2AM4A

Crystal structure of n-acetylglucosaminyltransferase i in complex with udp-2-deoxy-2-fluoro-glucose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminylt
publication title X-ray Crystal Structures of Rabbit N-acetylglucosaminyltransferase I (GnT I) in Complex with Donor Substrate Analogues.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 112
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2005-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 2am4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2am4A01
1MP4A 3N9WA 1FRWA 1W55A 2ZU9A 1O7OA 1WT3A 4NAKA 3V90A 5AJPA 1H4EA 2WE9A 3U0XA 1H5SB 3I0HA 2BO4A 2AH9A 3IOJA 2D7RA 3T7OA 2WGZA 4NAIA 4HCQA 3V0MA 1VH3A 2P73A 2X65A 2P6WA 1VGUA 1GQ9A 2WEEA 1PZTA 5BXCA 3USQA 1GX4A 1VZXA 2OI7A 2RJ6A 5JQQA 1G8OA 4KXOA 1H5TB 3I0EA 5C8RA 3I0KA 2D7IA 2I5KA 4FROA 4J18A 3IOIA 1H5SD 1WT0A 2O1GA 2FYAA 4EEGA 2VXMA 5EJ1A 2OI6A 1ZIZA 3ZF8A 4C2SA 1TZFA 5IFYA 4BQHA 3CKVA 4DDZA 4FCEA 5I1FA 1HJLA 3OC9A 2UX8A 5L6VA 2GGOA 3TZTA 2APCA 4FRQA 4M2AA 1GX0A 2RJ1A 1OQMB 1H5RB 1V83A 5CQOA 3OH1A 1FXJA 1JVDA 1NKHB 1VZUA 3U2UA 2RJ5A 1MP5A 5C4FA 2RIXA 1JYLA 1Z90A 1R82A 1FO8A 1G9RA 3E25A 2XMHA 3FWWA 3ZLKA 5FYEA 2YQHA 3I0LA 2QH5A 4DE7A 1LL0A 1G23A 3V0OA 3NGWA 3ZLLA 1HM8A 4M4KA 5C48A 4LW6A 4HG6A 1H5SA 1O23B 1NWGB 4R7PA 2RIYA 3DUVA 2RJ8A 4AAWA 1R7TA 5C47A 1INIA 5L6SA 1QGSA 1HV9A 2XWNA 2Z87A 1YP2A 5C4EA 4ARWA 3U2TA 4HO5A 3SXAA 1ZHJA 4CVHA 1R7VA 2PA4A 1LZ7A 1V82A 3CKNA 1HM0A 2JCKA 1ZCYA 1NF5B 1H5TA 1ZCVA 3O3PA 3SX3A 3V0QA 2VFZA 4D48A 1VICA 2ICXA 1ZJPA 3V0NA 2V0KA 2YQCA 3JUKA 5CMFX 4Y9XA 2WVLA 5CQLX 4EEOA 1H7LA 2FYCB 4K6RA 1ZI4A 1FWYA 2A8UA 4Y7GA 4B3UA 3OH2A 2AM4A 4G3QA 3USRA 1TVYA 3CU0A 5C36A 1VGTA 3V8YA 1WSZA 1JVGA 2WVMA 4L41C 4G3PA 4E1KA 3V0PA 4LW3A 1H7QA 2Y6PA 1PZYB 3BRKX 2YESA 4HOCA 1R7YA 2X60A 1ON8A 4EE3A 2DPWA 4HO2A 4CJBA 2O1FA 1EZIA 2XMEA 4YS8A 4IRQA 2FY7A 2XWLA 5C4DA 2W0WA 3T7MA 4IRPA 1S4NA 5FTSA 1OMXA 1R80A 5C38A 4MYBA 1LL3A 4KRVA 1WT2A 1ZCUA 1GQCA 1FG5N 1FR8A 3KIAA 2ZU8A 1YP4A 2RIZA 4D11C 4NANA 1ZI3A 4FRHA 5CMGX 1W77A 2QKXA 2VSHA 1ZDGA 1I52A 3OGZA 3Q80A 2I7BA 4Y7UA 2E8BA 3K8DA 3ZGFA 3I0FA 2OI5A 2Y4LA 4FRPA 4HO6A 3LW6A 1LVWA 3OKRA 1ZJ2A 4EVWA 5J49A 2AECA 4FCUA 2VD4A 2GGQA 2Z86A 1GWWA 1H7GA 5FV9A 3R3IA 1S4PA 4B2XA 1H7EA 1H7TA 1VH1A 1IINA 1G93A 4GBPA 1NHEB 2A8WA 2QGIA 2Y4MA 1H3MA 4EE4A 3PNNA 4KPZA 3EE5A 4KC2A 3CKJA 4ECMA 4P02A 2X5ZA 1YROB 4M28A 4KNRA 4EEAA 4Y7TA 2V0HA 5CMJA 1H4CA 2RJ0A 2VXLA 4Y7VA 4NALA 1SS9A 3U2VA 1G1LA 4HO3A 3CGXA 1ZCTA 5FTVA 4KNXA 1KWSA 4XWIA 1WT1A 1VM8A 1FOAA 4EEMA 1ZJ3A 1TW5A 4G87A 3SXGA 2JCLA 1O0RA 5HS2A 2RJ9A 4D0ZA 3I0IX 3U2XA 5C1HA 1ZI5A 2FYBA 5CMHA 3OAMA 2XWMA 3V0LA 1HM9A 1ZDFA 2P72A 4P00A 2PGYA 4B5BA 2V0JA 5C1GA 4ASYA 4FRBA 3Q4SA 5CQMX 1LZJA 1LZIA 4ZDQA 3OH4A 1R7UA 3I0GA 1NMMB 2YQJA 5CMIA 3CKOA 1INJA 2I5EA 1G97A 4HO0A 3JTJA 2YQSA 3SXBA 2VS5A 1H5RA 1W57A 1IIMA 4HO8A 4AYJA 4FRAA 1H4DA 2RJ7A 4B2WA 1NQIB 4B42A 1G0RA 4HO4A 2FYDB 1GWVA 1VPAA 2JCJA 1GA8A 3F1CA 3BCVA 5CQPA 2AESA 2RITA 3V8ZA 3DJ4A 3OH0A 1H7FA 2E3DA 3RMWA 4Y63A 3IOHA 4Y6NA 2AM3A 5DDVA 1S4OA 5C3BA 2VS4A 3HL3A 3U2WA 3SPTA 2Y4JA 5C4CA 5FUHA 1OMZA 1JV1A 4KC1A 4BMAA 5C4BA 3Q7UA 1MP3A 1QWJA 4FRLA 1VGWA 2O1HA 3I0DA 2BO6A 4D0TA 2Y7AA 4Y6UA 1R81A 1EYRA 3K8EA 4M2BA 3SXEA 2FFUA 3V91A 1FZWA 1FXOA 4HO9A 5C3DA 1ZJ0A 1JYKA 3GUEA 4JD0A 1LL2A 3QVBA 3PKQA 3DK5A 1G3LA 1WVCA 3I0CA 5FU8A 4D11A 2BO7A 4DECA 3SX8A 2YC5A 3SXCA 2PGVA 1G95A 1ON6A 5AJNA 4CJCA 3F1YA 2WAWA 1ZI1A 4KQLA 4FQWA 1R7XA 3E26A 1E5KA 3R2WA 5C1LA 3RSBA 1H5SC 2V0LA 4KPXA 4KT7A 5C49A 4AYLA 3I0JA 2YC3A 3RMVA 1LZ0A 4B4MA 5IDTA 1ZJ1A 2CU2A 1JV3A 5EIYA 2PX7A 2VSIA 4AC3A 1FGXA 4FREA 3D8VA 1XZ6A 2D0JA 1QG8A 2WVKA 3CKQA 1G2VA 1O7QA 3U0YA 4Y62A 2NXVA 1MC3A 4CJ8A 1FGGA 2OEFA 1ZJOA 2ZU7A 5FU0A 5IDSA 2AGDA 3SX7A 3T7NA 1H7HA 3SXDA 4KC4A 2Q4JA 2FFVA 5DDTA 5C3AA 2BO8A 1QGQA 4G3SA 3PKPA 3D98A 5EJZA 4B4BA 1TW1A 2V0IA 3ZGGA 3FOQA 2ICYA 2AM5A 4ASJA 1HJJA 4Y7FA 3ST8A 1YP3A 3JUJA 2Y4KA 1FR9A 2RJ4A 4MNDA 3POLA 3SX5A 1V84A 4JISA 2AE7A 2X5SA 1VGZA 3D5NA 3TQDA 4FRMA 2VS3A 4Y64A 1VZTA 1FO9A 4FRDA 5AJOA 4UEGA 1XHBA 4B4GA 1K4VA 2YCMA 2MZBA 2JCOA 2W0VA 5CQNX 3OH3A 2OEGA 4EE5A
