2O1HA

Naturally occurring mutation of humna abo(h) galactosyltransferase in complex with udp: gtb/m214t_udp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
284
structure length
262
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRFLSEVDYLVCVDVDTEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Structural effects of naturally occurring human blood group B galactosyltransferase mutations adjacent to the DXD motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 262
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2006-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2o1hA00
1OMZA 2VS4A 3OH1A 1G3LA 4NANA 2W0WA 2AH9A 3OC9A 2AE7A 1ZCYA 4XWIA 1S4NA 2BO8A 4Y64A 5FU8A 3CGXA 5C38A 3V0NA 1H7FA 2X60A 4HG6A 2CU2A 3V0LA 4AYLA 4HOCA 3BRKX 1O7OA 2P6WA 2RIYA 1H5TB 1QWJA 1ZI5A 5JQQA 4FRBA 4Y6UA 3BCVA 5C48A 2D7IA 1H3MA 5C47A 3T7NA 5C4DA 1WT1A 4EE3A 4ARWA 2FY7A 1WSZA 3V0MA 5HS2A 2OI7A 3K8EA 3F1YA 4HO0A 4EEOA 5FU0A 2A8UA 5L6SA 1LZ7A 1HM8A 1R7TA 1O7QA 2YQCA 3SXBA 4KNXA 2RITA 2WVMA 4MNDA 1W57A 1ZCTA 1HM0A 2I5KA 4Y7VA 2OEGA 5CQPA 2RIZA 3DK5A 4Y62A 3USRA 1IINA 5CMJA 4Y9XA 1H5RB 2V0KA 3SXAA 4HO5A 2A8WA 4FREA 1H7EA 1VH1A 1GQCA 2V0LA 5C8RA 4HO8A 3K8DA 4BQHA 1ZHJA 1H7TA 1JVDA 5DDVA 1KWSA 4R7PA 4Y63A 3D8VA 5AJOA 2XMEA 2YC3A 4FRHA 4Y6NA 5EJZA 2APCA 3CKOA 2NXVA 1O23B 2FYAA 2PGYA 4NALA 3IOIA 4BMAA 3V0OA 4KPXA 3SXEA 1R7XA 2OI6A 3I0LA 1W77A 1LVWA 1K4VA 3QVBA 5L6VA 1JYKA 1ZJ1A 1PZYB 2P72A 2O1HA 3U0YA 3DUVA 3I0KA 1INIA 1FWYA 1O0RA 3RMVA 3CKJA 2WE9A 1G95A 2FYCB 1H5SC 2WAWA 4CJ8A 3OH4A 2RJ8A 2JCKA 2VSHA 1W55A 2YESA 2XWMA 2ICYA 2PA4A 5C1GA 1TW1A 3PKPA 4EEGA 1ZDGA 4HO3A 1G93A 4KNRA 3U2TA 1H4EA 2WEEA 3CKNA 3F1CA 4MYBA 2UX8A 2Y4LA 2VFZA 3SXDA 1XZ6A 4KC4A 3I0JA 1GWWA 3I0FA 1ZI4A 4CJCA 1VGZA 1S4OA 1LL3A 2JCOA 3IOHA 1FZWA 1H5SA 3ZGFA 4KC1A 3U2XA 1FR9A 4DDZA 2Y7AA 3R3IA 2ZU7A 5CQLX 3I0CA 1Z90A 2YQHA 2AM3A 1MC3A 4NAIA 2RJ5A 1NQIB 4GBPA 4NAKA 5C4EA 1VZUA 5DDTA 3PNNA 4B2WA 3IOJA 1G9RA 1ZCUA 5CQOA 4FRLA 2FFVA 4M28A 5FYEA 2V0JA 4J18A 3OGZA 1VICA 3Q4SA 1V84A 1R7VA 1NHEB 4ECMA 5C4BA 1R81A 2VXLA 3TZTA 2FFUA 3NGWA 5C4CA 2OEFA 5AJNA 3N9WA 2X5SA 3GUEA 4FQWA 1NKHB 2RJ7A 2QKXA 4HO6A 3USQA 2X65A 4DECA 2YC5A 3OAMA 1H7HA 4HO9A 1WVCA 3ZF8A 4D0ZA 4Y7GA 3FWWA 4JISA 4KPZA 2BO7A 1I52A 1JYLA 1YP2A 5C4FA 2E3DA 1G1LA 4B4MA 4D0TA 4DE7A 4FRQA 2JCLA 3V0PA 2WVLA 3SX7A 3ZGGA 2RIXA 2XWNA 1ZJ2A 5CQNX 3U2WA 4B5BA 1G0RA 5FV9A 2O1FA 5C49A 3V90A 3E26A 1G2VA 3EE5A 3OH3A 1H5TA 1ZDFA 5C1HA 1ZI3A 2I7BA 3HL3A 2Y4MA 1HV9A 1YROB 2FYDB 1VZXA 4M4KA 3I0EA 3V91A 1H5SD 1V82A 1VH3A 1LL2A 1FGGA 2VXMA 5C3BA 4FRMA 3T7MA 5FTSA 1LZJA 1GWVA 2RJ1A 4LW6A 4G3SA 4FCEA 3KIAA 1PZTA 4YS8A 3OH0A 1SS9A 4JD0A 4FROA 2Q4JA 2AECA 1H4DA 4AYJA 1G97A 1VM8A 2E8BA 2I5EA 2XMHA 3RMWA 2GGOA 4P00A 1OQMB 4LW3A 4D48A 2VS3A 3T7OA 3RSBA 2V0HA 2QH5A 5CMFX 2DPWA 1FO9A 1H5RA 4Y7TA 1FR8A 5EJ1A 1TZFA 4HO4A 1LL0A 4AAWA 3POLA 2JCJA 1HJLA 2O1GA 3O3PA 4ZDQA 4KRVA 2XWLA 1R7UA 3ST8A 3FOQA 3SXCA 1HM9A 3I0GA 3E25A 4EE5A 1TW5A 1ZJPA 2D7RA 5C1LA 1YP4A 2Y4KA 2ICXA 1EZIA 2MZBA 2BO4A 3OKRA 4EEMA 1FGXA 2AESA 1ON6A 1H4CA 3CKQA 4IRQA 3DJ4A 4KQLA 1GQ9A 5IDTA 3SX8A 4P02A 5J49A 4M2AA 2D0JA 4KT7A 3Q80A 3U2UA 5AJPA 4Y7FA 5FTVA 3V0QA 4K6RA 4FRAA 1VZTA 2WVKA 5CMIA 1V83A 4E1KA 3D98A 1MP3A 3CKVA 5IFYA 5FUHA 4EEAA 4CJBA 3JUJA 4HO2A 4ASYA 2VS5A 1JVGA 1ON8A 2VSIA 1ZJ0A 2AM4A 5CMGX 2YQJA 2Y6PA 1G8OA 4FRDA 3JUKA 3LW6A 1ZJOA 3OH2A 4FRPA 1G23A 1QGQA 1FO8A 2RJ0A 1H7LA 1NWGB 1VGWA 1OMXA 5CQMX 4B4BA 1MP5A 2YQSA 1H7GA 1JV1A 1R7YA 2RJ4A 4UEGA 5C3AA 3V8ZA 5BXCA 