R7XA 1IINA 4YS8A 1ZCUA 3OH3A 3V0PA 1R82A 2XMEA 4KRVA 2PGYA 1NKHB 3I0LA 2RIXA 4P02A 3OH4A 2AGDA 2RITA 2WVKA 1S4PA 3T7NA 1G0RA 2BO4A 3DJ4A 1NHEB 2OI5A 2RJ0A 1H4CA 5DDTA 2WVLA 2OI6A 1FXJA 2O1HA 2X65A 3RSBA 2VXLA 4NALA 5FTVA 3OAMA 1ZJ0A 2FYCB 1ON6A 1R81A 2D7RA 1ZI3A 4K6RA 1FO8A 1ZI4A 4FCUA 4MYBA 3U2UA 3CKNA 1H7HA 4HO9A 4D0TA 1G95A 3V0MA 2XWNA 2FFVA 2ICYA 5CMGX 3CKOA 5AJNA 1YP2A 2YESA 3IOJA 2RIYA 4EE5A 4AYLA 1FR9A 2MZBA 2RJ4A 2RJ5A 2YQJA 1TW5A 2VD4A 4IRPA 2OEGA 1TW1A 4MNDA 1S4OA 1GQCA 1GWVA 1LL3A 4EEAA 2QH5A 2Q4JA 3SXBA 1H7LA 1ZHJA 3FOQA 4KXOA 1H3MA 2CU2A 5C1HA 2Y7AA 4FQWA 4B4GA 4E1KA 1R7UA 2W0VA 1H5RB 3FWWA 5CQNX 3ZF8A 3PKPA 3V0NA 4BQHA 2AECA 1HM8A 1O7QA 1WSZA 2O1GA 4Y64A 1INJA 1ZCVA 2D7IA 4Y7FA 4FRLA 1W77A 4KT7A 2FFUA 1TVYA 1JVGA 1ZJ3A 4AC3A 3KIAA 1ZJ1A 1O23B 2YC3A 4FRAA 4HCQA 1G2VA 3SXEA 3U0YA 2P6WA 1LZIA 5IDTA 3OKRA 4KPXA 4R7PA 2QGIA 1G9RA 1FG5N 2WGZA 1R7TA 4DECA 4Y7GA 3SX7A 4LW3A 5FYEA 5C38A 4EE3A 5FU0A 2P72A 5FV9A 2FYDB 4KNRA 2GGQA 1G3LA 1EZIA 4B5BA 3U2TA 2I5KA 4KNXA 1ON8A 1ZI1A 2OEFA 2BO7A 2RJ6A 3D8VA 4FRPA 5JQQA 4UEGA 4JD0A 3ZLKA 5C4BA 3JTJA 5C49A 4HO4A 1ZCTA 4CVHA 1V83A 1H5SB 2Y4LA 5AJOA 3I0GA 4GBPA 4IRQA 2Y4JA 5CMFX 3V8YA 5IDSA 2JCOA 3SXAA 4ZDQA 1ZIZA 4LW6A 2V0KA 1H5TB 2RJ8A 1VGZA 1XZ6A 4EEOA 4D11C 3K8DA 3I0DA 4FRMA 1PZTA 1OQMB 3QVBA 4Y62A 5C3DA 3CGXA 2VS5A 1TZFA 1QG8A 4FROA 5C8RA 1FO9A 3JUKA 2RIZA 1HJJA 3CKQA 3USQA 3EE5A 2WVMA 4D11A 1YP3A 3ZLLA 1JV3A 3I0HA 5FUHA 3V91A 3USRA 1E5KA 3E25A 2UX8A 1HV9A 3DUVA 5I1FA 4FRDA 1FR8A 2X60A 1G1LA 2A8WA 3SXGA 3U2WA 2Y6PA 4M2BA 2BO6A 4CJ8A 2JCKA 2XWLA 5FU8A 1LL0A 4M2AA 5J49A 1H7TA 1H4DA 2D0JA 3ZGGA 5C1LA 5BXCA 1FGGA 1G8OA 1VH3A 3POLA 5C3AA 1OMZA 2Y4MA 3T7MA 3OH0A 1FXOA 4FRBA 4JISA 2V0HA 4HG6A 2ICXA 3RMVA 5C4EA 3SPTA 1SS9A 3CKVA 3I0IX 3RMWA 3T7OA 3I0EA 1NF5B 1HM0A 2BO8A 2YQSA 3ZGFA 1FZWA 3BCVA 2X5ZA 3V0QA 4G87A 4HOCA 2FY7A 4D48A 1QGSA 3U2XA 4EEMA 5L6SA 4NAIA 4C2SA 5FTSA 3V8ZA 4EVWA 1JVDA 1ZI5A 1HM9A 3D5NA 2O1FA 2RJ9A 1IIMA 1KWSA 2YQCA 4FRHA 3OC9A 1H7GA 5CQMX 4B2XA 1FOAA 2XMHA 5C4DA 4DDZA 3I0CA 4Y6NA 4B42A 1LZ7A 1HJLA 1OMXA 1VZUA 1PZYB 1W55A 3PNNA 3IOIA 1WT0A 5HS2A 1ZDFA 1ZJ2A 2PA4A 2AM4A 4P00A 1V84A 4B3UA 2VS3A 1FWYA 5CQLX 1G23A 1H5SD 4HO0A 2VSIA 4CJBA 1H4EA 1O0RA 1G97A 4BMAA 2AH9A 2GGOA 4KPZA 2V0IA 1FRWA 2AESA 4KQLA 1ZJOA 2WE9A 1MC3A 1LZ0A 3D98A 3GUEA 1R80A 5C36A 1MP5A 2AM5A 2JCLA 1WT1A 2OI7A 3OH1A 2A8UA 5C3BA 2ZU9A 5CMJA 4Y7VA
chains in the Genus database with same CATH superfamily
1K4VA 1WVCA 4HO3A 4HO2A 2FYBA 4XWIA 1H5SC 5CMHA 5DDVA 4EE4A 1EYRA 1XHBA 1VGWA 2V0LA 1NQIB 4AYJA 1FGXA 3I0FA 4M4KA 2WEEA 3U2VA 2NXVA 2PGVA 3SXDA 1ZCYA 2QKXA 4B4MA 5CQPA 2YC5A 3PKQA 3TQDA 1I52A 4HO8A 4J18A 1ZDGA 2VK9A 4CJCA 1H5SA 2YQHA 4FRQA 4AAWA 1LL2A 4Y9XA 5EJ1A 5C48A 1V82A 4MIXA 2Y4KA 3DK5A 1NWGB 4KC1A 1LZJA 1QWJA 2DPWA 3OGZA 1H5TA 1GX0A 1H7FA 4M28A 1WT2A 4B2WA 4KC2A 2RJ7A 3Q80A 4G3SA 1MP3A 2VS4A 4Y7UA 2J0AA 3TZTA 4HO6A 2WAWA 1GQ9A 2ZU8A 1QGQA 1ZJPA 1VZXA 3R3IA 1H7QA 1VICA 1JYLA 1JV1A 4FREA 3V0OA 4ECMA 4Y7TA 2YCMA 1W57A 4ASYA 2JCJA 1WT3A 1YROB 3O3PA 2AM3A 5IFYA 4ARWA 2RJ1A 1MP4A 3N9WA 3K8EA 4G3PA 3JUJA 1G93A 4DE7A 1GX4A 2VSHA 1INIA 2Z86A 4FCEA 3I0KA 4EEGA 1O7OA 1VM8A 2X5SA 2APCA 1R7YA 5CQOA 4G3QA 3SXCA 1VH1A 3CKJA 2E8BA 2Z87A 3V0LA 5C4FA 1S4NA 1LVWA 3OH2A 2VFZA 1H7EA 1VPAA 3IOHA 2VXMA 5EJZA 