chains in the Genus database with same CATH superfamily
1KW3B 1MP4A 3N9WA 1FRWA 1W55A 2ZU9A 1O7OA 1SP9A 1WT3A 4NAKA 3V90A 5AJPA 1H4EA 1JIEA 2WE9A 3LHOA 1H5SB 3I0HA 3U0XA 2BO4A 1SQIA 2AH9A 3IOJA 3ZW5A 2QH0A 2R5VA 2D7RA 3T7OA 5CB9A 2WGZA 2ZI8A 4HCQA 4NAIA 3V0MA 1VH3A 4Z6TA 2P73A 3EY8A 2X65A 3GM5A 2P6WA 1VGUA 3L20A 1GQ9A 2WEEA 1PZTA 4O6NA 4FIXA 5BXCA 3OPYB 4Z6OA 3USQA 1KLLA 4MTSA 1GX4A 1VZXA 2OI7A 2RJ6A 4PV5A 1F1XA 5JQQA 1G8OA 1SQDA 4GHCA 4KXOA 1H5TB 1F1VA 3I0EA 5C8RA 1XQAA 1FA6A 3I0KA 2D7IA 1BH5A 2I5KA 5BWGA 4JH9A 4N04A 3RMUA 4FROA 3IOIA 4J18A 3OJJA 1FA8A 1H5SD 1WT0A 2P7OA 2VK9A 2O1GA 3E5DA 2FYAA 4EEGA 4MTRA 4NB0A 1EWJA 2VXMA 5EJ1A 2OI6A 1ZIZA 1Q0OA 3ZF8A 4C2SA 1TZFA 5IFYA 2ZYQA 4BQHA 1NPBA 3CKVA 4DDZA 4FCEA 5I1FA 1HJLA 3OC9A 2UX8A 5L6VA 2GGOA 3TZTA 3IUZA 3B59A 4HUZA 2APCA 1KW6B 4FRQA 4M2AA 4PAVA 1GX0A 2RJ1A 1OQMB 1H5RB 1V83A 5CQOA 4GHFA 3OH1A 1FXJA 1JVDA 1NKHB 1VZUA 3PKWA 3U2UA 2RJ5A 1DHYA 4Z6SA 1MP5A 1ECSA 5C4FA 2RIXA 1JYLA 1Z90A 1R82A 1FO8A 1G9RA 3E25A 2XMHA 3FWWA 3ZLKA 5FYEA 2YQHA 3I0LA 2QH5A 4DE7A 1G23A 1LL0A 3V0OA 3NGWA 3ZLLA 1HM8A 1KMZA 4M4KA 5C48A 4LW6A 4HG6A 1R9CA 1H5SA 1O23B 1NWGB 4R7PA 2RIYA 3DUVA 2RJ8A 4NB2A 5C68A 4AAWA 1R7TA 5C47A 1INIA 5L6SA 5D91A 3W0UA 1QGSA 2P7QA 1HV9A 2XWNA 2Z87A 1YP2A 5C4EA 4ARWA 3U2TA 2P7MA 4HO5A 3SXAA 1ZHJA 3OPYA 4CVHA 1R7VA 2PA4A 1LZ7A 1HM0A 1LQKA 1V82A 4JH5A 3CKNA 2JCKA 3W0TA 1ZCYA 1NF5B 1ZSWA 1H5TA 1ZCVA 3O3PA 3SX3A 3V0QA 3E0RA 4QB5A 4GYMA 4Z6UA 2VFZA 4D48A 1VICA 2ICXA 1ZJPA 3V0NA 2V0KA 2YQCA 3JUKA 5CMFX 4Y9XA 2WVLA 5CQLX 3P8AA 5D92A 4EEOA 1H7LA 1TFZA 4MIXA 2C21A 2FYCB 4K6RA 1ZI4A 1FWYA 4IAGA 2A8UA 4Y7GA 4B3UA 3OH2A 2AM4A 4G3QA 3USRA 1TVYA 3CU0A 5C36A 1VGTA 4JH2A 1QINA 3V8YA 1WSZA 2IG9A 1NKIA 3SK2A 1JVGA 2ZHPA 2WVMA 2QNTA 2R6UA 4L41C 4G3PA 4E1KA 2QQZA 3V0PA 4JH8A 3BQXA 4LW3A 1K4NA 1H7QA 1JC4A 1PZYB 2Y6PA 3BRKX 2YESA 4HOCA 1R7YA 2X60A 1ON8A 4EE3A 2DPWA 4HO2A 4CJBA 2ZW4A 2O1FA 1EZIA 3OJTA 2XMEA 4YS8A 4IRQA 5D4FA 1TG5A 1JIFA 2FY7A 1CJXA 2XWLA 5C4DA 2W0WA 4Z6WA 3T7MA 2RJBA 4IRPA 1S4NA 5FTSA 1OMXA 1U6LA 2RK9A 1R80A 5C38A 4MYBA 1LL3A 1NIQB 3OJKA 4KRVA 1WT2A 1ZCUA 1GQCA 4LQBA 1FG5N 1FR8A 3KIAA 2ZU8A 1YP4A 2RIZA 4D11C 2ZW5A 3PKXA 1ZI3A 4MTTA 1FA7A 4FRHA 4NANA 5CMGX 1W77A 2QKXA 2VSHA 1ZDGA 1I52A 3OGZA 3Q80A 1TWUA 2I7BA 4Y7UA 4JH7A 2E8BA 3K8DA 2I7RA 3ZGFA 3GHJA 2OI5A 2Y4LA 4G6XA 3I0FA 4FRPA 1NNRA 3KOLA 4HO6A 3LW6A 3HPYA 1LVWA 4RT5A 2IGAA 5DRHA 3OKRA 4MYMA 1ZJ2A 4EVWA 3ECKA 5J49A 2AECA 4FCUA 2VD4A 3HDPA 2GGQA 2WL9A 1LKDA 2Z86A 4JH6A 1GWWA 1H7GA 5FV9A 4OPNA 1S4PA 3R3IA 4B2XA 1SS4A 4X2AA 2J0AA 1XRKA 1H7EA 1H7TA 1VH1A 1IINA 1G93A 4GBPA 1QTOA 1NHEB 2A8WA 2QGIA 2Y4MA 1H3MA 3OUMA 4EE4A 3PNNA 1MH6A 4KPZA 3EY7A 4JH3A 3EE5A 4Z04A 4KC2A 3CKJA 4ECMA 4P02A 2X5ZA 1TSJA 1YROB 4M28A 2EI2A 2RBBA 4KNRA 2V0HA 4Y7TA 4EEAA 1H4CA 5CMJA 2RJ0A 2VXLA 3ZI1A 2P7PA 4Y7VA 4GHHA 4NALA 1SS9A 3U2VA 1G1LA 4HO3A 3CGXA 1ZCTA 5FTVA 4KNXA 4MTQA 1SP8A 1KWSA 4XWIA 2EHZA 1WT1A 1EIRA 1VM8A 1FOAA 1EIQA 3ISQA 4EEMA 1ZJ3A 1TW5A 4G87A 3SXGA 2JCLA 3BZAA 1O0RA 1KWCB 3R4QA 3RRIA 5HS2A 2P7LA 2RJ9A 4D0ZA 1LQOA 3I0IX 2PJSA 3CT8A 3HPVA 3U2XA 5C1HA 1ZI5A 2FYBA 5CMHA 3OAMA 2XWMA 3V0LA 1XY7A 1HM9A 1ZDFA 2P72A 4P00A 2PGYA 4B5BA 2V0JA 5C1GA 1HANA 4ASYA 2A4XA 2P7KA 4IR0A 4FRBA 4Z6VA 3Q4SA 5CQMX 1LZJA 1LZIA 4ZDQA 3OH4A 1FROA 5C4PA 1R7UA 3I0GA 1NMMB 2YQJA 4Z6MA 5CMIA 3CKOA 1INJA 5KEFA 2I5EA 1LGTA 3OJNA 1FA5A 1G97A 3R6AA 1EILA 4KYKA 2YQSA 3JTJA 4HO0A 3SXBA 2VS5A 4KYHA 1H5RA 1W57A 1IIMA 4HO8A 4AYJA 4FRAA 1BYLA 1F9ZA 1H4DA 2EI1A 2RJ7A 4B2WA 1NQIB 4B42A 1G0RA 3HUHA 2FYDB 4HO4A 1GWVA 4NAYA 1VPAA 2JCJA 1GA8A 3F1CA 3BCVA 5CQPA 2AESA 2RITA 3V8ZA 3DJ4A 3OH0A 1H7FA 2E3DA 3RMWA 4NAZA 4Y63A 3IOHA 3HQ0A 4Y6NA 2A4WA 2AM3A 2P25A 1T47A 5DDVA 1S4OA 4JD1A 5C6XA 5C3BA 2VS4A 3HL3A 3U2WA 3SPTA 2Y4JA 5C4CA 5FUHA 4Z6NA 1OMZA 1JV1A 3OAJA 2EI3A 4KC1A 