1QGSA 5IDSA 2Z86A 1XHBA 1GA8A 3U2VA 4IRPA 4Y7UA 4EE4A 4B2XA 1IIMA 1LZ0A 3Q7UA 1ZCVA 1FG5N 2WGZA 3I0HA 4CVHA 2OI5A 2PGVA 4G3PA 5C3DA 2FYBA 1HJJA 1YP3A 2V0IA 3ZLKA 1FOAA 3D5NA 3SX5A 3I0DA 4EVWA 4C2SA 3JTJA 1ZI1A 5I1FA 4M2BA 1GX0A 2Z87A 1MP4A 2P73A 3SXGA 2PX7A 2ZU9A 2QGIA 1S4PA 3SPTA 4B4GA 2VD4A 1H5SB 5C36A 4L41C 1FXJA 3I0IX 4G87A 1WT2A 4ASJA 3R2WA 1R82A 1WT0A 1R80A 2X5ZA 1VGTA 4B42A 3CU0A 1QG8A 4AC3A 1FXOA 1WT3A 1ZJ3A 1ZIZA 2BO6A 4D11C 4B3UA 1EYRA 4HCQA 3PKQA 5EIYA 1GX4A 1TVYA 2RJ9A 2AM5A 3SX3A 2RJ6A 3V8YA 1VGUA 2YCMA 1E5KA 1INJA 1JV3A 1VPAA 1FRWA 1NMMB 3ZLLA 2AGDA 4KC2A 4KXOA 2ZU8A 4G3QA 2Y4JA 2W0VA 4FCUA 5CMHA 1NF5B 3U0XA 2GGQA 1H7QA 3TQDA 4D11A 1LZIA
chains in the Genus database with same CATH superfamily
1OMZA 2VS4A 3OH1A 1G3LA 4NANA 2W0WA 2AH9A 3OC9A 2AE7A 1ZCYA 4XWIA 1S4NA 2BO8A 4Y64A 5FU8A 3CGXA 5C38A 3V0NA 1H7FA 2X60A 4HG6A 2CU2A 3V0LA 4AYLA 4HOCA 3BRKX 1O7OA 2P6WA 2RIYA 1H5TB 1QWJA 1ZI5A 4FIYA 5JQQA 4FRBA 4Y6UA 3BCVA 5C48A 2D7IA 1H3MA 5C47A 3T7NA 5C4DA 1WT1A 4EE3A 4ARWA 2FY7A 1WSZA 3V0MA 5HS2A 2OI7A 3K8EA 3F1YA 4HO0A 4EEOA 5FU0A 2A8UA 5L6SA 1LZ7A 1HM8A 1R7TA 1O7QA 2YQCA 3SXBA 4KNXA 2RITA 2VK9A 2WVMA 4MNDA 1W57A 1ZCTA 1HM0A 2I5KA 4Y7VA 2OEGA 5CQPA 2RIZA 3DK5A 4Y62A 3USRA 1IINA 5CMJA 2J0BA 4Y9XA 1H5RB 2V0KA 3SXAA 4HO5A 2A8WA 4FREA 1H7EA 1VH1A 1GQCA 2V0LA 5C8RA 4HO8A 3K8DA 4BQHA 1ZHJA 1H7TA 1JVDA 5DDVA 1KWSA 4R7PA 4Y63A 3D8VA 5AJOA 2XMEA 2YC3A 4FRHA 4Y6NA 5EJZA 2APCA 3CKOA 2NXVA 1O23B 2FYAA 2PGYA 4NALA 3IOIA 4BMAA 3V0OA 4KPXA 3SXEA 1R7XA 2OI6A 3I0LA 1W77A 1LVWA 1K4VA 3QVBA 5L6VA 1JYKA 1ZJ1A 1PZYB 2P72A 2O1HA 3U0YA 3DUVA 3I0KA 1INIA 1FWYA 1O0RA 3RMVA 3CKJA 2WE9A 1G95A 2FYCB 1H5SC 2WAWA 4CJ8A 3OH4A 2RJ8A 2JCKA 2VSHA 1W55A 2YESA 2XWMA 2ICYA 2PA4A 5C1GA 1TW1A 3PKPA 4EEGA 1ZDGA 4HO3A 1G93A 4KNRA 3U2TA 1H4EA 2WEEA 3CKNA 3F1CA 4MYBA 2UX8A 2Y4LA 2VFZA 3SXDA 1XZ6A 4KC4A 3I0JA 1GWWA 3I0FA 1ZI4A 4CJCA 1VGZA 1S4OA 1LL3A 2JCOA 3IOHA 1FZWA 1H5SA 3ZGFA 4KC1A 3U2XA 1FR9A 4DDZA 2Y7AA 3R3IA 2ZU7A 5CQLX 3I0CA 1Z90A 2YQHA 2AM3A 1MC3A 4MIXA 4NAIA 2RJ5A 1NQIB 4GBPA 4NAKA 5C4EA 1VZUA 5DDTA 3PNNA 4B2WA 3IOJA 1G9RA 1ZCUA 5CQOA 4FRLA 2FFVA 4M28A 5FYEA 2V0JA 4J18A 3OGZA 1VICA 3Q4SA 1V84A 1R7VA 1NHEB 4ECMA 5C4BA 1R81A 2VXLA 3TZTA 2FFUA 3NGWA 5C4CA 2OEFA 5AJNA 3N9WA 2X5SA 3GUEA 4FQWA 4O6MA 4Q7CA 1NKHB 2RJ7A 2QKXA 4HO6A 3USQA 2X65A 4DECA 2YC5A 3OAMA 1H7HA 4HO9A 1WVCA 3ZF8A 4D0ZA 4Y7GA 3FWWA 4JISA 4KPZA 2BO7A 1I52A 1JYLA 1YP2A 5C4FA 2E3DA 1G1LA 4B4MA 4D0TA 4DE7A 4FRQA 2JCLA 3V0PA 2C0NA 2WVLA 3SX7A 3ZGGA 2RIXA 2XWNA 1ZJ2A 4FIXA 5CQNX 3U2WA 4B5BA 1G0RA 5FV9A 2O1FA 5C49A 3V90A 3E26A 1G2VA 3EE5A 3OH3A 1H5TA 1ZDFA 5C1HA 1ZI3A 2I7BA 3HL3A 2Y4MA 1HV9A 1YROB 2FYDB 1VZXA 4M4KA 3I0EA 5D92A 3V91A 1H5SD 1V82A 1VH3A 1LL2A 1FGGA 2VXMA 5C3BA 4FRMA 3T7MA 5FTSA 1LZJA 1GWVA 2RJ1A 4LW6A 4G3SA 4FCEA 3KIAA 1PZTA 4YS8A 3OH0A 1SS9A 4JD0A 4FROA 2Q4JA 2AECA 1H4DA 4AYJA 1G97A 1VM8A 5D91A 2E8BA 2I5EA 2XMHA 3RMWA 2GGOA 4P00A 1OQMB 4LW3A 4D48A 2VS3A 3T7OA 3RSBA 2V0HA 2QH5A 5CMFX 2DPWA 1FO9A 1H5RA 4Y7TA 1FR8A 5EJ1A 1TZFA 4HO4A 1LL0A 4AAWA 3POLA 2JCJA 1HJLA 2O1GA 3O3PA 4ZDQA 4KRVA 2XWLA 1R7UA 3ST8A 3FOQA 3SXCA 1HM9A 3I0GA 3E25A 4EE5A 1TW5A 1ZJPA 2D7RA 5C1LA 1YP4A 2Y4KA 2ICXA 1EZIA 2MZBA 2BO4A 3OKRA 4EEMA 1FGXA 2AESA 1ON6A 1H4CA 3CKQA 4IRQA 3DJ4A 4KQLA 1GQ9A 5IDTA 3SX8A 4P02A 5J49A 4M2AA 2D0JA 4KT7A 3Q80A 3U2UA 5AJPA 4Y7FA 5FTVA 3V0QA 2J0AA 4FRAA 4K6RA 1VZTA 2WVKA 5CMIA 1V83A 4E1KA 3D98A 1MP3A 3CKVA 5IFYA 5FUHA 4EEAA 4CJBA 3JUJA 4HO2A 4ASYA 2VS5A 1JVGA 1ON8A 2VSIA 1ZJ0A 2AM4A 5CMGX 