5C47A 4D0ZA 3BRKX 2W0WA 1VGUA 5CMIA 3U0XA 1H5RA 2C0NA 3I0JA 2PX7A 4ASJA 5L6VA 3SX3A 2V0JA 4HO5A 2I5EA 2E3DA 1NMMB 2I7BA 3V90A 3HL3A 4B4BA 3Q7UA 2P73A 4KC4A 4NAKA 5AJPA 1VGTA 1GWWA 3LW6A 2ZU7A 3R2WA 4L41C 3ST8A 1VZTA 1GA8A 3F1CA 4Y6UA 3Q4SA 1JYKA 3SX8A 4NANA 1R7VA 2XWMA 4Y63A 5C1GA 2FYAA 2AE7A 1YP4A 5C4CA 3E26A 3SX5A 3F1YA 5EIYA 3NGWA 1Z90A 3CU0A 1R7XA 1IINA 4YS8A 1ZCUA 3OH3A 3V0PA 1R82A 2XMEA 4KRVA 2PGYA 4O6MA 1NKHB 3I0LA 2RIXA 4P02A 3OH4A 2AGDA 2RITA 2WVKA 1S4PA 3T7NA 1G0RA 2BO4A 3DJ4A 1NHEB 2OI5A 2RJ0A 1H4CA 5DDTA 2WVLA 2OI6A 1FXJA 2O1HA 2X65A 3RSBA 2VXLA 4NALA 5FTVA 3OAMA 5D91A 1ZJ0A 2FYCB 1ON6A 1R81A 2D7RA 1ZI3A 4K6RA 1FO8A 1ZI4A 4FCUA 4MYBA 3U2UA 3CKNA 1H7HA 4HO9A 4D0TA 1G95A 3V0MA 2XWNA 2FFVA 2ICYA 5CMGX 3CKOA 5AJNA 1YP2A 2YESA 3IOJA 2RIYA 4EE5A 4AYLA 1FR9A 2MZBA 2RJ4A 2RJ5A 2YQJA 1TW5A 2VD4A 4IRPA 2OEGA 1TW1A 4MNDA 1S4OA 4Q7CA 1GQCA 1GWVA 1LL3A 4EEAA 2QH5A 2Q4JA 3SXBA 1H7LA 1ZHJA 3FOQA 4KXOA 1H3MA 2CU2A 5C1HA 2Y7AA 4FQWA 4B4GA 4E1KA 1R7UA 2W0VA 1H5RB 3FWWA 5CQNX 3ZF8A 3PKPA 3V0NA 4BQHA 2AECA 1HM8A 1O7QA 1WSZA 2O1GA 4Y64A 1INJA 1ZCVA 2D7IA 4Y7FA 4FRLA 1W77A 4KT7A 2FFUA 1TVYA 1JVGA 1ZJ3A 4AC3A 3KIAA 1ZJ1A 1O23B 2YC3A 4FRAA 4HCQA 1G2VA 3SXEA 3U0YA 2P6WA 1LZIA 5IDTA 3OKRA 4KPXA 4R7PA 2QGIA 1G9RA 1FG5N 2WGZA 1R7TA 4DECA 4Y7GA 3SX7A 4LW3A 5FYEA 4FIXA 5C38A 4EE3A 5FU0A 2P72A 5FV9A 2FYDB 4KNRA 2GGQA 1G3LA 1EZIA 4B5BA 3U2TA 2I5KA 4KNXA 1ON8A 1ZI1A 2OEFA 2BO7A 2RJ6A 3D8VA 4FRPA 5JQQA 4UEGA 4JD0A 3ZLKA 5C4BA 3JTJA 5C49A 4HO4A 1ZCTA 4CVHA 1V83A 1H5SB 2Y4LA 5AJOA 3I0GA 4GBPA 4IRQA 2Y4JA 5CMFX 3V8YA 5IDSA 2JCOA 3SXAA 4ZDQA 1ZIZA 4LW6A 2V0KA 1H5TB 2RJ8A 1VGZA 1XZ6A 4EEOA 4D11C 3K8DA 3I0DA 4FRMA 1PZTA 1OQMB 3QVBA 4Y62A 5C3DA 3CGXA 2VS5A 1TZFA 1QG8A 4FROA 5C8RA 1FO9A 3JUKA 2RIZA 1HJJA 4O6NA 3CKQA 3USQA 3EE5A 2WVMA 4D11A 1YP3A 3ZLLA 1JV3A 3I0HA 5FUHA 3V91A 5D92A 3USRA 1E5KA 3E25A 2UX8A 1HV9A 3DUVA 5I1FA 4FRDA 1FR8A 2X60A 1G1LA 2A8WA 3SXGA 3U2WA 2Y6PA 4M2BA 2BO6A 4CJ8A 2JCKA 2XWLA 5FU8A 1LL0A 4M2AA 5J49A 1H7TA 1H4DA 2D0JA 3ZGGA 5C1LA 5BXCA 1FGGA 1G8OA 1VH3A 3POLA 5C3AA 1OMZA 2Y4MA 3T7MA 3OH0A 1FXOA 4FRBA 4JISA 2V0HA 4HG6A 2ICXA 3RMVA 5C4EA 3SPTA 1SS9A 3CKVA 3I0IX 3RMWA 3T7OA 3I0EA 1NF5B 1HM0A 2BO8A 2YQSA 3ZGFA 1FZWA 3BCVA 2X5ZA 3V0QA 4G87A 4HOCA 2FY7A 4D48A 1QGSA 3U2XA 4EEMA 5L6SA 4NAIA 4C2SA 5FTSA 3V8ZA 4EVWA 1JVDA 1ZI5A 1HM9A 3D5NA 2O1FA 2RJ9A 1IIMA 1KWSA 2YQCA 4FRHA 3OC9A 1H7GA 5CQMX 4B2XA 1FOAA 2XMHA 5C4DA 4DDZA 3I0CA 4Y6NA 4B42A 1LZ7A 1HJLA 1OMXA 1VZUA 4FIYA 1PZYB 1W55A 3PNNA 3IOIA 1WT0A 5HS2A 1ZDFA 1ZJ2A 2PA4A 2AM4A 4P00A 1V84A 4B3UA 2VS3A 1FWYA 5CQLX 1G23A 1H5SD 4HO0A 2VSIA 4CJBA 1H4EA 1O0RA 1G97A 4BMAA 2AH9A 2GGOA 4KPZA 2V0IA 2J0BA 1FRWA 2AESA 4KQLA 1ZJOA 2WE9A 1MC3A 1LZ0A 3D98A 3GUEA 1R80A 5C36A 1MP5A 2AM5A 2JCLA 1WT1A 2OI7A 3OH1A 2A8UA 5C3BA 2ZU9A 5CMJA 4Y7VA
chains in the Genus database with same CATH topology