4BMAA 5C4BA 4Z6QA 3Q7UA 1MP3A 1QWJA 4FRLA 1KNFA 1VGWA 2O1HA 3I0DA 4NVSA 2RK0A 2BO6A 5DFGA 4D0TA 2Y7AA 4Y6UA 1R81A 1EYRA 3K8EA 1F1UA 4M2BA 3SXEA 5D7ZA 4GHEA 2FFUA 3V91A 2ZA0A 1FZWA 1FXOA 4HO9A 5C3DA 1ZJ0A 1JYKA 3GUEA 4JD0A 1LL2A 5HCWA 3PKQA 3DK5A 1G3LA 1WVCA 3I0CA 3QVBA 5FU8A 2BO7A 4D11A 1KWBB 2YC5A 3SX8A 3SXCA 4DECA 2PGVA 5BWHA 4Q7CA 1G95A 1ON6A 5AJNA 4CJCA 3F1YA 2Q48A 2WAWA 1ZI1A 4KQLA 4FQWA 1R7XA 3L7TA 3E26A 1E5KA 3R2WA 5C1LA 3RSBA 1H5SC 2V0LA 4KPXA 5EC3A 1KW8B 4KT7A 5C49A 4AYLA 3I0JA 2YC3A 3RMVA 1LZ0A 4B4MA 5IDTA 1ZJ1A 2CU2A 1JV3A 1F1RA 1KMYA 5EIYA 2PX7A 2VSIA 4AC3A 1JC5A 3PKVA 1FGXA 4FIYA 4FREA 3D8VA 1XZ6A 2J0BA 1U69A 2ZW6A 1QG8A 2D0JA 2WVKA 1Q0CA 2EI0A 3CKQA 1G2VA 4O6MA 1O7QA 3U0YA 4Y62A 2NXVA 1MC3A 4CJ8A 1FGGA 2OEFA 1ZJOA 2ZU7A 2ZW7A 5FU0A 5IDSA 4JH4A 1KNDA 2AGDA 3SX7A 5F6QA 3T7NA 1H7HA 3SXDA 2C0NA 4KC4A 2Q4JA 2FFVA 5DDTA 5C3AA 4GHGA 2BO8A 5CTOA 1QGQA 4HC5A 4G3SA 3PKPA 3D98A 5EJZA 4B4BA 1TW1A 4Z6ZA 2V0IA 3VB0A 3FOQA 2ICYA 3ZGGA 2AM5A 1MPYA 4ASJA 4JH1A 1HJJA 4Y7FA 3ST8A 1YP3A 3JUJA 1LQPA 3RHEA 4GHDA 2Y4KA 1FR9A 2RJ4A 4MNDA 3POLA 3SX5A 1QIPA 2WL3A 3ECJA 5DHWA 1V84A 3ZGJA 4JISA 3OA4A 1KW9B 2AE7A 2X5SA 3LM4A 1VGZA 3D5NA 4NB1A 3G12A 3TQDA 3OULA 4FRMA 4Z6RA 2VS3A 4Y64A 1VZTA 1FO9A 4FRDA 5AJOA 3FCDA 4Z6LA 1XHBA 4UEGA 4B4GA 1K4VA 3OXHA 2YCMA 3VW9A 2MZBA 5CJ3A 2JCOA 2W0VA 5CQNX 3OH3A 2OEGA 4Z6PA 3HNQA 4EE5A
chains in the Genus database with same CATH topology
1MP4A 3N9WA 1FRWA 1W55A 2ZU9A 1O7OA 1WT3A 4NAKA 3V90A 5AJPA 1H4EA 2WE9A 3U0XA 1H5SB 3I0HA 2BO4A 2AH9A 3IOJA 2D7RA 3T7OA 2WGZA 4NAIA 4HCQA 3V0MA 1VH3A 2P73A 2X65A 2P6WA 1VGUA 1GQ9A 2WEEA 1PZTA 4O6NA 4FIXA 5BXCA 3USQA 1GX4A 1VZXA 2OI7A 2RJ6A 5JQQA 1G8OA 4KXOA 1H5TB 3I0EA 5C8RA 3I0KA 2D7IA 2I5KA 4FROA 4J18A 3IOIA 1H5SD 1WT0A 2VK9A 2O1GA 2FYAA 4EEGA 2VXMA 5EJ1A 2OI6A 1ZIZA 3ZF8A 4C2SA 1TZFA 5IFYA 4BQHA 3CKVA 4DDZA 4FCEA 5I1FA 1HJLA 3OC9A 2UX8A 5L6VA 2GGOA 3TZTA 2APCA 4FRQA 4M2AA 1GX0A 2RJ1A 1OQMB 1H5RB 1V83A 5CQOA 3OH1A 1FXJA 1JVDA 1NKHB 1VZUA 3U2UA 2RJ5A 1MP5A 5C4FA 2RIXA 1JYLA 1Z90A 1R82A 1FO8A 1G9RA 3E25A 2XMHA 3FWWA 3ZLKA 5FYEA 2YQHA 3I0LA 2QH5A 4DE7A 1LL0A 1G23A 3V0OA 3NGWA 3ZLLA 1HM8A 4M4KA 5C48A 4LW6A 4HG6A 1H5SA 1O23B 1NWGB 4R7PA 2RIYA 3DUVA 2RJ8A 4AAWA 1R7TA 5C47A 1INIA 5L6SA 5D91A 1QGSA 1HV9A 2XWNA 2Z87A 1YP2A 5C4EA 4ARWA 3U2TA 4HO5A 3SXAA 1ZHJA 4CVHA 1R7VA 2PA4A 1LZ7A 1V82A 3CKNA 1HM0A 2JCKA 1ZCYA 1NF5B 1H5TA 1ZCVA 3O3PA 3SX3A 3V0QA 2VFZA 4D48A 1VICA 2ICXA 1ZJPA 3V0NA 2V0KA 2YQCA 3JUKA 5CMFX 4Y9XA 2WVLA 5CQLX 5D92A 4EEOA 1H7LA 4MIXA 2FYCB 4K6RA 1ZI4A 1FWYA 2A8UA 4Y7GA 4B3UA 3OH2A 2AM4A 4G3QA 3USRA 1TVYA 3CU0A 5C36A 1VGTA 3V8YA 1WSZA 1JVGA 2WVMA 4L41C 4G3PA 4E1KA 3V0PA 4LW3A 1H7QA 2Y6PA 1PZYB 3BRKX 2YESA 4HOCA 1R7YA 2X60A 1ON8A 4EE3A 2DPWA 4HO2A 4CJBA 2O1FA 1EZIA 2XMEA 4YS8A 4IRQA 2FY7A 2XWLA 5C4DA 2W0WA 3T7MA 4IRPA 1S4NA 5FTSA 1OMXA 1R80A 5C38A 4MYBA 1LL3A 4KRVA 1WT2A 1ZCUA 1GQCA 1FG5N 1FR8A 3KIAA 2ZU8A 1YP4A 2RIZA 4D11C 4NANA 1ZI3A 4FRHA 5CMGX 1W77A 2QKXA 2VSHA 1ZDGA 1I52A 3OGZA 3Q80A 2I7BA 4Y7UA 2E8BA 3K8DA 3ZGFA 3I0FA 2OI5A 2Y4LA 4FRPA 4HO6A 3LW6A 1LVWA 3OKRA 1ZJ2A 4EVWA 5J49A 2AECA 4FCUA 2VD4A 2GGQA 2Z86A 1GWWA 1H7GA 5FV9A 3R3IA 1S4PA 4B2XA 2J0AA 1H7EA 1H7TA 1VH1A 1IINA 1G93A 4GBPA 1NHEB 2A8WA 2QGIA 2Y4MA 1H3MA 4EE4A 3PNNA 4KPZA 3EE5A 4KC2A 3CKJA 4ECMA 4P02A 2X5ZA 1YROB 4M28A 4KNRA 4EEAA 4Y7TA 2V0HA 5CMJA 1H4CA 2RJ0A 2VXLA 4Y7VA 4NALA 1SS9A 3U2VA 1G1LA 4HO3A 3CGXA 1ZCTA 5FTVA 4KNXA 1KWSA 4XWIA 1WT1A 1VM8A 1FOAA 4EEMA 1ZJ3A 1TW5A 4G87A 3SXGA 2JCLA 1O0RA 5HS2A 2RJ9A 4D0ZA 3I0IX 3U2XA 5C1HA 1ZI5A 2FYBA 5CMHA 3OAMA 2XWMA 3V0LA 1HM9A 1ZDFA 2P72A 4P00A 2PGYA 4B5BA 2V0JA 5C1GA 4ASYA 4FRBA 3Q4SA 5CQMX 1LZJA 1LZIA 4ZDQA 3OH4A 1R7UA 3I0GA 1NMMB 2YQJA 5CMIA 3CKOA 1INJA 2I5EA 1G97A 4HO0A 3JTJA 2YQSA 3SXBA 2VS5A 1H5RA 1W57A 1IIMA 4HO8A 4AYJA 4FRAA 1H4DA 2RJ7A 4B2WA 1NQIB 4B42A 1G0RA 4HO4A 2FYDB 1GWVA 1VPAA 2JCJA 1GA8A 3F1CA 3BCVA 5CQPA 2AESA 2RITA 3V8ZA 3DJ4A 3OH0A 1H7FA 2E3DA 3RMWA 4Y63A 3IOHA 4Y6NA 