2YQJA 2Y6PA 1G8OA 4FRDA 3JUKA 3LW6A 1ZJOA 3OH2A 4FRPA 1G23A 1QGQA 1FO8A 2RJ0A 1H7LA 1NWGB 1VGWA 1OMXA 5CQMX 4B4BA 1MP5A 2YQSA 1H7GA 1JV1A 1R7YA 2RJ4A 4UEGA 5C3AA 3V8ZA 5BXCA 1QGSA 5IDSA 2Z86A 1XHBA 1GA8A 3U2VA 4IRPA 4Y7UA 4EE4A 4B2XA 1IIMA 1LZ0A 3Q7UA 1ZCVA 1FG5N 2WGZA 3I0HA 4CVHA 2OI5A 2PGVA 4G3PA 5C3DA 2FYBA 1HJJA 1YP3A 2V0IA 3ZLKA 1FOAA 4O6NA 3D5NA 3SX5A 3I0DA 4EVWA 4C2SA 3JTJA 1ZI1A 5I1FA 4M2BA 1GX0A 2Z87A 1MP4A 2P73A 3SXGA 2PX7A 2ZU9A 2QGIA 1S4PA 3SPTA 4B4GA 2VD4A 1H5SB 5C36A 4L41C 1FXJA 3I0IX 4G87A 1WT2A 4ASJA 3R2WA 1R82A 1WT0A 1R80A 2X5ZA 1VGTA 4B42A 3CU0A 1QG8A 4AC3A 1FXOA 1WT3A 1ZJ3A 1ZIZA 2BO6A 4D11C 4B3UA 1EYRA 4HCQA 3PKQA 5EIYA 1GX4A 1TVYA 2RJ9A 2AM5A 3SX3A 2RJ6A 3V8YA 1VGUA 2YCMA 1E5KA 1INJA 1JV3A 1VPAA 1FRWA 1NMMB 3ZLLA 2AGDA 4KC2A 4KXOA 2ZU8A 4G3QA 2Y4JA 2W0VA 4FCUA 5CMHA 1NF5B 3U0XA 2GGQA 1H7QA 3TQDA 4D11A 1LZIA
chains in the Genus database with same CATH topology
1OMZA 2VS4A 3OH1A 1G3LA 4NANA 2W0WA 2AH9A 3OC9A 2AE7A 1ZCYA 4XWIA 1S4NA 2BO8A 4Y64A 5FU8A 3CGXA 5C38A 3V0NA 1H7FA 2X60A 4HG6A 2CU2A 3V0LA 4AYLA 4HOCA 3BRKX 1O7OA 2P6WA 2RIYA 1H5TB 1QWJA 1ZI5A 4FIYA 5JQQA 4FRBA 4Y6UA 3BCVA 5C48A 2D7IA 1H3MA 5C47A 3T7NA 5C4DA 1WT1A 4EE3A 4ARWA 2FY7A 1WSZA 3V0MA 5HS2A 2OI7A 3K8EA 3F1YA 4HO0A 4EEOA 5FU0A 2A8UA 5L6SA 1LZ7A 1HM8A 1R7TA 1O7QA 2YQCA 3SXBA 4KNXA 2RITA 2VK9A 2WVMA 4MNDA 1W57A 1ZCTA 1HM0A 2I5KA 4Y7VA 2OEGA 5CQPA 2RIZA 3DK5A 4Y62A 3USRA 1IINA 5CMJA 2J0BA 4Y9XA 1H5RB 2V0KA 3SXAA 4HO5A 2A8WA 4FREA 1H7EA 1VH1A 1GQCA 2V0LA 5C8RA 4HO8A 3K8DA 4BQHA 1ZHJA 1H7TA 1JVDA 5DDVA 1KWSA 4R7PA 4Y63A 3D8VA 5AJOA 2XMEA 2YC3A 4FRHA 4Y6NA 5EJZA 2APCA 3CKOA 2NXVA 1O23B 2FYAA 2PGYA 4NALA 3IOIA 4BMAA 3V0OA 4KPXA 3SXEA 1R7XA 2OI6A 3I0LA 1W77A 1LVWA 1K4VA 3QVBA 5L6VA 1JYKA 1ZJ1A 1PZYB 2P72A 2O1HA 3U0YA 3DUVA 3I0KA 1INIA 1FWYA 1O0RA 3RMVA 3CKJA 2WE9A 1G95A 2FYCB 1H5SC 2WAWA 4CJ8A 3OH4A 2RJ8A 2JCKA 2VSHA 1W55A 2YESA 2XWMA 2ICYA 2PA4A 5C1GA 1TW1A 3PKPA 4EEGA 1ZDGA 4HO3A 1G93A 4KNRA 3U2TA 1H4EA 2WEEA 3CKNA 3F1CA 4MYBA 2UX8A 2Y4LA 2VFZA 3SXDA 1XZ6A 4KC4A 3I0JA 1GWWA 3I0FA 1ZI4A 4CJCA 1VGZA 1S4OA 1LL3A 2JCOA 3IOHA 1FZWA 1H5SA 3ZGFA 4KC1A 3U2XA 1FR9A 4DDZA 2Y7AA 3R3IA 2ZU7A 5CQLX 3I0CA 1Z90A 2YQHA 2AM3A 1MC3A 4MIXA 4NAIA 2RJ5A 1NQIB 4GBPA 4NAKA 5C4EA 1VZUA 5DDTA 3PNNA 4B2WA 3IOJA 1G9RA 1ZCUA 5CQOA 4FRLA 2FFVA 4M28A 5FYEA 2V0JA 4J18A 3OGZA 1VICA 3Q4SA 1V84A 1R7VA 1NHEB 4ECMA 5C4BA 1R81A 2VXLA 3TZTA 2FFUA 3NGWA 5C4CA 2OEFA 5AJNA 3N9WA 2X5SA 3GUEA 4FQWA 4O6MA 4Q7CA 1NKHB 2RJ7A 2QKXA 4HO6A 3USQA 2X65A 4DECA 2YC5A 3OAMA 1H7HA 4HO9A 1WVCA 3ZF8A 4D0ZA 4Y7GA 3FWWA 4JISA 4KPZA 2BO7A 1I52A 1JYLA 1YP2A 5C4FA 2E3DA 1G1LA 4B4MA 4D0TA 4DE7A 4FRQA 2JCLA 3V0PA 2C0NA 2WVLA 3SX7A 3ZGGA 2RIXA 2XWNA 1ZJ2A 4FIXA 5CQNX 3U2WA 4B5BA 1G0RA 5FV9A 2O1FA 5C49A 3V90A 3E26A 1G2VA 3EE5A 3OH3A 1H5TA 1ZDFA 5C1HA 1ZI3A 2I7BA 3HL3A 2Y4MA 1HV9A 1YROB 2FYDB 1VZXA 4M4KA 3I0EA 5D92A 3V91A 1H5SD 1V82A 1VH3A 1LL2A 1FGGA 2VXMA 5C3BA 4FRMA 3T7MA 5FTSA 1LZJA 1GWVA 2RJ1A 4LW6A 4G3SA 4FCEA 3KIAA 1PZTA 4YS8A 3OH0A 1SS9A 4JD0A 4FROA 2Q4JA 2AECA 1H4DA 4AYJA 1G97A 1VM8A 5D91A 2E8BA 2I5EA 2XMHA 3RMWA 2GGOA 4P00A 1OQMB 4LW3A 4D48A 2VS3A 3T7OA 3RSBA 2V0HA 2QH5A 5CMFX 2DPWA 1FO9A 1H5RA 4Y7TA 1FR8A 5EJ1A 1TZFA 4HO4A 1LL0A 4AAWA 3POLA 2JCJA 1HJLA 2O1GA 3O3PA 4ZDQA 4KRVA 2XWLA 1R7UA 3ST8A 3FOQA 3SXCA 1HM9A 3I0GA 3E25A 4EE5A 1TW5A 1ZJPA 2D7RA 5C1LA 1YP4A 2Y4KA 2ICXA 1EZIA 2MZBA 2BO4A 3OKRA 4EEMA 1FGXA 2AESA 1ON6A 1H4CA 3CKQA 4IRQA 3DJ4A 4KQLA 1GQ9A 5IDTA 3SX8A 4P02A 5J49A 4M2AA 2D0JA 4KT7A 3Q80A 