1K4VA 1WVCA 4HO3A 4HO2A 2FYBA 4XWIA 1H5SC 5CMHA 5DDVA 4EE4A 1EYRA 1XHBA 1VGWA 2V0LA 1NQIB 4AYJA 1FGXA 3I0FA 4M4KA 2WEEA 3U2VA 2NXVA 2PGVA 3SXDA 1ZCYA 2QKXA 4B4MA 5CQPA 2YC5A 3PKQA 3TQDA 1I52A 4HO8A 4J18A 1ZDGA 2VK9A 4CJCA 1H5SA 2YQHA 4FRQA 4AAWA 1LL2A 4Y9XA 5EJ1A 5C48A 1V82A 4MIXA 2Y4KA 3DK5A 1NWGB 4KC1A 1LZJA 1QWJA 2DPWA 3OGZA 1H5TA 1GX0A 1H7FA 4M28A 1WT2A 4B2WA 4KC2A 2RJ7A 3Q80A 4G3SA 1MP3A 2VS4A 4Y7UA 2J0AA 3TZTA 4HO6A 2WAWA 1GQ9A 2ZU8A 1QGQA 1ZJPA 1VZXA 3R3IA 1H7QA 1VICA 1JYLA 1JV1A 4FREA 3V0OA 4ECMA 4Y7TA 2YCMA 1W57A 4ASYA 2JCJA 1WT3A 1YROB 3O3PA 2AM3A 5IFYA 4ARWA 2RJ1A 1MP4A 3N9WA 3K8EA 4G3PA 3JUJA 1G93A 4DE7A 1GX4A 2VSHA 1INIA 2Z86A 4FCEA 3I0KA 4EEGA 1O7OA 1VM8A 2X5SA 2APCA 1R7YA 5CQOA 4G3QA 3SXCA 1VH1A 3CKJA 2E8BA 2Z87A 3V0LA 5C4FA 1S4NA 1LVWA 3OH2A 2VFZA 1H7EA 1VPAA 3IOHA 2VXMA 5EJZA 5C47A 4D0ZA 3BRKX 2W0WA 1VGUA 5CMIA 3U0XA 1H5RA 2C0NA 3I0JA 2PX7A 4ASJA 5L6VA 3SX3A 2V0JA 4HO5A 2I5EA 2E3DA 1NMMB 2I7BA 3V90A 3HL3A 4B4BA 3Q7UA 2P73A 4KC4A 4NAKA 5AJPA 1VGTA 1GWWA 3LW6A 2ZU7A 3R2WA 4L41C 3ST8A 1VZTA 1GA8A 3F1CA 4Y6UA 3Q4SA 1JYKA 3SX8A 4NANA 1R7VA 2XWMA 4Y63A 5C1GA 2FYAA 2AE7A 1YP4A 5C4CA 3E26A 3SX5A 3F1YA 5EIYA 3NGWA 1Z90A 3CU0A 1R7XA 1IINA 4YS8A 1ZCUA 3OH3A 3V0PA 1R82A 2XMEA 4KRVA 2PGYA 4O6MA 1NKHB 3I0LA 2RIXA 4P02A 3OH4A 2AGDA 2RITA 2WVKA 1S4PA 3T7NA 1G0RA 2BO4A 3DJ4A 1NHEB 2OI5A 2RJ0A 1H4CA 5DDTA 2WVLA 2OI6A 1FXJA 2O1HA 2X65A 3RSBA 2VXLA 4NALA 5FTVA 3OAMA 5D91A 1ZJ0A 2FYCB 1ON6A 1R81A 2D7RA 1ZI3A 4K6RA 1FO8A 1ZI4A 4FCUA 4MYBA 3U2UA 3CKNA 1H7HA 4HO9A 4D0TA 1G95A 3V0MA 2XWNA 2FFVA 2ICYA 5CMGX 3CKOA 5AJNA 1YP2A 2YESA 3IOJA 2RIYA 4EE5A 4AYLA 1FR9A 2MZBA 2RJ4A 2RJ5A 2YQJA 1TW5A 2VD4A 4IRPA 2OEGA 1TW1A 4MNDA 1S4OA 4Q7CA 1GQCA 1GWVA 1LL3A 4EEAA 2QH5A 2Q4JA 3SXBA 1H7LA 1ZHJA 3FOQA 4KXOA 1H3MA 2CU2A 5C1HA 2Y7AA 4FQWA 4B4GA 4E1KA 1R7UA 2W0VA 1H5RB 3FWWA 5CQNX 3ZF8A 3PKPA 3V0NA 4BQHA 2AECA 1HM8A 1O7QA 1WSZA 2O1GA 4Y64A 1INJA 1ZCVA 2D7IA 4Y7FA 4FRLA 1W77A 4KT7A 2FFUA 1TVYA 1JVGA 1ZJ3A 4AC3A 3KIAA 1ZJ1A 1O23B 2YC3A 4FRAA 4HCQA 1G2VA 3SXEA 3U0YA 2P6WA 1LZIA 5IDTA 3OKRA 4KPXA 4R7PA 2QGIA 1G9RA 1FG5N 2WGZA 1R7TA 4DECA 4Y7GA 3SX7A 4LW3A 5FYEA 4FIXA 5C38A 4EE3A 5FU0A 2P72A 5FV9A 2FYDB 4KNRA 2GGQA 1G3LA 1EZIA 4B5BA 3U2TA 2I5KA 4KNXA 1ON8A 1ZI1A 2OEFA 2BO7A 2RJ6A 3D8VA 4FRPA 5JQQA 4UEGA 4JD0A 3ZLKA 5C4BA 3JTJA 5C49A 4HO4A 1ZCTA 4CVHA 1V83A 1H5SB 2Y4LA 5AJOA 3I0GA 4GBPA 4IRQA 2Y4JA 5CMFX 3V8YA 5IDSA 2JCOA 3SXAA 4ZDQA 1ZIZA 4LW6A 2V0KA 1H5TB 2RJ8A 1VGZA 1XZ6A 4EEOA 4D11C 3K8DA 3I0DA 4FRMA 1PZTA 1OQMB 3QVBA 4Y62A 5C3DA 3CGXA 2VS5A 1TZFA 1QG8A 4FROA 5C8RA 1FO9A 3JUKA 2RIZA 1HJJA 4O6NA 3CKQA 3USQA 3EE5A 2WVMA 4D11A 1YP3A 3ZLLA 1JV3A 3I0HA 5FUHA 3V91A 5D92A 3USRA 1E5KA 3E25A 2UX8A 1HV9A 3DUVA 5I1FA 4FRDA 1FR8A 2X60A 1G1LA 2A8WA 3SXGA 3U2WA 2Y6PA 4M2BA 2BO6A 4CJ8A 2JCKA 2XWLA 5FU8A 1LL0A 4M2AA 5J49A 1H7TA 1H4DA 2D0JA 3ZGGA 5C1LA 5BXCA 1FGGA 1G8OA 1VH3A 3POLA 5C3AA 1OMZA 2Y4MA 3T7MA 3OH0A 1FXOA 4FRBA 4JISA 2V0HA 4HG6A 2ICXA 3RMVA 5C4EA 3SPTA 1SS9A 3CKVA 3I0IX 3RMWA 3T7OA 3I0EA 1NF5B 1HM0A 2BO8A 2YQSA 3ZGFA 1FZWA 3BCVA 2X5ZA 3V0QA 4G87A 4HOCA 2FY7A 4D48A 1QGSA 3U2XA 4EEMA 5L6SA 4NAIA 4C2SA 5FTSA 3V8ZA 4EVWA 1JVDA 1ZI5A 1HM9A 3D5NA 2O1FA 2RJ9A 1IIMA 1KWSA 2YQCA 4FRHA 3OC9A 1H7GA 5CQMX 4B2XA 1FOAA 2XMHA 5C4DA 4DDZA 3I0CA 4Y6NA 4B42A 1LZ7A 1HJLA 1OMXA 1VZUA 4FIYA 1PZYB 1W55A 3PNNA 3IOIA 1WT0A 5HS2A 1ZDFA 1ZJ2A 2PA4A 2AM4A 4P00A 1V84A 4B3UA 2VS3A 1FWYA 5CQLX 1G23A 1H5SD 4HO0A 2VSIA 4CJBA 1H4EA 1O0RA 1G97A 4BMAA 2AH9A 2GGOA 4KPZA 2V0IA 2J0BA 1FRWA 2AESA 4KQLA 1ZJOA 2WE9A 1MC3A 1LZ0A 3D98A 3GUEA 1R80A 5C36A 1MP5A 2AM5A 2JCLA 1WT1A 2OI7A 3OH1A 2A8UA 5C3BA 2ZU9A 5CMJA 4Y7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4V A;  1WVC