2AM3A 5DDVA 1S4OA 5C3BA 2VS4A 3HL3A 3U2WA 3SPTA 2Y4JA 5C4CA 5FUHA 1OMZA 1JV1A 4KC1A 4BMAA 5C4BA 3Q7UA 1MP3A 1QWJA 4FRLA 1VGWA 2O1HA 3I0DA 2BO6A 4D0TA 2Y7AA 4Y6UA 1R81A 1EYRA 3K8EA 4M2BA 3SXEA 2FFUA 3V91A 1FZWA 1FXOA 4HO9A 5C3DA 1ZJ0A 1JYKA 3GUEA 4JD0A 1LL2A 3QVBA 3PKQA 3DK5A 1G3LA 1WVCA 3I0CA 5FU8A 4D11A 2BO7A 4DECA 3SX8A 2YC5A 3SXCA 2PGVA 4Q7CA 1G95A 1ON6A 5AJNA 4CJCA 3F1YA 2WAWA 1ZI1A 4KQLA 4FQWA 1R7XA 3E26A 1E5KA 3R2WA 5C1LA 3RSBA 1H5SC 2V0LA 4KPXA 4KT7A 5C49A 4AYLA 3I0JA 2YC3A 3RMVA 1LZ0A 4B4MA 5IDTA 1ZJ1A 2CU2A 1JV3A 5EIYA 2PX7A 2VSIA 4AC3A 1FGXA 4FIYA 4FREA 3D8VA 1XZ6A 2J0BA 2D0JA 1QG8A 2WVKA 3CKQA 1G2VA 4O6MA 1O7QA 3U0YA 4Y62A 2NXVA 1MC3A 4CJ8A 1FGGA 2OEFA 1ZJOA 2ZU7A 5FU0A 5IDSA 2AGDA 3SX7A 3T7NA 1H7HA 3SXDA 2C0NA 4KC4A 2Q4JA 2FFVA 5DDTA 5C3AA 2BO8A 1QGQA 4G3SA 3PKPA 3D98A 5EJZA 4B4BA 1TW1A 2V0IA 3ZGGA 3FOQA 2ICYA 2AM5A 4ASJA 1HJJA 4Y7FA 3ST8A 1YP3A 3JUJA 2Y4KA 1FR9A 2RJ4A 4MNDA 3POLA 3SX5A 1V84A 4JISA 2AE7A 2X5SA 1VGZA 3D5NA 3TQDA 4FRMA 2VS3A 4Y64A 1VZTA 1FO9A 4FRDA 5AJOA 4UEGA 1XHBA 4B4GA 1K4VA 2YCMA 2MZBA 2JCOA 2W0VA 5CQNX 3OH3A 2OEGA 4EE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MP4 A;  3N9W A;  1FRW A;  1W55 A;  2ZU9 A;  1O7O A;  1WT3 A;  4NAK A;  3V90 A;  5AJP A;  1H4E A;  2WE9 A;  3U0X A;  1H5S B;  3I0H A;  2BO4 A;  2AH9 A;  3IOJ A;  2D7R A;  3T7O A;  2WGZ A;  4NAI A;  4HCQ A;  3V0M A;  1VH3 A;  2P73 A;  2X65 A;  2P6W A;  1VGU A;  1GQ9 A;  2WEE A;  1PZT A;  5BXC A;  3USQ A;  1GX4 A;  1VZX A;  2OI7 A;  2RJ6 A;  5JQQ A;  1G8O A;  4KXO A;  1H5T B;  3I0E A;  5C8R A;  3I0K A;  2D7I A;  2I5K A;  4FRO A;  4J18 A;  3IOI A;  1H5S D;  1WT0 A;  2O1G A;  2FYA A;  4EEG A;  2VXM A;  5EJ1 A;  2OI6 A;  1ZIZ A;  3ZF8 A;  4C2S A;  1TZF A;  5IFY A;  4BQH A;  3CKV A;  4DDZ A;  4FCE A;  5I1F A;  1HJL A;  3OC9 A;  2UX8 A;  5L6V A;  2GGO A;  3TZT A;  2APC A;  4FRQ A;  4M2A A;  1GX0 A;  2RJ1 A;  1OQM B;  1H5R B;  1V83 A;  5CQO A;  3OH1 A;  1FXJ A;  1JVD A;  1NKH B;  1VZU A;  3U2U A;  2RJ5 A;  1MP5 A;  5C4F A;  2RIX A;  1JYL A;  1Z90 A;  1R82 A;  1FO8 A;  1G9R A;  3E25 A;  2XMH A;  3FWW A;  3ZLK A;  5FYE A;  2YQH A;  3I0L A;  2QH5 A;  4DE7 A;  1LL0 A;  1G23 A;  3V0O A;  3NGW A;  3ZLL A;  1HM8 A;  4M4K A;  5C48 A;  4LW6 A;  4HG6 A;  1H5S A;  1O23 B;  1NWG B;  4R7P A;  2RIY A;  3DUV A;  2RJ8 A;  4AAW A;  1R7T A;  5C47 A;  1INI A;  5L6S A;  1QGS A;  1HV9 A;  2XWN A;  2Z87 A;  1YP2 A;  5C4E A;  4ARW A;  3U2T A;  4HO5 A;  3SXA A;  1ZHJ A;  4CVH A;  1R7V A;  2PA4 A;  1LZ7 A;  1V82 A;  3CKN A;  1HM0 A;  2JCK A;  1ZCY A;  1NF5 B;  1H5T A;  1ZCV A;  3O3P A;  3SX3 A;  3V0Q A;  2VFZ A;  4D48 A;  1VIC A;  2ICX A;  1ZJP A;  3V0N A;  2V0K A;  2YQC A;  3JUK A;  5CMF X;  4Y9X A;  2WVL A;  5CQL X;  4EEO A;  1H7L A;  2FYC B;  4K6R A;  1ZI4 A;  1FWY A;  2A8U A;  4Y7G A;  4B3U A;  3OH2 A;  2AM4 A;  4G3Q A;  3USR A;  1TVY A;  3CU0 A;  5C36 A;  1VGT A;  3V8Y A;  1WSZ A;  1JVG A;  2WVM A;  4L41 C;  4G3P A;  4E1K A;  3V0P A;  4LW3 A;  1H7Q A;  2Y6P A;  1PZY B;  3BRK X;  2YES A;  4HOC A;  1R7Y A;  2X60 A;  1ON8 A;  4EE3 A;  2DPW A;  4HO2 A;  4CJB A;  2O1F A;  1EZI A;  2XME A;  4YS8 A;  4IRQ A;  2FY7 A;  2XWL A;  5C4D A;  2W0W A;  3T7M A;  4IRP A;  1S4N A;  5FTS A;  1OMX A;  1R80 A;  5C38 A;  4MYB A;  1LL3 A;  4KRV A;  1WT2 A;  1ZCU A;  1GQC A;  1FG5 N;  1FR8 A;  3KIA A;  2ZU8 A;  1YP4 A;  2RIZ A;  4D11 C;  4NAN A;  1ZI3 A;  4FRH A;  5CMG X;  1W77 A;  2QKX A;  2VSH A;  1ZDG A;  1I52 A;  3OGZ A;  3Q80 A;  2I7B A;  4Y7U A;  2E8B A;  3K8D A;  3ZGF A;  3I0F A;  2OI5 A;  2Y4L A;  4FRP A;  4HO6 A;  3LW6 A;  1LVW A;  3OKR A;  1ZJ2 A;  4EVW A;  5J49 A;  2AEC A;  4FCU A;  2VD4 A;  2GGQ A;  2Z86 A;  1GWW A;  1H7G A;  5FV9 A;  3R3I A;  1S4P A;  4B2X A;  1H7E A;  1H7T A;  1VH1 A;  1IIN A;  1G93 A;  4GBP A;  1NHE B;  2A8W A;  2QGI A;  2Y4M A;  1H3M A;  4EE4 A;  3PNN A;  4KPZ A;  3EE5 A;  4KC2 A;  3CKJ A;  4ECM A;  4P02 A;  2X5Z A;  1YRO B;  4M28 A;  4KNR A;  4EEA A;  4Y7T A;  2V0H A;  