3U2UA 5AJPA 4Y7FA 5FTVA 3V0QA 2J0AA 4FRAA 4K6RA 1VZTA 2WVKA 5CMIA 1V83A 4E1KA 3D98A 1MP3A 3CKVA 5IFYA 5FUHA 4EEAA 4CJBA 3JUJA 4HO2A 4ASYA 2VS5A 1JVGA 1ON8A 2VSIA 1ZJ0A 2AM4A 5CMGX 2YQJA 2Y6PA 1G8OA 4FRDA 3JUKA 3LW6A 1ZJOA 3OH2A 4FRPA 1G23A 1QGQA 1FO8A 2RJ0A 1H7LA 1NWGB 1VGWA 1OMXA 5CQMX 4B4BA 1MP5A 2YQSA 1H7GA 1JV1A 1R7YA 2RJ4A 4UEGA 5C3AA 3V8ZA 5BXCA 1QGSA 5IDSA 2Z86A 1XHBA 1GA8A 3U2VA 4IRPA 4Y7UA 4EE4A 4B2XA 1IIMA 1LZ0A 3Q7UA 1ZCVA 1FG5N 2WGZA 3I0HA 4CVHA 2OI5A 2PGVA 4G3PA 5C3DA 2FYBA 1HJJA 1YP3A 2V0IA 3ZLKA 1FOAA 4O6NA 3D5NA 3SX5A 3I0DA 4EVWA 4C2SA 3JTJA 1ZI1A 5I1FA 4M2BA 1GX0A 2Z87A 1MP4A 2P73A 3SXGA 2PX7A 2ZU9A 2QGIA 1S4PA 3SPTA 4B4GA 2VD4A 1H5SB 5C36A 4L41C 1FXJA 3I0IX 4G87A 1WT2A 4ASJA 3R2WA 1R82A 1WT0A 1R80A 2X5ZA 1VGTA 4B42A 3CU0A 1QG8A 4AC3A 1FXOA 1WT3A 1ZJ3A 1ZIZA 2BO6A 4D11C 4B3UA 1EYRA 4HCQA 3PKQA 5EIYA 1GX4A 1TVYA 2RJ9A 2AM5A 3SX3A 2RJ6A 3V8YA 1VGUA 2YCMA 1E5KA 1INJA 1JV3A 1VPAA 1FRWA 1NMMB 3ZLLA 2AGDA 4KC2A 4KXOA 2ZU8A 4G3QA 2Y4JA 2W0VA 4FCUA 5CMHA 1NF5B 3U0XA 2GGQA 1H7QA 3TQDA 4D11A 1LZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMZ A;  2VS4 A;  3OH1 A;  1G3L A;  4NAN A;  2W0W A;  2AH9 A;  3OC9 A;  2AE7 A;  1ZCY A;  4XWI A;  1S4N A;  2BO8 A;  4Y64 A;  5FU8 A;  3CGX A;  5C38 A;  3V0N A;  1H7F A;  2X60 A;  4HG6 A;  2CU2 A;  3V0L A;  4AYL A;  4HOC A;  3BRK X;  1O7O A;  2P6W A;  2RIY A;  1H5T B;  1QWJ A;  1ZI5 A;  5JQQ A;  4FRB A;  4Y6U A;  3BCV A;  5C48 A;  2D7I A;  1H3M A;  5C47 A;  3T7N A;  5C4D A;  1WT1 A;  4EE3 A;  4ARW A;  2FY7 A;  1WSZ A;  3V0M A;  5HS2 A;  2OI7 A;  3K8E A;  3F1Y A;  4HO0 A;  4EEO A;  5FU0 A;  2A8U A;  5L6S A;  1LZ7 A;  1HM8 A;  1R7T A;  1O7Q A;  2YQC A;  3SXB A;  4KNX A;  2RIT A;  2WVM A;  4MND A;  1W57 A;  1ZCT A;  1HM0 A;  2I5K A;  4Y7V A;  2OEG A;  5CQP A;  2RIZ A;  3DK5 A;  4Y62 A;  3USR A;  1IIN A;  5CMJ A;  4Y9X A;  1H5R B;  2V0K A;  3SXA A;  4HO5 A;  2A8W A;  4FRE A;  1H7E A;  1VH1 A;  1GQC A;  2V0L A;  5C8R A;  4HO8 A;  3K8D A;  4BQH A;  1ZHJ A;  1H7T A;  1JVD A;  5DDV A;  1KWS A;  4R7P A;  4Y63 A;  3D8V A;  5AJO A;  2XME A;  2YC3 A;  4FRH A;  4Y6N A;  5EJZ A;  2APC A;  3CKO A;  2NXV A;  1O23 B;  2FYA A;  2PGY A;  4NAL A;  3IOI A;  4BMA A;  3V0O A;  4KPX A;  3SXE A;  1R7X A;  2OI6 A;  3I0L A;  1W77 A;  1LVW A;  1K4V A;  3QVB A;  5L6V A;  1JYK A;  1ZJ1 A;  1PZY B;  2P72 A;  2O1H A;  3U0Y A;  3DUV A;  3I0K A;  1INI A;  1FWY A;  1O0R A;  3RMV A;  3CKJ A;  2WE9 A;  1G95 A;  2FYC B;  1H5S C;  2WAW A;  4CJ8 A;  3OH4 A;  2RJ8 A;  2JCK A;  2VSH A;  1W55 A;  2YES A;  2XWM A;  2ICY A;  2PA4 A;  5C1G A;  1TW1 A;  3PKP A;  4EEG A;  1ZDG A;  4HO3 A;  1G93 A;  4KNR A;  3U2T A;  1H4E A;  2WEE A;  3CKN A;  3F1C A;  4MYB A;  2UX8 A;  2Y4L A;  2VFZ A;  3SXD A;  1XZ6 A;  4KC4 A;  3I0J A;  1GWW A;  3I0F A;  1ZI4 A;  4CJC A;  1VGZ A;  1S4O A;  1LL3 A;  2JCO A;  3IOH A;  1FZW A;  1H5S A;  3ZGF A;  4KC1 A;  3U2X A;  1FR9 A;  4DDZ A;  2Y7A A;  3R3I A;  2ZU7 A;  5CQL X;  3I0C A;  1Z90 A;  2YQH A;  2AM3 A;  1MC3 A;  4NAI A;  2RJ5 A;  1NQI B;  4GBP A;  4NAK A;  5C4E A;  1VZU A;  5DDT A;  3PNN A;  4B2W A;  3IOJ A;  1G9R A;  1ZCU A;  5CQO A;  4FRL A;  2FFV A;  4M28 A;  5FYE A;  2V0J A;  4J18 A;  3OGZ A;  1VIC A;  3Q4S A;  1V84 A;  1R7V A;  1NHE B;  4ECM A;  5C4B A;  1R81 A;  2VXL A;  3TZT A;  2FFU A;  3NGW A;  5C4C A;  2OEF A;  5AJN A;  3N9W A;  2X5S A;  3GUE A;  4FQW A;  1NKH B;  2RJ7 A;  2QKX A;  4HO6 A;  3USQ A;  2X65 A;  4DEC A;  2YC5 A;  3OAM A;  1H7H A;  4HO9 A;  1WVC A;  3ZF8 A;  4D0Z A;  