A;  4HO3 A;  4HO2 A;  2FYB A;  4XWI A;  1H5S C;  5CMH A;  5DDV A;  4EE4 A;  1EYR A;  1XHB A;  1VGW A;  2V0L A;  1NQI B;  4AYJ A;  1FGX A;  3I0F A;  4M4K A;  2WEE A;  3U2V A;  2NXV A;  2PGV A;  3SXD A;  1ZCY A;  2QKX A;  4B4M A;  5CQP A;  2YC5 A;  3PKQ A;  3TQD A;  1I52 A;  4HO8 A;  4J18 A;  1ZDG A;  4CJC A;  1H5S A;  2YQH A;  4FRQ A;  4AAW A;  1LL2 A;  4Y9X A;  5EJ1 A;  5C48 A;  1V82 A;  2Y4K A;  3DK5 A;  1NWG B;  4KC1 A;  1LZJ A;  1QWJ A;  2DPW A;  3OGZ A;  1H5T A;  1GX0 A;  1H7F A;  4M28 A;  1WT2 A;  4B2W A;  4KC2 A;  2RJ7 A;  3Q80 A;  4G3S A;  1MP3 A;  2VS4 A;  4Y7U A;  3TZT A;  4HO6 A;  2WAW A;  1GQ9 A;  2ZU8 A;  1QGQ A;  1ZJP A;  1VZX A;  3R3I A;  1H7Q A;  1VIC A;  1JYL A;  1JV1 A;  4FRE A;  3V0O A;  4ECM A;  4Y7T A;  2YCM A;  1W57 A;  4ASY A;  2JCJ A;  1WT3 A;  1YRO B;  3O3P A;  2AM3 A;  5IFY A;  4ARW A;  2RJ1 A;  1MP4 A;  3N9W A;  3K8E A;  4G3P A;  3JUJ A;  1G93 A;  4DE7 A;  1GX4 A;  2VSH A;  1INI A;  2Z86 A;  4FCE A;  3I0K A;  4EEG A;  1O7O A;  1VM8 A;  2X5S A;  2APC A;  1R7Y A;  5CQO A;  4G3Q A;  3SXC A;  1VH1 A;  3CKJ A;  2E8B A;  2Z87 A;  3V0L A;  5C4F A;  1S4N A;  1LVW A;  3OH2 A;  2VFZ A;  1H7E A;  1VPA A;  3IOH A;  2VXM A;  5EJZ A;  5C47 A;  4D0Z A;  3BRK X;  2W0W A;  1VGU A;  5CMI A;  3U0X A;  1H5R A;  3I0J A;  2PX7 A;  4ASJ A;  5L6V A;  3SX3 A;  2V0J A;  4HO5 A;  2I5E A;  2E3D A;  1NMM B;  2I7B A;  3V90 A;  3HL3 A;  4B4B A;  3Q7U A;  2P73 A;  4KC4 A;  4NAK A;  5AJP A;  1VGT A;  1GWW A;  3LW6 A;  2ZU7 A;  3R2W A;  4L41 C;  3ST8 A;  1VZT A;  1GA8 A;  3F1C A;  4Y6U A;  3Q4S A;  1JYK A;  3SX8 A;  4NAN A;  1R7V A;  2XWM A;  4Y63 A;  5C1G A;  2FYA A;  2AE7 A;  1YP4 A;  5C4C A;  3E26 A;  3SX5 A;  3F1Y A;  5EIY A;  3NGW A;  1Z90 A;  3CU0 A;  1R7X A;  1IIN A;  4YS8 A;  1ZCU A;  3OH3 A;  3V0P A;  1R82 A;  2XME A;  4KRV A;  2PGY A;  1NKH B;  3I0L A;  2RIX A;  4P02 A;  3OH4 A;  2AGD A;  2RIT A;  2WVK A;  1S4P A;  3T7N A;  1G0R A;  2BO4 A;  3DJ4 A;  1NHE B;  2OI5 A;  2RJ0 A;  1H4C A;  5DDT A;  2WVL A;  2OI6 A;  1FXJ A;  2O1H A;  2X65 A;  3RSB A;  2VXL A;  4NAL A;  5FTV A;  3OAM A;  1ZJ0 A;  2FYC B;  1ON6 A;  1R81 A;  2D7R A;  1ZI3 A;  4K6R A;  1FO8 A;  1ZI4 A;  4FCU A;  4MYB A;  3U2U A;  3CKN A;  1H7H A;  4HO9 A;  4D0T A;  1G95 A;  3V0M A;  2XWN A;  2FFV A;  2ICY A;  5CMG X;  3CKO A;  5AJN A;  1YP2 A;  2YES A;  3IOJ A;  2RIY A;  4EE5 A;  4AYL A;  1FR9 A;  2MZB A;  2RJ4 A;  2RJ5 A;  2YQJ A;  1TW5 A;  2VD4 A;  4IRP A;  2OEG A;  1TW1 A;  4MND A;  1S4O A;  1GQC A;  1GWV A;  1LL3 A;  4EEA A;  2QH5 A;  2Q4J A;  3SXB A;  1H7L A;  1ZHJ A;  3FOQ A;  4KXO A;  1H3M A;  2CU2 A;  5C1H A;  2Y7A A;  4FQW A;  4B4G A;  4E1K A;  1R7U A;  2W0V A;  1H5R B;  3FWW A;  5CQN X;  3ZF8 A;  3PKP A;  3V0N A;  4BQH A;  2AEC A;  1HM8 A;  1O7Q A;  1WSZ A;  2O1G A;  4Y64 A;  1INJ A;  1ZCV A;  2D7I A;  4Y7F A;  4FRL A;  1W77 A;  4KT7 A;  2FFU A;  1TVY A;  1JVG A;  1ZJ3 A;  4AC3 A;  3KIA A;  1ZJ1 A;  1O23 B;  2YC3 A;  4FRA A;  4HCQ A;  1G2V A;  3SXE A;  3U0Y A;  2P6W A;  1LZI A;  5IDT A;  3OKR A;  4KPX A;  4R7P A;  2QGI A;  1G9R A;  1FG5 N;  2WGZ A;  1R7T A;  4DEC A;  4Y7G A;  3SX7 A;  4LW3 A;  5FYE A;  5C38 A;  4EE3 A;  5FU0 A;  2P72 A;  5FV9 A;  2FYD B;  4KNR A;  2GGQ A;  1G3L A;  1EZI A;  4B5B A;  3U2T A;  2I5K A;  4KNX A;  1ON8 A;  1ZI1 