5CMJ A;  1H4C A;  2RJ0 A;  2VXL A;  4Y7V A;  4NAL A;  1SS9 A;  3U2V A;  1G1L A;  4HO3 A;  3CGX A;  1ZCT A;  5FTV A;  4KNX A;  1KWS A;  4XWI A;  1WT1 A;  1VM8 A;  1FOA A;  4EEM A;  1ZJ3 A;  1TW5 A;  4G87 A;  3SXG A;  2JCL A;  1O0R A;  5HS2 A;  2RJ9 A;  4D0Z A;  3I0I X;  3U2X A;  5C1H A;  1ZI5 A;  2FYB A;  5CMH A;  3OAM A;  2XWM A;  3V0L A;  1HM9 A;  1ZDF A;  2P72 A;  4P00 A;  2PGY A;  4B5B A;  2V0J A;  5C1G A;  4ASY A;  4FRB A;  3Q4S A;  5CQM X;  1LZJ A;  1LZI A;  4ZDQ A;  3OH4 A;  1R7U A;  3I0G A;  1NMM B;  2YQJ A;  5CMI A;  3CKO A;  1INJ A;  2I5E A;  1G97 A;  4HO0 A;  3JTJ A;  2YQS A;  3SXB A;  2VS5 A;  1H5R A;  1W57 A;  1IIM A;  4HO8 A;  4AYJ A;  4FRA A;  1H4D A;  2RJ7 A;  4B2W A;  1NQI B;  4B42 A;  1G0R A;  4HO4 A;  2FYD B;  1GWV A;  1VPA A;  2JCJ A;  1GA8 A;  3F1C A;  3BCV A;  5CQP A;  2AES A;  2RIT A;  3V8Z A;  3DJ4 A;  3OH0 A;  1H7F A;  2E3D A;  3RMW A;  4Y63 A;  3IOH A;  4Y6N A;  2AM3 A;  5DDV A;  1S4O A;  5C3B A;  2VS4 A;  3HL3 A;  3U2W A;  3SPT A;  2Y4J A;  5C4C A;  5FUH A;  1OMZ A;  1JV1 A;  4KC1 A;  4BMA A;  5C4B A;  3Q7U A;  1MP3 A;  1QWJ A;  4FRL A;  1VGW A;  2O1H A;  3I0D A;  2BO6 A;  4D0T A;  2Y7A A;  4Y6U A;  1R81 A;  1EYR A;  3K8E A;  4M2B A;  3SXE A;  2FFU A;  3V91 A;  1FZW A;  1FXO A;  4HO9 A;  5C3D A;  1ZJ0 A;  1JYK A;  3GUE A;  4JD0 A;  1LL2 A;  3QVB A;  3PKQ A;  3DK5 A;  1G3L A;  1WVC A;  3I0C A;  5FU8 A;  4D11 A;  2BO7 A;  4DEC A;  3SX8 A;  2YC5 A;  3SXC A;  2PGV A;  1G95 A;  1ON6 A;  5AJN A;  4CJC A;  3F1Y A;  2WAW A;  1ZI1 A;  4KQL A;  4FQW A;  1R7X A;  3E26 A;  1E5K A;  3R2W A;  5C1L A;  3RSB A;  1H5S C;  2V0L A;  4KPX A;  4KT7 A;  5C49 A;  4AYL A;  3I0J A;  2YC3 A;  3RMV A;  1LZ0 A;  4B4M A;  5IDT A;  1ZJ1 A;  2CU2 A;  1JV3 A;  5EIY A;  2PX7 A;  2VSI A;  4AC3 A;  1FGX A;  4FRE A;  3D8V A;  1XZ6 A;  2D0J A;  1QG8 A;  2WVK A;  3CKQ A;  1G2V A;  1O7Q A;  3U0Y A;  4Y62 A;  2NXV A;  1MC3 A;  4CJ8 A;  1FGG A;  2OEF A;  1ZJO A;  2ZU7 A;  5FU0 A;  5IDS A;  2AGD A;  3SX7 A;  3T7N A;  1H7H A;  3SXD A;  4KC4 A;  2Q4J A;  2FFV A;  5DDT A;  5C3A A;  2BO8 A;  1QGQ A;  4G3S A;  3PKP A;  3D98 A;  5EJZ A;  4B4B A;  1TW1 A;  2V0I A;  3ZGG A;  3FOQ A;  2ICY A;  2AM5 A;  4ASJ A;  1HJJ A;  4Y7F A;  3ST8 A;  1YP3 A;  3JUJ A;  2Y4K A;  1FR9 A;  2RJ4 A;  4MND A;  3POL A;  3SX5 A;  1V84 A;  4JIS A;  2AE7 A;  2X5S A;  1VGZ A;  3D5N A;  3TQD A;  4FRM A;  2VS3 A;  4Y64 A;  1VZT A;  1FO9 A;  4FRD A;  5AJO A;  4UEG A;  1XHB A;  4B4G A;  1K4V A;  2YCM A;  2MZB A;  2JCO A;  2W0V A;  5CQN X;  3OH3 A;  2OEG A;  4EE5 A; 
#chains in the Genus database with same CATH topology
 1KW3 B;  1MP4 A;  3N9W A;  1FRW A;  1W55 A;  2ZU9 A;  1O7O A;  1SP9 A;  1WT3 A;  4NAK A;  3V90 A;  5AJP A;  1H4E A;  1JIE A;  2WE9 A;  3LHO A;  1H5S B;  3I0H A;  3U0X A;  2BO4 A;  1SQI A;  2AH9 A;  3IOJ A;  3ZW5 A;  2QH0 A;  2R5V A;  2D7R A;  3T7O A;  5CB9 A;  2WGZ A;  2ZI8 A;  4HCQ A;  4NAI A;  3V0M A;  1VH3 A;  4Z6T A;  2P73 A;  3EY8 A;  2X65 A;  3GM5 A;  2P6W A;  1VGU A;  3L20 A;  1GQ9 A;  2WEE A;  1PZT A;  4O6N A;  4FIX A;  5BXC A;  3OPY B;  4Z6O A;  3USQ A;  1KLL A;  4MTS A;  1GX4 A;  1VZX A;  2OI7 A;  2RJ6 A;  4PV5 A;  1F1X A;  5JQQ A;  1G8O A;  1SQD A;  4GHC A;  4KXO A;  1H5T B;  1F1V A;  3I0E A;  5C8R A;  1XQA A;  1FA6 A;  3I0K A;  2D7I A;  1BH5 A;  2I5K A;  5BWG A;  4JH9 A;  4N04 A;  3RMU A;  4FRO A;  3IOI A;  4J18 A;  3OJJ A;  1FA8 A;  1H5S D;  1WT0 A;  2P7O A;  2VK9 A;  2O1G A;  3E5D A;  2FYA A;  4EEG A;  4MTR A;  4NB0 A;  1EWJ A;  2VXM A;  5EJ1 A;  2OI6 A;  1ZIZ A;  1Q0O A;  3ZF8 A;  4C2S A;  1TZF A;  5IFY A;  2ZYQ A;  4BQH A;  1NPB A;  3CKV A;  4DDZ A;  4FCE A;  5I1F A;  1HJL A;  3OC9 A;  2UX8 A;  5L6V A;  2GGO A;  3TZT A;  3IUZ A;  3B59 A;  4HUZ A;  2APC A;  1KW6 B;  4FRQ A;  4M2A A;  4PAV A;  1GX0 A;  2RJ1 A;  1OQM B;  1H5R B;  1V83 A;  5CQO A;  4GHF A;  3OH1 A;  1FXJ A;  1JVD A;  1NKH B;  1VZU A;  3PKW A;  3U2U A;  2RJ5 A;  1DHY A;  4Z6S A;  1MP5 A;  1ECS A;  5C4F A;  2RIX