4Y7G A;  3FWW A;  4JIS A;  4KPZ A;  2BO7 A;  1I52 A;  1JYL A;  1YP2 A;  5C4F A;  2E3D A;  1G1L A;  4B4M A;  4D0T A;  4DE7 A;  4FRQ A;  2JCL A;  3V0P A;  2WVL A;  3SX7 A;  3ZGG A;  2RIX A;  2XWN A;  1ZJ2 A;  5CQN X;  3U2W A;  4B5B A;  1G0R A;  5FV9 A;  2O1F A;  5C49 A;  3V90 A;  3E26 A;  1G2V A;  3EE5 A;  3OH3 A;  1H5T A;  1ZDF A;  5C1H A;  1ZI3 A;  2I7B A;  3HL3 A;  2Y4M A;  1HV9 A;  1YRO B;  2FYD B;  1VZX A;  4M4K A;  3I0E A;  3V91 A;  1H5S D;  1V82 A;  1VH3 A;  1LL2 A;  1FGG A;  2VXM A;  5C3B A;  4FRM A;  3T7M A;  5FTS A;  1LZJ A;  1GWV A;  2RJ1 A;  4LW6 A;  4G3S A;  4FCE A;  3KIA A;  1PZT A;  4YS8 A;  3OH0 A;  1SS9 A;  4JD0 A;  4FRO A;  2Q4J A;  2AEC A;  1H4D A;  4AYJ A;  1G97 A;  1VM8 A;  2E8B A;  2I5E A;  2XMH A;  3RMW A;  2GGO A;  4P00 A;  1OQM B;  4LW3 A;  4D48 A;  2VS3 A;  3T7O A;  3RSB A;  2V0H A;  2QH5 A;  5CMF X;  2DPW A;  1FO9 A;  1H5R A;  4Y7T A;  1FR8 A;  5EJ1 A;  1TZF A;  4HO4 A;  1LL0 A;  4AAW A;  3POL A;  2JCJ A;  1HJL A;  2O1G A;  3O3P A;  4ZDQ A;  4KRV A;  2XWL A;  1R7U A;  3ST8 A;  3FOQ A;  3SXC A;  1HM9 A;  3I0G A;  3E25 A;  4EE5 A;  1TW5 A;  1ZJP A;  2D7R A;  5C1L A;  1YP4 A;  2Y4K A;  2ICX A;  1EZI A;  2MZB A;  2BO4 A;  3OKR A;  4EEM A;  1FGX A;  2AES A;  1ON6 A;  1H4C A;  3CKQ A;  4IRQ A;  3DJ4 A;  4KQL A;  1GQ9 A;  5IDT A;  3SX8 A;  4P02 A;  5J49 A;  4M2A A;  2D0J A;  4KT7 A;  3Q80 A;  3U2U A;  5AJP A;  4Y7F A;  5FTV A;  3V0Q A;  4K6R A;  4FRA A;  1VZT A;  2WVK A;  5CMI A;  1V83 A;  4E1K A;  3D98 A;  1MP3 A;  3CKV A;  5IFY A;  5FUH A;  4EEA A;  4CJB A;  3JUJ A;  4HO2 A;  4ASY A;  2VS5 A;  1JVG A;  1ON8 A;  2VSI A;  1ZJ0 A;  2AM4 A;  5CMG X;  2YQJ A;  2Y6P A;  1G8O A;  4FRD A;  3JUK A;  3LW6 A;  1ZJO A;  3OH2 A;  4FRP A;  1G23 A;  1QGQ A;  1FO8 A;  2RJ0 A;  1H7L A;  1NWG B;  1VGW A;  1OMX A;  5CQM X;  4B4B A;  1MP5 A;  2YQS A;  1H7G A;  1JV1 A;  1R7Y A;  2RJ4 A;  4UEG A;  5C3A A;  3V8Z A;  5BXC A;  1QGS A;  5IDS A;  2Z86 A;  1XHB A;  1GA8 A;  3U2V A;  4IRP A;  4Y7U A;  4EE4 A;  4B2X A;  1IIM A;  1LZ0 A;  3Q7U A;  1ZCV A;  1FG5 N;  2WGZ A;  3I0H A;  4CVH A;  2OI5 A;  2PGV A;  4G3P A;  5C3D A;  2FYB A;  1HJJ A;  1YP3 A;  2V0I A;  3ZLK A;  1FOA A;  3D5N A;  3SX5 A;  3I0D A;  4EVW A;  4C2S A;  3JTJ A;  1ZI1 A;  5I1F A;  4M2B A;  1GX0 A;  2Z87 A;  1MP4 A;  2P73 A;  3SXG A;  2PX7 A;  2ZU9 A;  2QGI A;  1S4P A;  3SPT A;  4B4G A;  2VD4 A;  1H5S B;  5C36 A;  4L41 C;  1FXJ A;  3I0I X;  4G87 A;  1WT2 A;  4ASJ A;  3R2W A;  1R82 A;  1WT0 A;  1R80 A;  2X5Z A;  1VGT A;  4B42 A;  3CU0 A;  1QG8 A;  4AC3 A;  1FXO A;  1WT3 A;  1ZJ3 A;  1ZIZ A;  2BO6 A;  4D11 C;  4B3U A;  1EYR A;  4HCQ A;  3PKQ A;  5EIY A;  1GX4 A;  1TVY A;  2RJ9 A;  2AM5 A;  3SX3 A;  2RJ6 A;  3V8Y A;  1VGU A;  2YCM A;  1E5K A;  1INJ A;  1JV3 A;  1VPA A;  1FRW A;  1NMM B;  3ZLL A;  2AGD A;  4KC2 A;  4KXO A;  2ZU8 A;  4G3Q A;  2Y4J A;  2W0V A;  4FCU A;  5CMH A;  1NF5 B;  3U0X A;  2GGQ A;  1H7Q A;  3TQD A;  4D11 A;  1LZI A; 
#chains in the Genus database with same CATH topology