A;  2OEF A;  2BO7 A;  2RJ6 A;  3D8V A;  4FRP A;  5JQQ A;  4UEG A;  4JD0 A;  3ZLK A;  5C4B A;  3JTJ A;  5C49 A;  4HO4 A;  1ZCT A;  4CVH A;  1V83 A;  1H5S B;  2Y4L A;  5AJO A;  3I0G A;  4GBP A;  4IRQ A;  2Y4J A;  5CMF X;  3V8Y A;  5IDS A;  2JCO A;  3SXA A;  4ZDQ A;  1ZIZ A;  4LW6 A;  2V0K A;  1H5T B;  2RJ8 A;  1VGZ A;  1XZ6 A;  4EEO A;  4D11 C;  3K8D A;  3I0D A;  4FRM A;  1PZT A;  1OQM B;  3QVB A;  4Y62 A;  5C3D A;  3CGX A;  2VS5 A;  1TZF A;  1QG8 A;  4FRO A;  5C8R A;  1FO9 A;  3JUK A;  2RIZ A;  1HJJ A;  3CKQ A;  3USQ A;  3EE5 A;  2WVM A;  4D11 A;  1YP3 A;  3ZLL A;  1JV3 A;  3I0H A;  5FUH A;  3V91 A;  3USR A;  1E5K A;  3E25 A;  2UX8 A;  1HV9 A;  3DUV A;  5I1F A;  4FRD A;  1FR8 A;  2X60 A;  1G1L A;  2A8W A;  3SXG A;  3U2W A;  2Y6P A;  4M2B A;  2BO6 A;  4CJ8 A;  2JCK A;  2XWL A;  5FU8 A;  1LL0 A;  4M2A A;  5J49 A;  1H7T A;  1H4D A;  2D0J A;  3ZGG A;  5C1L A;  5BXC A;  1FGG A;  1G8O A;  1VH3 A;  3POL A;  5C3A A;  1OMZ A;  2Y4M A;  3T7M A;  3OH0 A;  1FXO A;  4FRB A;  4JIS A;  2V0H A;  4HG6 A;  2ICX A;  3RMV A;  5C4E A;  3SPT A;  1SS9 A;  3CKV A;  3I0I X;  3RMW A;  3T7O A;  3I0E A;  1NF5 B;  1HM0 A;  2BO8 A;  2YQS A;  3ZGF A;  1FZW A;  3BCV A;  2X5Z A;  3V0Q A;  4G87 A;  4HOC A;  2FY7 A;  4D48 A;  1QGS A;  3U2X A;  4EEM A;  5L6S A;  4NAI A;  4C2S A;  5FTS A;  3V8Z A;  4EVW A;  1JVD A;  1ZI5 A;  1HM9 A;  3D5N A;  2O1F A;  2RJ9 A;  1IIM A;  1KWS A;  2YQC A;  4FRH A;  3OC9 A;  1H7G A;  5CQM X;  4B2X A;  1FOA A;  2XMH A;  5C4D A;  4DDZ A;  3I0C A;  4Y6N A;  4B42 A;  1LZ7 A;  1HJL A;  1OMX A;  1VZU A;  1PZY B;  1W55 A;  3PNN A;  3IOI A;  1WT0 A;  5HS2 A;  1ZDF A;  1ZJ2 A;  2PA4 A;  2AM4 A;  4P00 A;  1V84 A;  4B3U A;  2VS3 A;  1FWY A;  5CQL X;  1G23 A;  1H5S D;  4HO0 A;  2VSI A;  4CJB A;  1H4E A;  1O0R A;  1G97 A;  4BMA A;  2AH9 A;  2GGO A;  4KPZ A;  2V0I A;  1FRW A;  2AES A;  4KQL A;  1ZJO A;  2WE9 A;  1MC3 A;  1LZ0 A;  3D98 A;  3GUE A;  1R80 A;  5C36 A;  1MP5 A;  2AM5 A;  2JCL A;  1WT1 A;  2OI7 A;  3OH1 A;  2A8U A;  5C3B A;  2ZU9 A;  5CMJ A;  4Y7V A; 
#chains in the Genus database with same CATH topology
 1K4V A;  1WVC A;  4HO3 A;  4HO2 A;  2FYB A;  4XWI A;  1H5S C;  5CMH A;  5DDV A;  4EE4 A;  1EYR A;  1XHB A;  1VGW A;  2V0L A;  1NQI B;  4AYJ A;  1FGX A;  3I0F A;  4M4K A;  2WEE A;  3U2V A;  2NXV A;  2PGV A;  3SXD A;  1ZCY A;  2QKX A;  4B4M A;  5CQP A;  2YC5 A;  3PKQ A;  3TQD A;  1I52 A;  4HO8 A;  4J18 A;  1ZDG A;  2VK9 A;  4CJC A;  1H5S A;  2YQH A;  4FRQ A;  4AAW A;  1LL2 A;  4Y9X A;  5EJ1 A;  5C48 A;  1V82 A;  4MIX A;  2Y4K A;  3DK5 A;  1NWG B;  4KC1 A;  1LZJ A;  1QWJ A;  2DPW A;  3OGZ A;  1H5T A;  1GX0 A;  1H7F A;  4M28 A;  1WT2 A;  4B2W A;  4KC2 A;  2RJ7 A;  3Q80 A;  4G3S A;  1MP3 A;  2VS4 A;  4Y7U A;  2J0A A;  3TZT A;  4HO6 A;  2WAW A;  1GQ9 A;  2ZU8 A;  1QGQ A;  1ZJP A;  1VZX A;  3R3I A;  1H7Q A;  1VIC A;  1JYL A;  1JV1 A;  4FRE A;  3V0O A;  4ECM A;  4Y7T A;  2YCM A;  1W57 A;  4ASY A;  2JCJ A;  1WT3 A;  1YRO B;  3O3P A;  2AM3 A;  5IFY A;  4ARW A;  2RJ1 A;  1MP4 A;  3N9W A;  3K8E A;  4G3P A;  3JUJ A;  1G93 A;  4DE7 A;  1GX4 A;  2VSH A;  1INI A;  2Z86 A;  4FCE A;  3I0K A;  4EEG A;  1O7O A;  1VM8 A;  2X5S A;  2APC A;  1R7Y A;  5CQO A;  4G3Q A;  3SXC A;  1VH1 A;  3CKJ A;  2E8B A;  2Z87 A;  3V0L A;  5C4F A;  1S4N A;  