A;  1JYL A;  1Z90 A;  1R82 A;  1FO8 A;  1G9R A;  3E25 A;  2XMH A;  3FWW A;  3ZLK A;  5FYE A;  2YQH A;  3I0L A;  2QH5 A;  4DE7 A;  1G23 A;  1LL0 A;  3V0O A;  3NGW A;  3ZLL A;  1HM8 A;  1KMZ A;  4M4K A;  5C48 A;  4LW6 A;  4HG6 A;  1R9C A;  1H5S A;  1O23 B;  1NWG B;  4R7P A;  2RIY A;  3DUV A;  2RJ8 A;  4NB2 A;  5C68 A;  4AAW A;  1R7T A;  5C47 A;  1INI A;  5L6S A;  5D91 A;  3W0U A;  1QGS A;  2P7Q A;  1HV9 A;  2XWN A;  2Z87 A;  1YP2 A;  5C4E A;  4ARW A;  3U2T A;  2P7M A;  4HO5 A;  3SXA A;  1ZHJ A;  3OPY A;  4CVH A;  1R7V A;  2PA4 A;  1LZ7 A;  1HM0 A;  1LQK A;  1V82 A;  4JH5 A;  3CKN A;  2JCK A;  3W0T A;  1ZCY A;  1NF5 B;  1ZSW A;  1H5T A;  1ZCV A;  3O3P A;  3SX3 A;  3V0Q A;  3E0R A;  4QB5 A;  4GYM A;  4Z6U A;  2VFZ A;  4D48 A;  1VIC A;  2ICX A;  1ZJP A;  3V0N A;  2V0K A;  2YQC A;  3JUK A;  5CMF X;  4Y9X A;  2WVL A;  5CQL X;  3P8A A;  5D92 A;  4EEO A;  1H7L A;  1TFZ A;  4MIX A;  2C21 A;  2FYC B;  4K6R A;  1ZI4 A;  1FWY A;  4IAG A;  2A8U A;  4Y7G A;  4B3U A;  3OH2 A;  2AM4 A;  4G3Q A;  3USR A;  1TVY A;  3CU0 A;  5C36 A;  1VGT A;  4JH2 A;  1QIN A;  3V8Y A;  1WSZ A;  2IG9 A;  1NKI A;  3SK2 A;  1JVG A;  2ZHP A;  2WVM A;  2QNT A;  2R6U A;  4L41 C;  4G3P A;  4E1K A;  2QQZ A;  3V0P A;  4JH8 A;  3BQX A;  4LW3 A;  1K4N A;  1H7Q A;  1JC4 A;  1PZY B;  2Y6P A;  3BRK X;  2YES A;  4HOC A;  1R7Y A;  2X60 A;  1ON8 A;  4EE3 A;  2DPW A;  4HO2 A;  4CJB A;  2ZW4 A;  2O1F A;  1EZI A;  3OJT A;  2XME A;  4YS8 A;  4IRQ A;  5D4F A;  1TG5 A;  1JIF A;  2FY7 A;  1CJX A;  2XWL A;  5C4D A;  2W0W A;  4Z6W A;  3T7M A;  2RJB A;  4IRP A;  1S4N A;  5FTS A;  1OMX A;  1U6L A;  2RK9 A;  1R80 A;  5C38 A;  4MYB A;  1LL3 A;  1NIQ B;  3OJK A;  4KRV A;  1WT2 A;  1ZCU A;  1GQC A;  4LQB A;  1FG5 N;  1FR8 A;  3KIA A;  2ZU8 A;  1YP4 A;  2RIZ A;  4D11 C;  2ZW5 A;  3PKX A;  1ZI3 A;  4MTT A;  1FA7 A;  4FRH A;  4NAN A;  5CMG X;  1W77 A;  2QKX A;  2VSH A;  1ZDG A;  1I52 A;  3OGZ A;  3Q80 A;  1TWU A;  2I7B A;  4Y7U A;  4JH7 A;  2E8B A;  3K8D A;  2I7R A;  3ZGF A;  3GHJ A;  2OI5 A;  2Y4L A;  4G6X A;  3I0F A;  4FRP A;  1NNR A;  3KOL A;  4HO6 A;  3LW6 A;  3HPY A;  1LVW A;  4RT5 A;  2IGA A;  5DRH A;  3OKR A;  4MYM A;  1ZJ2 A;  4EVW A;  3ECK A;  5J49 A;  2AEC A;  4FCU A;  2VD4 A;  3HDP A;  2GGQ A;  2WL9 A;  1LKD A;  2Z86 A;  4JH6 A;  1GWW A;  1H7G A;  5FV9 A;  4OPN A;  1S4P A;  3R3I A;  4B2X A;  1SS4 A;  4X2A A;  2J0A A;  1XRK A;  1H7E A;  1H7T A;  1VH1 A;  1IIN A;  1G93 A;  4GBP A;  1QTO A;  1NHE B;  2A8W A;  2QGI A;  2Y4M A;  1H3M A;  3OUM A;  4EE4 A;  3PNN A;  1MH6 A;  4KPZ A;  3EY7 A;  4JH3 A;  3EE5 A;  4Z04 A;  4KC2 A;  3CKJ A;  4ECM A;  4P02 A;  2X5Z A;  1TSJ A;  1YRO B;  4M28 A;  2EI2 A;  2RBB A;  4KNR A;  2V0H A;  4Y7T A;  4EEA A;  1H4C A;  5CMJ A;  2RJ0 A;  2VXL A;  3ZI1 A;  2P7P A;  4Y7V A;  4GHH A;  4NAL A;  1SS9 A;  3U2V A;  1G1L A;  4HO3 A;  3CGX A;  1ZCT A;  5FTV A;  4KNX A;  4MTQ A;  1SP8 A;  1KWS A;  4XWI A;  2EHZ A;  1WT1 A;  1EIR A;  1VM8 A;  1FOA A;  1EIQ A;  3ISQ A;  4EEM A;  1ZJ3 A;  1TW5 A;  4G87 A;  3SXG A;  2JCL A;  3BZA A;  1O0R A;  1KWC B;  3R4Q A;  3RRI A;  5HS2 A;  2P7L A;  2RJ9 A;  4D0Z A;  1LQO A;  3I0I X;  2PJS A;  3CT8 A;  3HPV A;  3U2X A;  5C1H A;  1ZI5 A;  2FYB A;  5CMH A;  3OAM A;  2XWM A;  3V0L A;  1XY7 A;  1HM9 A;  1ZDF A;  2P72 A;  4P00 A;  2PGY A;  4B5B A;  2V0J A;  5C1G A;  1HAN A;  4ASY A;  2A4X A;  2P7K A;  4IR0 A;  4FRB A;  4Z6V A;  3Q4S A;  5CQM X;  1LZJ A;  1LZI A;  4ZDQ A;  3OH4 A;  1FRO A;  5C4P A;  1R7U A;  3I0G A;  1NMM B;  2YQJ A;  4Z6M A;  5CMI A;  3CKO A;  1INJ A;  5KEF A;  2I5E A;  1LGT A;  3OJN A;  1FA5 A;  1G97 A;  3R6A A;  1EIL A;  4KYK A;  2YQS A;  3JTJ A;  4HO0 A;  3SXB A;  2VS5 A;  4KYH A;  1H5R A;  1W57 A;  1IIM A;  4HO8 A;  4AYJ A;  4FRA A;  1BYL A;  1F9Z A;  1H4D A;  2EI1 A;  2RJ7 A;  4B2W A;  1NQI B;  4B42 A;  1G0R A;  3HUH A;  2FYD B;  4HO4 A;  1GWV A;  4NAY A;  1VPA A;  2JCJ A;  1GA8 A;  3F1C A;  3BCV A;  5CQP A;  2AES A;  2RIT A;  3V8Z A;  3DJ4 A;  