 1OMZ A;  2VS4 A;  3OH1 A;  1G3L A;  4NAN A;  2W0W A;  2AH9 A;  3OC9 A;  2AE7 A;  1ZCY A;  4XWI A;  1S4N A;  2BO8 A;  4Y64 A;  5FU8 A;  3CGX A;  5C38 A;  3V0N A;  1H7F A;  2X60 A;  4HG6 A;  2CU2 A;  3V0L A;  4AYL A;  4HOC A;  3BRK X;  1O7O A;  2P6W A;  2RIY A;  1H5T B;  1QWJ A;  1ZI5 A;  4FIY A;  5JQQ A;  4FRB A;  4Y6U A;  3BCV A;  5C48 A;  2D7I A;  1H3M A;  5C47 A;  3T7N A;  5C4D A;  1WT1 A;  4EE3 A;  4ARW A;  2FY7 A;  1WSZ A;  3V0M A;  5HS2 A;  2OI7 A;  3K8E A;  3F1Y A;  4HO0 A;  4EEO A;  5FU0 A;  2A8U A;  5L6S A;  1LZ7 A;  1HM8 A;  1R7T A;  1O7Q A;  2YQC A;  3SXB A;  4KNX A;  2RIT A;  2VK9 A;  2WVM A;  4MND A;  1W57 A;  1ZCT A;  1HM0 A;  2I5K A;  4Y7V A;  2OEG A;  5CQP A;  2RIZ A;  3DK5 A;  4Y62 A;  3USR A;  1IIN A;  5CMJ A;  2J0B A;  4Y9X A;  1H5R B;  2V0K A;  3SXA A;  4HO5 A;  2A8W A;  4FRE A;  1H7E A;  1VH1 A;  1GQC A;  2V0L A;  5C8R A;  4HO8 A;  3K8D A;  4BQH A;  1ZHJ A;  1H7T A;  1JVD A;  5DDV A;  1KWS A;  4R7P A;  4Y63 A;  3D8V A;  5AJO A;  2XME A;  2YC3 A;  4FRH A;  4Y6N A;  5EJZ A;  2APC A;  3CKO A;  2NXV A;  1O23 B;  2FYA A;  2PGY A;  4NAL A;  3IOI A;  4BMA A;  3V0O A;  4KPX A;  3SXE A;  1R7X A;  2OI6 A;  3I0L A;  1W77 A;  1LVW A;  1K4V A;  3QVB A;  5L6V A;  1JYK A;  1ZJ1 A;  1PZY B;  2P72 A;  2O1H A;  3U0Y A;  3DUV A;  3I0K A;  1INI A;  1FWY A;  1O0R A;  3RMV A;  3CKJ A;  2WE9 A;  1G95 A;  2FYC B;  1H5S C;  2WAW A;  4CJ8 A;  3OH4 A;  2RJ8 A;  2JCK A;  2VSH A;  1W55 A;  2YES A;  2XWM A;  2ICY A;  2PA4 A;  5C1G A;  1TW1 A;  3PKP A;  4EEG A;  1ZDG A;  4HO3 A;  1G93 A;  4KNR A;  3U2T A;  1H4E A;  2WEE A;  3CKN A;  3F1C A;  4MYB A;  2UX8 A;  2Y4L A;  2VFZ A;  3SXD A;  1XZ6 A;  4KC4 A;  3I0J A;  1GWW A;  3I0F A;  1ZI4 A;  4CJC A;  1VGZ A;  1S4O A;  1LL3 A;  2JCO A;  3IOH A;  1FZW A;  1H5S A;  3ZGF A;  4KC1 A;  3U2X A;  1FR9 A;  4DDZ A;  2Y7A A;  3R3I A;  2ZU7 A;  5CQL X;  3I0C A;  1Z90 A;  2YQH A;  2AM3 A;  1MC3 A;  4MIX A;  4NAI A;  2RJ5 A;  1NQI B;  4GBP A;  4NAK A;  5C4E A;  1VZU A;  5DDT A;  3PNN A;  4B2W A;  3IOJ A;  1G9R A;  1ZCU A;  5CQO A;  4FRL A;  2FFV A;  4M28 A;  5FYE A;  2V0J A;  4J18 A;  3OGZ A;  1VIC A;  3Q4S A;  1V84 A;  1R7V A;  1NHE B;  4ECM A;  5C4B A;  1R81 A;  2VXL A;  3TZT A;  2FFU A;  3NGW A;  5C4C A;  2OEF A;  5AJN A;  3N9W A;  2X5S A;  3GUE A;  4FQW A;  4O6M A;  4Q7C A;  1NKH B;  2RJ7 A;  2QKX A;  4HO6 A;  3USQ A;  2X65 A;  4DEC A;  2YC5 A;  3OAM A;  1H7H A;  4HO9 A;  1WVC A;  3ZF8 A;  4D0Z A;  4Y7G A;  3FWW A;  4JIS A;  4KPZ A;  2BO7 A;  1I52 A;  1JYL A;  1YP2 A;  5C4F A;  2E3D A;  1G1L A;  4B4M A;  4D0T A;  4DE7 A;  4FRQ A;  2JCL A;  3V0P A;  2C0N A;  2WVL A;  3SX7 A;  3ZGG A;  2RIX A;  2XWN A;  1ZJ2 A;  4FIX A;  5CQN X;  3U2W A;  4B5B A;  1G0R A;  5FV9 A;  2O1F A;  5C49 A;  3V90 A;  3E26 A;  1G2V A;  3EE5 A;  3OH3 A;  1H5T A;  1ZDF A;  5C1H A;  1ZI3 A;  2I7B A;  3HL3 A;  2Y4M A;  1HV9 A;  1YRO B;  2FYD B;  1VZX A;  4M4K A;  3I0E A;  5D92 A;  3V91 A;  1H5S D;  1V82 A;  1VH3 A;  1LL2 A;  1FGG A;  2VXM A;  5C3B A;  4FRM A;  3T7M A;  5FTS A;  1LZJ A;  1GWV A;  2RJ1 A;  4LW6 A;  4G3S A;  4FCE A;  3KIA A;  1PZT A;  4YS8 A;  3OH0 A;  1SS9 A;  4JD0 A;  4FRO A;  2Q4J A;  2AEC A;  1H4D A;  4AYJ A;  1G97 A;  1VM8 A;  5D91 A;  2E8B A;  2I5E A;  2XMH A;  3RMW A;  2GGO A;  4P00 A;  1OQM B;  4LW3 A;  4D48 A;  2VS3 A;  3T7O A;  3RSB A;  2V0H A;  2QH5 A;  5CMF X;  2DPW A;  1FO9 A;  1H5R A;  4Y7T A;  1FR8 A;  5EJ1 A;  1TZF A;  4HO4 A;  1LL0 A;  4AAW A;  3POL A;  2JCJ A;  1HJL A;  2O1G A;  3O3P A;  4ZDQ A;  4KRV A;  2XWL A;  1R7U A;  3ST8 A;  3FOQ A;  3SXC A;  1HM9 A;  3I0G A;  3E25 A;  4EE5 A;  1TW5 A;  1ZJP A;  2D7R A;  5C1L A;  1YP4 A;  2Y4K A;  2ICX A;  1EZI A;  2MZB A;  2BO4 A;  3OKR A;  4EEM A;  1FGX A;  2AES A;  1ON6 A;  1H4C A;  3CKQ A;  4IRQ A;  3DJ4 A;  4KQL A;  1GQ9 A;  5IDT A;  3SX8 A;  4P02 A;  5J49 A;  4M2A A;  2D0J A;  4KT7 A;  3Q80 A;  3U2U A;  5AJP A;  4Y7F A;  5FTV A;  3V0Q A;  2J0A A;  4FRA A;  4K6R A;  1VZT A;  2WVK A;  5CMI A;  1V83 A;  4E1K A;  3D98 A;  1MP3 A;  