1LVW A;  3OH2 A;  2VFZ A;  1H7E A;  1VPA A;  3IOH A;  2VXM A;  5EJZ A;  5C47 A;  4D0Z A;  3BRK X;  2W0W A;  1VGU A;  5CMI A;  3U0X A;  1H5R A;  2C0N A;  3I0J A;  2PX7 A;  4ASJ A;  5L6V A;  3SX3 A;  2V0J A;  4HO5 A;  2I5E A;  2E3D A;  1NMM B;  2I7B A;  3V90 A;  3HL3 A;  4B4B A;  3Q7U A;  2P73 A;  4KC4 A;  4NAK A;  5AJP A;  1VGT A;  1GWW A;  3LW6 A;  2ZU7 A;  3R2W A;  4L41 C;  3ST8 A;  1VZT A;  1GA8 A;  3F1C A;  4Y6U A;  3Q4S A;  1JYK A;  3SX8 A;  4NAN A;  1R7V A;  2XWM A;  4Y63 A;  5C1G A;  2FYA A;  2AE7 A;  1YP4 A;  5C4C A;  3E26 A;  3SX5 A;  3F1Y A;  5EIY A;  3NGW A;  1Z90 A;  3CU0 A;  1R7X A;  1IIN A;  4YS8 A;  1ZCU A;  3OH3 A;  3V0P A;  1R82 A;  2XME A;  4KRV A;  2PGY A;  4O6M A;  1NKH B;  3I0L A;  2RIX A;  4P02 A;  3OH4 A;  2AGD A;  2RIT A;  2WVK A;  1S4P A;  3T7N A;  1G0R A;  2BO4 A;  3DJ4 A;  1NHE B;  2OI5 A;  2RJ0 A;  1H4C A;  5DDT A;  2WVL A;  2OI6 A;  1FXJ A;  2O1H A;  2X65 A;  3RSB A;  2VXL A;  4NAL A;  5FTV A;  3OAM A;  5D91 A;  1ZJ0 A;  2FYC B;  1ON6 A;  1R81 A;  2D7R A;  1ZI3 A;  4K6R A;  1FO8 A;  1ZI4 A;  4FCU A;  4MYB A;  3U2U A;  3CKN A;  1H7H A;  4HO9 A;  4D0T A;  1G95 A;  3V0M A;  2XWN A;  2FFV A;  2ICY A;  5CMG X;  3CKO A;  5AJN A;  1YP2 A;  2YES A;  3IOJ A;  2RIY A;  4EE5 A;  4AYL A;  1FR9 A;  2MZB A;  2RJ4 A;  2RJ5 A;  2YQJ A;  1TW5 A;  2VD4 A;  4IRP A;  2OEG A;  1TW1 A;  4MND A;  1S4O A;  4Q7C A;  1GQC A;  1GWV A;  1LL3 A;  4EEA A;  2QH5 A;  2Q4J A;  3SXB A;  1H7L A;  1ZHJ A;  3FOQ A;  4KXO A;  1H3M A;  2CU2 A;  5C1H A;  2Y7A A;  4FQW A;  4B4G A;  4E1K A;  1R7U A;  2W0V A;  1H5R B;  3FWW A;  5CQN X;  3ZF8 A;  3PKP A;  3V0N A;  4BQH A;  2AEC A;  1HM8 A;  1O7Q A;  1WSZ A;  2O1G A;  4Y64 A;  1INJ A;  1ZCV A;  2D7I A;  4Y7F A;  4FRL A;  1W77 A;  4KT7 A;  2FFU A;  1TVY A;  1JVG A;  1ZJ3 A;  4AC3 A;  3KIA A;  1ZJ1 A;  1O23 B;  2YC3 A;  4FRA A;  4HCQ A;  1G2V A;  3SXE A;  3U0Y A;  2P6W A;  1LZI A;  5IDT A;  3OKR A;  4KPX A;  4R7P A;  2QGI A;  1G9R A;  1FG5 N;  2WGZ A;  1R7T A;  4DEC A;  4Y7G A;  3SX7 A;  4LW3 A;  5FYE A;  4FIX A;  5C38 A;  4EE3 A;  5FU0 A;  2P72 A;  5FV9 A;  2FYD B;  4KNR A;  2GGQ A;  1G3L A;  1EZI A;  4B5B A;  3U2T A;  2I5K A;  4KNX A;  1ON8 A;  1ZI1 A;  2OEF A;  2BO7 A;  2RJ6 A;  3D8V A;  4FRP A;  5JQQ A;  4UEG A;  4JD0 A;  3ZLK A;  5C4B A;  3JTJ A;  5C49 A;  4HO4 A;  1ZCT A;  4CVH A;  1V83 A;  1H5S B;  2Y4L A;  5AJO A;  3I0G A;  4GBP A;  4IRQ A;  2Y4J A;  5CMF X;  3V8Y A;  5IDS A;  2JCO A;  3SXA A;  4ZDQ A;  1ZIZ A;  4LW6 A;  2V0K A;  1H5T B;  2RJ8 A;  1VGZ A;  1XZ6 A;  4EEO A;  4D11 C;  3K8D A;  3I0D A;  4FRM A;  1PZT A;  1OQM B;  3QVB A;  4Y62 A;  5C3D A;  3CGX A;  2VS5 A;  1TZF A;  1QG8 A;  4FRO A;  5C8R A;  1FO9 A;  3JUK A;  2RIZ A;  1HJJ A;  4O6N A;  3CKQ A;  3USQ A;  3EE5 A;  2WVM A;  4D11 A;  1YP3 A;  3ZLL A;  1JV3 A;  3I0H A;  5FUH A;  3V91 A;  5D92 A;  3USR A;  1E5K A;  3E25 A;  2UX8 A;  1HV9 A;  3DUV A;  5I1F A;  4FRD A;  1FR8 A;  2X60 A;  1G1L A;  2A8W A;  3SXG A;  3U2W A;  2Y6P A;  4M2B A;  2BO6 A;  4CJ8 A;  2JCK A;  2XWL A;  5FU8 A;  1LL0 A;  4M2A A;  5J49 A;  1H7T A;  1H4D A;  2D0J A;  3ZGG A;  5C1L A;  5BXC A;  1FGG A;  1G8O A;  1VH3 A;  3POL A;  5C3A A;  1OMZ A;  2Y4M A;  3T7M A;  3OH0 A;  1FXO A;  4FRB A;  4JIS A;  2V0H A;  4HG6 A;  2ICX A;  3RMV A;  5C4E A;  