3OH0 A;  1H7F A;  2E3D A;  3RMW A;  4NAZ A;  4Y63 A;  3IOH A;  3HQ0 A;  4Y6N A;  2A4W A;  2AM3 A;  2P25 A;  1T47 A;  5DDV A;  1S4O A;  4JD1 A;  5C6X A;  5C3B A;  2VS4 A;  3HL3 A;  3U2W A;  3SPT A;  2Y4J A;  5C4C A;  5FUH A;  4Z6N A;  1OMZ A;  1JV1 A;  3OAJ A;  2EI3 A;  4KC1 A;  4BMA A;  5C4B A;  4Z6Q A;  3Q7U A;  1MP3 A;  1QWJ A;  4FRL A;  1KNF A;  1VGW A;  2O1H A;  3I0D A;  4NVS A;  2RK0 A;  2BO6 A;  5DFG A;  4D0T A;  2Y7A A;  4Y6U A;  1R81 A;  1EYR A;  3K8E A;  1F1U A;  4M2B A;  3SXE A;  5D7Z A;  4GHE A;  2FFU A;  3V91 A;  2ZA0 A;  1FZW A;  1FXO A;  4HO9 A;  5C3D A;  1ZJ0 A;  1JYK A;  3GUE A;  4JD0 A;  1LL2 A;  5HCW A;  3PKQ A;  3DK5 A;  1G3L A;  1WVC A;  3I0C A;  3QVB A;  5FU8 A;  2BO7 A;  4D11 A;  1KWB B;  2YC5 A;  3SX8 A;  3SXC A;  4DEC A;  2PGV A;  5BWH A;  4Q7C A;  1G95 A;  1ON6 A;  5AJN A;  4CJC A;  3F1Y A;  2Q48 A;  2WAW A;  1ZI1 A;  4KQL A;  4FQW A;  1R7X A;  3L7T A;  3E26 A;  1E5K A;  3R2W A;  5C1L A;  3RSB A;  1H5S C;  2V0L A;  4KPX A;  5EC3 A;  1KW8 B;  4KT7 A;  5C49 A;  4AYL A;  3I0J A;  2YC3 A;  3RMV A;  1LZ0 A;  4B4M A;  5IDT A;  1ZJ1 A;  2CU2 A;  1JV3 A;  1F1R A;  1KMY A;  5EIY A;  2PX7 A;  2VSI A;  4AC3 A;  1JC5 A;  3PKV A;  1FGX A;  4FIY A;  4FRE A;  3D8V A;  1XZ6 A;  2J0B A;  1U69 A;  2ZW6 A;  1QG8 A;  2D0J A;  2WVK A;  1Q0C A;  2EI0 A;  3CKQ A;  1G2V A;  4O6M A;  1O7Q A;  3U0Y A;  4Y62 A;  2NXV A;  1MC3 A;  4CJ8 A;  1FGG A;  2OEF A;  1ZJO A;  2ZU7 A;  2ZW7 A;  5FU0 A;  5IDS A;  4JH4 A;  1KND A;  2AGD A;  3SX7 A;  5F6Q A;  3T7N A;  1H7H A;  3SXD A;  2C0N A;  4KC4 A;  2Q4J A;  2FFV A;  5DDT A;  5C3A A;  4GHG A;  2BO8 A;  5CTO A;  1QGQ A;  4HC5 A;  4G3S A;  3PKP A;  3D98 A;  5EJZ A;  4B4B A;  1TW1 A;  4Z6Z A;  2V0I A;  3VB0 A;  3FOQ A;  2ICY A;  3ZGG A;  2AM5 A;  1MPY A;  4ASJ A;  4JH1 A;  1HJJ A;  4Y7F A;  3ST8 A;  1YP3 A;  3JUJ A;  1LQP A;  3RHE A;  4GHD A;  2Y4K A;  1FR9 A;  2RJ4 A;  4MND A;  3POL A;  3SX5 A;  1QIP A;  2WL3 A;  3ECJ A;  5DHW A;  1V84 A;  3ZGJ A;  4JIS A;  3OA4 A;  1KW9 B;  2AE7 A;  2X5S A;  3LM4 A;  1VGZ A;  3D5N A;  4NB1 A;  3G12 A;  3TQD A;  3OUL A;  4FRM A;  4Z6R A;  2VS3 A;  4Y64 A;  1VZT A;  1FO9 A;  4FRD A;  5AJO A;  3FCD A;  4Z6L A;  1XHB A;  4UEG A;  4B4G A;  1K4V A;  3OXH A;  2YCM A;  3VW9 A;  2MZB A;  5CJ3 A;  2JCO A;  2W0V A;  5CQN X;  3OH3 A;  2OEG A;  4Z6P A;  3HNQ A;  4EE5 A; 
#chains in the Genus database with same CATH homology
 1MP4 A;  3N9W A;  1FRW A;  1W55 A;  2ZU9 A;  1O7O A;  1WT3 A;  4NAK A;  3V90 A;  5AJP A;  1H4E A;  2WE9 A;  3U0X A;  1H5S B;  3I0H A;  2BO4 A;  2AH9 A;  3IOJ A;  2D7R A;  3T7O A;  2WGZ A;  4NAI A;  4HCQ A;  3V0M A;  1VH3 A;  2P73 A;  2X65 A;  2P6W A;  1VGU A;  1GQ9 A;  2WEE A;  1PZT A;  4O6N A;  4FIX A;  5BXC A;  3USQ A;  1GX4 A;  1VZX A;  2OI7 A;  2RJ6 A;  5JQQ A;  1G8O A;  4KXO A;  1H5T B;  3I0E A;  5C8R A;  3I0K A;  2D7I A;  2I5K A;  4FRO A;  4J18 A;  3IOI A;  1H5S D;  1WT0 A;  2VK9 A;  2O1G A;  2FYA A;  4EEG A;  2VXM A;  5EJ1 A;  2OI6 A;  1ZIZ A;  3ZF8 A;  4C2S A;  1TZF A;  5IFY A;  4BQH A;  3CKV A;  4DDZ A;  4FCE A;  5I1F A;  1HJL A;  3OC9 A;  2UX8 A;  5L6V A;  2GGO A;  3TZT A;  2APC A;  4FRQ A;  4M2A A;  1GX0 A;  2RJ1 A;  1OQM B;  1H5R B;  1V83 A;  5CQO A;  3OH1 A;  1FXJ A;  1JVD A;  1NKH B;  1VZU A;  3U2U A;  2RJ5 A;  1MP5 A;  5C4F A;  2RIX A;  1JYL A;  1Z90 A;  1R82 A;  1FO8 A;  1G9R A;  3E25 A;  2XMH A;  3FWW A;  3ZLK A;  5FYE A;  2YQH A;  3I0L A;  2QH5 A;  4DE7 A;  1LL0 A;  1G23 A;  3V0O A;  3NGW A;  3ZLL A;  1HM8 A;  4M4K A;  5C48 A;  4LW6 A;  4HG6 A;  1H5S A;  1O23 B;  1NWG B;  4R7P A;  2RIY A;  3DUV A;  2RJ8 A;  4AAW A;  1R7T A;  5C47 A;  1INI A;  5L6S A;  5D91 A;  1QGS A;  1HV9 A;  2XWN A;  2Z87 A;  1YP2 A;  5C4E A;  4ARW A;  3U2T A;  4HO5 A;  3SXA A;  1ZHJ A;  4CVH A;  1R7V A;  2PA4 A;  1LZ7 A;  1V82 A;  3CKN A;  1HM0 A;  2JCK A;  1ZCY A;  1NF5 B;  1H5T A;  1ZCV A;  3O3P A;  3SX3 A;  3V0Q A;  2VFZ A;  4D48 A;  1VIC A;  2ICX A;  1ZJP A;  3V0N A;  2V0K A;  