3CKV A;  5IFY A;  5FUH A;  4EEA A;  4CJB A;  3JUJ A;  4HO2 A;  4ASY A;  2VS5 A;  1JVG A;  1ON8 A;  2VSI A;  1ZJ0 A;  2AM4 A;  5CMG X;  2YQJ A;  2Y6P A;  1G8O A;  4FRD A;  3JUK A;  3LW6 A;  1ZJO A;  3OH2 A;  4FRP A;  1G23 A;  1QGQ A;  1FO8 A;  2RJ0 A;  1H7L A;  1NWG B;  1VGW A;  1OMX A;  5CQM X;  4B4B A;  1MP5 A;  2YQS A;  1H7G A;  1JV1 A;  1R7Y A;  2RJ4 A;  4UEG A;  5C3A A;  3V8Z A;  5BXC A;  1QGS A;  5IDS A;  2Z86 A;  1XHB A;  1GA8 A;  3U2V A;  4IRP A;  4Y7U A;  4EE4 A;  4B2X A;  1IIM A;  1LZ0 A;  3Q7U A;  1ZCV A;  1FG5 N;  2WGZ A;  3I0H A;  4CVH A;  2OI5 A;  2PGV A;  4G3P A;  5C3D A;  2FYB A;  1HJJ A;  1YP3 A;  2V0I A;  3ZLK A;  1FOA A;  4O6N A;  3D5N A;  3SX5 A;  3I0D A;  4EVW A;  4C2S A;  3JTJ A;  1ZI1 A;  5I1F A;  4M2B A;  1GX0 A;  2Z87 A;  1MP4 A;  2P73 A;  3SXG A;  2PX7 A;  2ZU9 A;  2QGI A;  1S4P A;  3SPT A;  4B4G A;  2VD4 A;  1H5S B;  5C36 A;  4L41 C;  1FXJ A;  3I0I X;  4G87 A;  1WT2 A;  4ASJ A;  3R2W A;  1R82 A;  1WT0 A;  1R80 A;  2X5Z A;  1VGT A;  4B42 A;  3CU0 A;  1QG8 A;  4AC3 A;  1FXO A;  1WT3 A;  1ZJ3 A;  1ZIZ A;  2BO6 A;  4D11 C;  4B3U A;  1EYR A;  4HCQ A;  3PKQ A;  5EIY A;  1GX4 A;  1TVY A;  2RJ9 A;  2AM5 A;  3SX3 A;  2RJ6 A;  3V8Y A;  1VGU A;  2YCM A;  1E5K A;  1INJ A;  1JV3 A;  1VPA A;  1FRW A;  1NMM B;  3ZLL A;  2AGD A;  4KC2 A;  4KXO A;  2ZU8 A;  4G3Q A;  2Y4J A;  2W0V A;  4FCU A;  5CMH A;  1NF5 B;  3U0X A;  2GGQ A;  1H7Q A;  3TQD A;  4D11 A;  1LZI A; 
#chains in the Genus database with same CATH homology
 1OMZ A;  2VS4 A;  3OH1 A;  1G3L A;  4NAN A;  2W0W A;  2AH9 A;  3OC9 A;  2AE7 A;  1ZCY A;  4XWI A;  1S4N A;  2BO8 A;  4Y64 A;  5FU8 A;  3CGX A;  5C38 A;  3V0N A;  1H7F A;  2X60 A;  4HG6 A;  2CU2 A;  3V0L A;  4AYL A;  4HOC A;  3BRK X;  1O7O A;  2P6W A;  2RIY A;  1H5T B;  1QWJ A;  1ZI5 A;  4FIY A;  5JQQ A;  4FRB A;  4Y6U A;  3BCV A;  5C48 A;  2D7I A;  1H3M A;  5C47 A;  3T7N A;  5C4D A;  1WT1 A;  4EE3 A;  4ARW A;  2FY7 A;  1WSZ A;  3V0M A;  5HS2 A;  2OI7 A;  3K8E A;  3F1Y A;  4HO0 A;  4EEO A;  5FU0 A;  2A8U A;  5L6S A;  1LZ7 A;  1HM8 A;  1R7T A;  1O7Q A;  2YQC A;  3SXB A;  4KNX A;  2RIT A;  2VK9 A;  2WVM A;  4MND A;  1W57 A;  1ZCT A;  1HM0 A;  2I5K A;  4Y7V A;  2OEG A;  5CQP A;  2RIZ A;  3DK5 A;  4Y62 A;  3USR A;  1IIN A;  5CMJ A;  2J0B A;  4Y9X A;  1H5R B;  2V0K A;  3SXA A;  4HO5 A;  2A8W A;  4FRE A;  1H7E A;  1VH1 A;  1GQC A;  2V0L A;  5C8R A;  4HO8 A;  3K8D A;  4BQH A;  1ZHJ A;  1H7T A;  1JVD A;  5DDV A;  1KWS A;  4R7P A;  4Y63 A;  3D8V A;  5AJO A;  2XME A;  2YC3 A;  4FRH A;  4Y6N A;  5EJZ A;  2APC A;  3CKO A;  2NXV A;  1O23 B;  2FYA A;  2PGY A;  4NAL A;  3IOI A;  4BMA A;  3V0O A;  4KPX A;  3SXE A;  1R7X A;  2OI6 A;  3I0L A;  1W77 A;  1LVW A;  1K4V A;  3QVB A;  5L6V A;  1JYK A;  1ZJ1 A;  1PZY B;  2P72 A;  2O1H A;  3U0Y A;  3DUV A;  3I0K A;  1INI A;  1FWY A;  1O0R A;  3RMV A;  3CKJ A;  2WE9 A;  1G95 A;  2FYC B;  1H5S C;  2WAW A;  4CJ8 A;  3OH4 A;  2RJ8 A;  2JCK A;  2VSH A;  1W55 A;  2YES A;  2XWM A;  2ICY A;  2PA4 A;  5C1G A;  1TW1 A;  3PKP A;  4EEG A;  1ZDG A;  4HO3 A;  1G93 A;  4KNR A;  3U2T A;  1H4E A;  2WEE A;  3CKN A;  3F1C A;  4MYB A;  2UX8 A;  2Y4L A;  2VFZ A;  3SXD A;  1XZ6 A;  4KC4 A;  3I0J A;  1GWW A;  3I0F A;  1ZI4 A;  4CJC A;  1VGZ A;  1S4O A;  1LL3 A;  2JCO A;  3IOH A;  1FZW A;  1H5S A;  3ZGF A;  4KC1 A;  3U2X A;  1FR9 A;  4DDZ A;  2Y7A A;  3R3I A;  2ZU7 A;  5CQL X;  3I0C A;  1Z90 A;  2YQH A;  2AM3 A;  1MC3 A;  4MIX A;  4NAI A;  2RJ5 A;  1NQI B;  4GBP A;  4NAK A;  5C4E A;  1VZU A;  5DDT