3SPT A;  1SS9 A;  3CKV A;  3I0I X;  3RMW A;  3T7O A;  3I0E A;  1NF5 B;  1HM0 A;  2BO8 A;  2YQS A;  3ZGF A;  1FZW A;  3BCV A;  2X5Z A;  3V0Q A;  4G87 A;  4HOC A;  2FY7 A;  4D48 A;  1QGS A;  3U2X A;  4EEM A;  5L6S A;  4NAI A;  4C2S A;  5FTS A;  3V8Z A;  4EVW A;  1JVD A;  1ZI5 A;  1HM9 A;  3D5N A;  2O1F A;  2RJ9 A;  1IIM A;  1KWS A;  2YQC A;  4FRH A;  3OC9 A;  1H7G A;  5CQM X;  4B2X A;  1FOA A;  2XMH A;  5C4D A;  4DDZ A;  3I0C A;  4Y6N A;  4B42 A;  1LZ7 A;  1HJL A;  1OMX A;  1VZU A;  4FIY A;  1PZY B;  1W55 A;  3PNN A;  3IOI A;  1WT0 A;  5HS2 A;  1ZDF A;  1ZJ2 A;  2PA4 A;  2AM4 A;  4P00 A;  1V84 A;  4B3U A;  2VS3 A;  1FWY A;  5CQL X;  1G23 A;  1H5S D;  4HO0 A;  2VSI A;  4CJB A;  1H4E A;  1O0R A;  1G97 A;  4BMA A;  2AH9 A;  2GGO A;  4KPZ A;  2V0I A;  2J0B A;  1FRW A;  2AES A;  4KQL A;  1ZJO A;  2WE9 A;  1MC3 A;  1LZ0 A;  3D98 A;  3GUE A;  1R80 A;  5C36 A;  1MP5 A;  2AM5 A;  2JCL A;  1WT1 A;  2OI7 A;  3OH1 A;  2A8U A;  5C3B A;  2ZU9 A;  5CMJ A;  4Y7V A; 
#chains in the Genus database with same CATH homology
 1K4V A;  1WVC A;  4HO3 A;  4HO2 A;  2FYB A;  4XWI A;  1H5S C;  5CMH A;  5DDV A;  4EE4 A;  1EYR A;  1XHB A;  1VGW A;  2V0L A;  1NQI B;  4AYJ A;  1FGX A;  3I0F A;  4M4K A;  2WEE A;  3U2V A;  2NXV A;  2PGV A;  3SXD A;  1ZCY A;  2QKX A;  4B4M A;  5CQP A;  2YC5 A;  3PKQ A;  3TQD A;  1I52 A;  4HO8 A;  4J18 A;  1ZDG A;  2VK9 A;  4CJC A;  1H5S A;  2YQH A;  4FRQ A;  4AAW A;  1LL2 A;  4Y9X A;  5EJ1 A;  5C48 A;  1V82 A;  4MIX A;  2Y4K A;  3DK5 A;  1NWG B;  4KC1 A;  1LZJ A;  1QWJ A;  2DPW A;  3OGZ A;  1H5T A;  1GX0 A;  1H7F A;  4M28 A;  1WT2 A;  4B2W A;  4KC2 A;  2RJ7 A;  3Q80 A;  4G3S A;  1MP3 A;  2VS4 A;  4Y7U A;  2J0A A;  3TZT A;  4HO6 A;  2WAW A;  1GQ9 A;  2ZU8 A;  1QGQ A;  1ZJP A;  1VZX A;  3R3I A;  1H7Q A;  1VIC A;  1JYL A;  1JV1 A;  4FRE A;  3V0O A;  4ECM A;  4Y7T A;  2YCM A;  1W57 A;  4ASY A;  2JCJ A;  1WT3 A;  1YRO B;  3O3P A;  2AM3 A;  5IFY A;  4ARW A;  2RJ1 A;  1MP4 A;  3N9W A;  3K8E A;  4G3P A;  3JUJ A;  1G93 A;  4DE7 A;  1GX4 A;  2VSH A;  1INI A;  2Z86 A;  4FCE A;  3I0K A;  4EEG A;  1O7O A;  1VM8 A;  2X5S A;  2APC A;  1R7Y A;  5CQO A;  4G3Q A;  3SXC A;  1VH1 A;  3CKJ A;  2E8B A;  2Z87 A;  3V0L A;  5C4F A;  1S4N A;  1LVW A;  3OH2 A;  2VFZ A;  1H7E A;  1VPA A;  3IOH A;  2VXM A;  5EJZ A;  5C47 A;  4D0Z A;  3BRK X;  2W0W A;  1VGU A;  5CMI A;  3U0X A;  1H5R A;  2C0N A;  3I0J A;  2PX7 A;  4ASJ A;  5L6V A;  3SX3 A;  2V0J A;  4HO5 A;  2I5E A;  2E3D A;  1NMM B;  2I7B A;  3V90 A;  3HL3 A;  4B4B A;  3Q7U A;  2P73 A;  4KC4 A;  4NAK A;  5AJP A;  1VGT A;  1GWW A;  3LW6 A;  2ZU7 A;  3R2W A;  4L41 C;  3ST8 A;  1VZT A;  1GA8 A;  3F1C A;  4Y6U A;  3Q4S A;  1JYK A;  3SX8 A;  4NAN A;  1R7V A;  2XWM A;  4Y63 A;  5C1G A;  2FYA A;  2AE7 A;  1YP4 A;  5C4C A;  3E26 A;  3SX5 A;  3F1Y A;  5EIY A;  3NGW A;  1Z90 A;  3CU0 A;  1R7X A;  1IIN A;  4YS8 A;  1ZCU A;  3OH3 A;  3V0P A;  1R82 A;  2XME A;  4KRV A;  2PGY A;  4O6M A;  1NKH B;  3I0L A;  2RIX A;  4P02 A;  3OH4 A;  2AGD A;  2RIT A;  2WVK A;  1S4P A;  3T7N A;  1G0R A;  2BO4 A;  3DJ4 A;  1NHE B;  2OI5 A;  2RJ0 A;  1H4C A;  5DDT A;  2WVL A;  2OI6 A;  1FXJ A;  2O1H A;  2X65 A;  3RSB A;  2VXL A;  4NAL A;  5FTV A;  3OAM A;  5D91 A;  1ZJ0 A;  2FYC B;  1ON6 A;  1R81 A;  2D7R A;  1ZI3 A;  4K6R