2YQC A;  3JUK A;  5CMF X;  4Y9X A;  2WVL A;  5CQL X;  5D92 A;  4EEO A;  1H7L A;  4MIX A;  2FYC B;  4K6R A;  1ZI4 A;  1FWY A;  2A8U A;  4Y7G A;  4B3U A;  3OH2 A;  2AM4 A;  4G3Q A;  3USR A;  1TVY A;  3CU0 A;  5C36 A;  1VGT A;  3V8Y A;  1WSZ A;  1JVG A;  2WVM A;  4L41 C;  4G3P A;  4E1K A;  3V0P A;  4LW3 A;  1H7Q A;  2Y6P A;  1PZY B;  3BRK X;  2YES A;  4HOC A;  1R7Y A;  2X60 A;  1ON8 A;  4EE3 A;  2DPW A;  4HO2 A;  4CJB A;  2O1F A;  1EZI A;  2XME A;  4YS8 A;  4IRQ A;  2FY7 A;  2XWL A;  5C4D A;  2W0W A;  3T7M A;  4IRP A;  1S4N A;  5FTS A;  1OMX A;  1R80 A;  5C38 A;  4MYB A;  1LL3 A;  4KRV A;  1WT2 A;  1ZCU A;  1GQC A;  1FG5 N;  1FR8 A;  3KIA A;  2ZU8 A;  1YP4 A;  2RIZ A;  4D11 C;  4NAN A;  1ZI3 A;  4FRH A;  5CMG X;  1W77 A;  2QKX A;  2VSH A;  1ZDG A;  1I52 A;  3OGZ A;  3Q80 A;  2I7B A;  4Y7U A;  2E8B A;  3K8D A;  3ZGF A;  3I0F A;  2OI5 A;  2Y4L A;  4FRP A;  4HO6 A;  3LW6 A;  1LVW A;  3OKR A;  1ZJ2 A;  4EVW A;  5J49 A;  2AEC A;  4FCU A;  2VD4 A;  2GGQ A;  2Z86 A;  1GWW A;  1H7G A;  5FV9 A;  3R3I A;  1S4P A;  4B2X A;  2J0A A;  1H7E A;  1H7T A;  1VH1 A;  1IIN A;  1G93 A;  4GBP A;  1NHE B;  2A8W A;  2QGI A;  2Y4M A;  1H3M A;  4EE4 A;  3PNN A;  4KPZ A;  3EE5 A;  4KC2 A;  3CKJ A;  4ECM A;  4P02 A;  2X5Z A;  1YRO B;  4M28 A;  4KNR A;  4EEA A;  4Y7T A;  2V0H A;  5CMJ A;  1H4C A;  2RJ0 A;  2VXL A;  4Y7V A;  4NAL A;  1SS9 A;  3U2V A;  1G1L A;  4HO3 A;  3CGX A;  1ZCT A;  5FTV A;  4KNX A;  1KWS A;  4XWI A;  1WT1 A;  1VM8 A;  1FOA A;  4EEM A;  1ZJ3 A;  1TW5 A;  4G87 A;  3SXG A;  2JCL A;  1O0R A;  5HS2 A;  2RJ9 A;  4D0Z A;  3I0I X;  3U2X A;  5C1H A;  1ZI5 A;  2FYB A;  5CMH A;  3OAM A;  2XWM A;  3V0L A;  1HM9 A;  1ZDF A;  2P72 A;  4P00 A;  2PGY A;  4B5B A;  2V0J A;  5C1G A;  4ASY A;  4FRB A;  3Q4S A;  5CQM X;  1LZJ A;  1LZI A;  4ZDQ A;  3OH4 A;  1R7U A;  3I0G A;  1NMM B;  2YQJ A;  5CMI A;  3CKO A;  1INJ A;  2I5E A;  1G97 A;  4HO0 A;  3JTJ A;  2YQS A;  3SXB A;  2VS5 A;  1H5R A;  1W57 A;  1IIM A;  4HO8 A;  4AYJ A;  4FRA A;  1H4D A;  2RJ7 A;  4B2W A;  1NQI B;  4B42 A;  1G0R A;  4HO4 A;  2FYD B;  1GWV A;  1VPA A;  2JCJ A;  1GA8 A;  3F1C A;  3BCV A;  5CQP A;  2AES A;  2RIT A;  3V8Z A;  3DJ4 A;  3OH0 A;  1H7F A;  2E3D A;  3RMW A;  4Y63 A;  3IOH A;  4Y6N A;  2AM3 A;  5DDV A;  1S4O A;  5C3B A;  2VS4 A;  3HL3 A;  3U2W A;  3SPT A;  2Y4J A;  5C4C A;  5FUH A;  1OMZ A;  1JV1 A;  4KC1 A;  4BMA A;  5C4B A;  3Q7U A;  1MP3 A;  1QWJ A;  4FRL A;  1VGW A;  2O1H A;  3I0D A;  2BO6 A;  4D0T A;  2Y7A A;  4Y6U A;  1R81 A;  1EYR A;  3K8E A;  4M2B A;  3SXE A;  2FFU A;  3V91 A;  1FZW A;  1FXO A;  4HO9 A;  5C3D A;  1ZJ0 A;  1JYK A;  3GUE A;  4JD0 A;  1LL2 A;  3QVB A;  3PKQ A;  3DK5 A;  1G3L A;  1WVC A;  3I0C A;  5FU8 A;  4D11 A;  2BO7 A;  4DEC A;  3SX8 A;  2YC5 A;  3SXC A;  2PGV A;  4Q7C A;  1G95 A;  1ON6 A;  5AJN A;  4CJC A;  3F1Y A;  2WAW A;  1ZI1 A;  4KQL A;  4FQW A;  1R7X A;  3E26 A;  1E5K A;  3R2W A;  5C1L A;  3RSB A;  1H5S C;  2V0L A;  4KPX A;  4KT7 A;  5C49 A;  4AYL A;  3I0J A;  2YC3 A;  3RMV A;  1LZ0 A;  4B4M A;  5IDT A;  1ZJ1 A;  2CU2 A;  1JV3 A;  5EIY A;  2PX7 A;  2VSI A;  4AC3 A;  1FGX A;  4FIY A;  4FRE A;  3D8V A;  1XZ6 A;  2J0B A;  2D0J A;  1QG8 A;  2WVK A;  3CKQ A;  1G2V A;  4O6M A;  1O7Q A;  3U0Y A;  4Y62 A;  2NXV A;  1MC3 A;  4CJ8 A;  1FGG A;  2OEF A;  1ZJO A;  2ZU7 A;  5FU0 A;  5IDS A;  2AGD A;  3SX7 A;  3T7N A;  1H7H A;  3SXD A;  2C0N A;  4KC4 A;  2Q4J A;  2FFV A;  5DDT A;  5C3A A;  2BO8 A;  1QGQ A;  4G3S A;  3PKP A;  3D98 A;  5EJZ A;  4B4B A;  1TW1 A;  2V0I A;  3ZGG A;  3FOQ A;  2ICY A;  2AM5 A;  4ASJ A;  1HJJ A;  4Y7F A;  3ST8 A;  1YP3 A;  3JUJ A;  2Y4K A;  1FR9 A;  2RJ4 A;  4MND A;  3POL A;  3SX5 A;  1V84 A;  4JIS A;  2AE7 A;  2X5S A;  1VGZ A;  3D5N A;  3TQD A;  4FRM A;  2VS3 A;  4Y64 A;  1VZT A;  1FO9 A;  4FRD A;  5AJO A;  4UEG A;  1XHB A;  4B4G A;  1K4V A;  2YCM A;  2MZB A;  2JCO A;  2W0V A;  5CQN X;  3OH3 A;  2OEG A;  4EE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...