A;  3PNN A;  4B2W A;  3IOJ A;  1G9R A;  1ZCU A;  5CQO A;  4FRL A;  2FFV A;  4M28 A;  5FYE A;  2V0J A;  4J18 A;  3OGZ A;  1VIC A;  3Q4S A;  1V84 A;  1R7V A;  1NHE B;  4ECM A;  5C4B A;  1R81 A;  2VXL A;  3TZT A;  2FFU A;  3NGW A;  5C4C A;  2OEF A;  5AJN A;  3N9W A;  2X5S A;  3GUE A;  4FQW A;  4O6M A;  4Q7C A;  1NKH B;  2RJ7 A;  2QKX A;  4HO6 A;  3USQ A;  2X65 A;  4DEC A;  2YC5 A;  3OAM A;  1H7H A;  4HO9 A;  1WVC A;  3ZF8 A;  4D0Z A;  4Y7G A;  3FWW A;  4JIS A;  4KPZ A;  2BO7 A;  1I52 A;  1JYL A;  1YP2 A;  5C4F A;  2E3D A;  1G1L A;  4B4M A;  4D0T A;  4DE7 A;  4FRQ A;  2JCL A;  3V0P A;  2C0N A;  2WVL A;  3SX7 A;  3ZGG A;  2RIX A;  2XWN A;  1ZJ2 A;  4FIX A;  5CQN X;  3U2W A;  4B5B A;  1G0R A;  5FV9 A;  2O1F A;  5C49 A;  3V90 A;  3E26 A;  1G2V A;  3EE5 A;  3OH3 A;  1H5T A;  1ZDF A;  5C1H A;  1ZI3 A;  2I7B A;  3HL3 A;  2Y4M A;  1HV9 A;  1YRO B;  2FYD B;  1VZX A;  4M4K A;  3I0E A;  5D92 A;  3V91 A;  1H5S D;  1V82 A;  1VH3 A;  1LL2 A;  1FGG A;  2VXM A;  5C3B A;  4FRM A;  3T7M A;  5FTS A;  1LZJ A;  1GWV A;  2RJ1 A;  4LW6 A;  4G3S A;  4FCE A;  3KIA A;  1PZT A;  4YS8 A;  3OH0 A;  1SS9 A;  4JD0 A;  4FRO A;  2Q4J A;  2AEC A;  1H4D A;  4AYJ A;  1G97 A;  1VM8 A;  5D91 A;  2E8B A;  2I5E A;  2XMH A;  3RMW A;  2GGO A;  4P00 A;  1OQM B;  4LW3 A;  4D48 A;  2VS3 A;  3T7O A;  3RSB A;  2V0H A;  2QH5 A;  5CMF X;  2DPW A;  1FO9 A;  1H5R A;  4Y7T A;  1FR8 A;  5EJ1 A;  1TZF A;  4HO4 A;  1LL0 A;  4AAW A;  3POL A;  2JCJ A;  1HJL A;  2O1G A;  3O3P A;  4ZDQ A;  4KRV A;  2XWL A;  1R7U A;  3ST8 A;  3FOQ A;  3SXC A;  1HM9 A;  3I0G A;  3E25 A;  4EE5 A;  1TW5 A;  1ZJP A;  2D7R A;  5C1L A;  1YP4 A;  2Y4K A;  2ICX A;  1EZI A;  2MZB A;  2BO4 A;  3OKR A;  4EEM A;  1FGX A;  2AES A;  1ON6 A;  1H4C A;  3CKQ A;  4IRQ A;  3DJ4 A;  4KQL A;  1GQ9 A;  5IDT A;  3SX8 A;  4P02 A;  5J49 A;  4M2A A;  2D0J A;  4KT7 A;  3Q80 A;  3U2U A;  5AJP A;  4Y7F A;  5FTV A;  3V0Q A;  2J0A A;  4FRA A;  4K6R A;  1VZT A;  2WVK A;  5CMI A;  1V83 A;  4E1K A;  3D98 A;  1MP3 A;  3CKV A;  5IFY A;  5FUH A;  4EEA A;  4CJB A;  3JUJ A;  4HO2 A;  4ASY A;  2VS5 A;  1JVG A;  1ON8 A;  2VSI A;  1ZJ0 A;  2AM4 A;  5CMG X;  2YQJ A;  2Y6P A;  1G8O A;  4FRD A;  3JUK A;  3LW6 A;  1ZJO A;  3OH2 A;  4FRP A;  1G23 A;  1QGQ A;  1FO8 A;  2RJ0 A;  1H7L A;  1NWG B;  1VGW A;  1OMX A;  5CQM X;  4B4B A;  1MP5 A;  2YQS A;  1H7G A;  1JV1 A;  1R7Y A;  2RJ4 A;  4UEG A;  5C3A A;  3V8Z A;  5BXC A;  1QGS A;  5IDS A;  2Z86 A;  1XHB A;  1GA8 A;  3U2V A;  4IRP A;  4Y7U A;  4EE4 A;  4B2X A;  1IIM A;  1LZ0 A;  3Q7U A;  1ZCV A;  1FG5 N;  2WGZ A;  3I0H A;  4CVH A;  2OI5 A;  2PGV A;  4G3P A;  5C3D A;  2FYB A;  1HJJ A;  1YP3 A;  2V0I A;  3ZLK A;  1FOA A;  4O6N A;  3D5N A;  3SX5 A;  3I0D A;  4EVW A;  4C2S A;  3JTJ A;  1ZI1 A;  5I1F A;  4M2B A;  1GX0 A;  2Z87 A;  1MP4 A;  2P73 A;  3SXG A;  2PX7 A;  2ZU9 A;  2QGI A;  1S4P A;  3SPT A;  4B4G A;  2VD4 A;  1H5S B;  5C36 A;  4L41 C;  1FXJ A;  3I0I X;  4G87 A;  1WT2 A;  4ASJ A;  3R2W A;  1R82 A;  1WT0 A;  1R80 A;  2X5Z A;  1VGT A;  4B42 A;  3CU0 A;  1QG8 A;  4AC3 A;  1FXO A;  1WT3 A;  1ZJ3 A;  1ZIZ A;  2BO6 A;  4D11 C;  4B3U A;  1EYR A;  4HCQ A;  3PKQ A;  5EIY A;  1GX4 A;  1TVY A;  2RJ9 A;  2AM5 A;  3SX3 A;  2RJ6 A;  3V8Y A;  1VGU A;  2YCM A;  1E5K A;  1INJ A;  1JV3 A;  1VPA A;  1FRW A;  1NMM B;  3ZLL A;  2AGD A;  4KC2 A;  4KXO A;  2ZU8 A;  4G3Q A;  2Y4J A;  2W0V A;  4FCU A;  5CMH A;  1NF5 B;  3U0X A;  2GGQ A;  1H7Q A;  3TQD A;  4D11 A;  1LZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...