A;  1FO8 A;  1ZI4 A;  4FCU A;  4MYB A;  3U2U A;  3CKN A;  1H7H A;  4HO9 A;  4D0T A;  1G95 A;  3V0M A;  2XWN A;  2FFV A;  2ICY A;  5CMG X;  3CKO A;  5AJN A;  1YP2 A;  2YES A;  3IOJ A;  2RIY A;  4EE5 A;  4AYL A;  1FR9 A;  2MZB A;  2RJ4 A;  2RJ5 A;  2YQJ A;  1TW5 A;  2VD4 A;  4IRP A;  2OEG A;  1TW1 A;  4MND A;  1S4O A;  4Q7C A;  1GQC A;  1GWV A;  1LL3 A;  4EEA A;  2QH5 A;  2Q4J A;  3SXB A;  1H7L A;  1ZHJ A;  3FOQ A;  4KXO A;  1H3M A;  2CU2 A;  5C1H A;  2Y7A A;  4FQW A;  4B4G A;  4E1K A;  1R7U A;  2W0V A;  1H5R B;  3FWW A;  5CQN X;  3ZF8 A;  3PKP A;  3V0N A;  4BQH A;  2AEC A;  1HM8 A;  1O7Q A;  1WSZ A;  2O1G A;  4Y64 A;  1INJ A;  1ZCV A;  2D7I A;  4Y7F A;  4FRL A;  1W77 A;  4KT7 A;  2FFU A;  1TVY A;  1JVG A;  1ZJ3 A;  4AC3 A;  3KIA A;  1ZJ1 A;  1O23 B;  2YC3 A;  4FRA A;  4HCQ A;  1G2V A;  3SXE A;  3U0Y A;  2P6W A;  1LZI A;  5IDT A;  3OKR A;  4KPX A;  4R7P A;  2QGI A;  1G9R A;  1FG5 N;  2WGZ A;  1R7T A;  4DEC A;  4Y7G A;  3SX7 A;  4LW3 A;  5FYE A;  4FIX A;  5C38 A;  4EE3 A;  5FU0 A;  2P72 A;  5FV9 A;  2FYD B;  4KNR A;  2GGQ A;  1G3L A;  1EZI A;  4B5B A;  3U2T A;  2I5K A;  4KNX A;  1ON8 A;  1ZI1 A;  2OEF A;  2BO7 A;  2RJ6 A;  3D8V A;  4FRP A;  5JQQ A;  4UEG A;  4JD0 A;  3ZLK A;  5C4B A;  3JTJ A;  5C49 A;  4HO4 A;  1ZCT A;  4CVH A;  1V83 A;  1H5S B;  2Y4L A;  5AJO A;  3I0G A;  4GBP A;  4IRQ A;  2Y4J A;  5CMF X;  3V8Y A;  5IDS A;  2JCO A;  3SXA A;  4ZDQ A;  1ZIZ A;  4LW6 A;  2V0K A;  1H5T B;  2RJ8 A;  1VGZ A;  1XZ6 A;  4EEO A;  4D11 C;  3K8D A;  3I0D A;  4FRM A;  1PZT A;  1OQM B;  3QVB A;  4Y62 A;  5C3D A;  3CGX A;  2VS5 A;  1TZF A;  1QG8 A;  4FRO A;  5C8R A;  1FO9 A;  3JUK A;  2RIZ A;  1HJJ A;  4O6N A;  3CKQ A;  3USQ A;  3EE5 A;  2WVM A;  4D11 A;  1YP3 A;  3ZLL A;  1JV3 A;  3I0H A;  5FUH A;  3V91 A;  5D92 A;  3USR A;  1E5K A;  3E25 A;  2UX8 A;  1HV9 A;  3DUV A;  5I1F A;  4FRD A;  1FR8 A;  2X60 A;  1G1L A;  2A8W A;  3SXG A;  3U2W A;  2Y6P A;  4M2B A;  2BO6 A;  4CJ8 A;  2JCK A;  2XWL A;  5FU8 A;  1LL0 A;  4M2A A;  5J49 A;  1H7T A;  1H4D A;  2D0J A;  3ZGG A;  5C1L A;  5BXC A;  1FGG A;  1G8O A;  1VH3 A;  3POL A;  5C3A A;  1OMZ A;  2Y4M A;  3T7M A;  3OH0 A;  1FXO A;  4FRB A;  4JIS A;  2V0H A;  4HG6 A;  2ICX A;  3RMV A;  5C4E A;  3SPT A;  1SS9 A;  3CKV A;  3I0I X;  3RMW A;  3T7O A;  3I0E A;  1NF5 B;  1HM0 A;  2BO8 A;  2YQS A;  3ZGF A;  1FZW A;  3BCV A;  2X5Z A;  3V0Q A;  4G87 A;  4HOC A;  2FY7 A;  4D48 A;  1QGS A;  3U2X A;  4EEM A;  5L6S A;  4NAI A;  4C2S A;  5FTS A;  3V8Z A;  4EVW A;  1JVD A;  1ZI5 A;  1HM9 A;  3D5N A;  2O1F A;  2RJ9 A;  1IIM A;  1KWS A;  2YQC A;  4FRH A;  3OC9 A;  1H7G A;  5CQM X;  4B2X A;  1FOA A;  2XMH A;  5C4D A;  4DDZ A;  3I0C A;  4Y6N A;  4B42 A;  1LZ7 A;  1HJL A;  1OMX A;  1VZU A;  4FIY A;  1PZY B;  1W55 A;  3PNN A;  3IOI A;  1WT0 A;  5HS2 A;  1ZDF A;  1ZJ2 A;  2PA4 A;  2AM4 A;  4P00 A;  1V84 A;  4B3U A;  2VS3 A;  1FWY A;  5CQL X;  1G23 A;  1H5S D;  4HO0 A;  2VSI A;  4CJB A;  1H4E A;  1O0R A;  1G97 A;  4BMA A;  2AH9 A;  2GGO A;  4KPZ A;  2V0I A;  2J0B A;  1FRW A;  2AES A;  4KQL A;  1ZJO A;  2WE9 A;  1MC3 A;  1LZ0 A;  3D98 A;  3GUE A;  1R80 A;  5C36 A;  1MP5 A;  2AM5 A;  2JCL A;  1WT1 A;  2OI7 A;  3OH1 A;  2A8U A;  5C3B A;  2ZU9 A;  5CMJ A;  4Y7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...