2AM4A

Crystal structure of n-acetylglucosaminyltransferase i in complex with udp-2-deoxy-2-fluoro-glucose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminylt
publication title X-ray Crystal Structures of Rabbit N-acetylglucosaminyltransferase I (GnT I) in Complex with Donor Substrate Analogues.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 112
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2005-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 2am4A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2am4A01
4HO3A 2QH5A 2UX8A 1LL3A 2AE7A 3RSBA 4D48A 3OKRA 2FYCB 1OQMB 2BO7A 1ZDFA 1ZI1A 3I0CA 4EEGA 2OEGA 2O1FA 3JTJA 2AH9A 4XWIA 3ZLLA 5IDTA 5C49A 4B42A 2ZU7A 3CGXA 5C3BA 2Z86A 3BCVA 4M4KA 1R7VA 5CQOA 5FU0A 4D11C 1SS9A 2YQSA 2GGQA 4Y9XA 5DDTA 4Y7FA 1H7GA 1H5SB 3E25A 4Y6UA 2Y4LA 1ZJPA 2OI7A 3U0YA 1INJA 1FG5N 1VZXA 1G95A 1H7EA 3V0MA 3V8ZA 1VGWA 4FCEA 3CU0A 2YESA 1VZUA 1VH3A 1FR8A 3OH1A 4ZDQA 4AAWA 2XMEA 2I5KA 4HOCA 2MZBA 3USQA 5EJZA 1V82A 4KC2A 1NHEB 1IIMA 2WVKA 1ZHJA 3D98A 4CVHA 1LZJA 1NMMB 3Q4SA 4FQWA 2JCKA 1H5SA 3NGWA 5CQNX 2I7BA 3OAMA 1V83A 3SX5A 4G3PA 2WVLA 3SXBA 4C2SA 1MP5A 1V84A 1ON6A 2AM5A 1JVDA 5AJOA 1ZCVA 1VGTA 5C4FA 1HJLA 5C4DA 4AYJA 4MYBA 5IFYA 3T7MA 1OMXA 4HO8A 5FU8A 3U0XA 1HM0A 3JUJA 1H4DA 3V0QA 1FXJA 2JCOA 5FYEA 4B3UA 2FYBA 2X5ZA 5IDSA 2BO8A 2WVMA 1WSZA 4LW6A 4AYLA 1O7OA 4KNRA 4BQHA 5C4CA 3SPTA 5I1FA 1H5RB 2WE9A 4ASYA 2Y6PA 4HO2A 2DPWA 1E5KA 5J49A 2RJ8A 2O1GA 4Y7VA 5C38A 1HM8A 1W77A 5CMFX 3I0DA 2ZU9A 5C1HA 1H7HA 3Q80A 4JISA 3PNNA 4B4BA 2Y7AA 3SXAA 3OH0A 4KC4A 1ZI4A 1FGXA 1VPAA 4FREA 3SX8A 1GWVA 4G3QA 4KC1A 4D0ZA 3IOHA 2QKXA 3I0FA 1R81A 4B2XA 1FO9A 4NALA 1JVGA 3V91A 2OEFA 4HO9A 1H5RA 3SXGA 1G8OA 2ICYA 1FO8A 1TW5A 2V0KA 3T7OA 1QGSA 2RJ5A 2YQHA 3OH3A 2YC3A 4Y7TA 4B5BA 1VGZA 2JCJA 1HM9A 4G3SA 1ZJ2A 4FRPA 2AM3A 1H7LA 5CQLX 5BXCA 1ZI3A 4EE5A 3O3PA 2RJ4A 1LVWA 3ZGGA 1VH1A 2Q4JA 4Y7GA 3SX7A 4DECA 1FGGA 3EE5A 4NANA 4HO5A 4DE7A 1G2VA 1PZTA 1MP4A 1XZ6A 3I0IX 2AGDA 3TQDA 1S4OA 5HS2A 4IRQA 4CJCA 4M28A 2VS4A 4CJBA 3FWWA 2P72A 2BO4A 4G87A 1OMZA 4Y64A 4D11A 4YS8A 3ZLKA 4KPXA 1I52A 3TZTA 2YCMA 4ASJA 3F1CA 2RJ0A 3QVBA 4R7PA 1VZTA 1WVCA 4M2BA 4J18A 5CQMX 5C4EA 1ZCYA 3K8DA 3ZGFA 2XWLA 3RMVA 1ZCUA 1PZYB 5C4BA 4K6RA 2RJ1A 5JQQA 1HV9A 2XWMA 5DDVA 2A8UA 4FRHA 3OH2A 3GUEA 1FZWA 3PKPA 1TVYA 1ZIZA 4FROA 2RIYA 3CKOA 2QGIA 4EE3A 4P00A 1WT3A 2Z87A 1R80A 2WEEA 3SXDA 4ARWA 1GWWA 1R7YA 4KPZA 2RITA 3D8VA 4FRMA 2FFVA 1ON8A 4FRAA 4HO4A 4NAKA 4HO0A 4EEAA 1H5SD 1W55A 4EVWA 3I0GA 1G0RA 1G97A 4LW3A 4M2AA 2E3DA 3CKNA 5EIYA 4Y62A 1R7TA 2RJ9A 3IOIA 4FRQA 1H4EA 3I0JA 1FR9A 2PGVA 3I0EA 4JD0A 2W0VA 4D0TA 1MP3A 1Z90A 3DK5A 4B4MA 3U2UA 5C48A 1VICA 2Y4JA 4KT7A 1G23A 3I0LA 1G9RA 1JYKA 1R82A 2D7IA 1GX0A 1IINA 3POLA 1H3MA 1GA8A 1ZDGA 2AECA 2AESA 2X5SA 2CU2A 3HL3A 3R2WA 3Q7UA 1FOAA 4NAIA 2VXMA 1G1LA 3ZF8A 2PX7A 4FRLA 1H4CA 2ICXA 4Y6NA 3CKVA 4KRVA 4KQLA 1GQ9A 2FY7A 2XMHA 1ZJ0A 5C1GA 5C3DA 1QWJA 1HJJA 3ST8A 2VFZA 1GQCA 3IOJA 4FRBA 1QGQA 1FXOA 1JV3A 3K8EA 3T7NA 3JUKA 3V0OA 4FRDA 5L6VA 2Y4KA 5C3AA 1EYRA 1WT1A 4HCQA 3CKJA 3V90A 1O0RA 2VS3A 5L6SA 1GX4A 4MNDA 2PGYA 5FTVA 1R7UA 1S4PA 4FCUA 4UEGA 4B2WA 1YP2A 3U2VA 2FFUA 5C8RA 3PKQA 1VM8A 2APCA 3U2WA 2VSHA 5AJNA 1S4NA 1ZJ3A 2P73A 4Y7UA 5CMHA 4CJ8A 2P6WA 1R7XA 1JYLA 2D7RA 1FRWA 3F1YA 3OH4A 4AC3A 4P02A 1XHBA 1YP3A 1H5SC 2FYAA 1NQIB 2X65A 2RIZA 3R3IA 1ZJ1A 1K4VA 2YQJA 1QG8A 2BO6A 2W0WA 4EEOA 5C36A 1LZ0A 2E8BA 2YC5A 2PA4A 4IRPA 2OI6A 5EJ1A 1YP4A 3OGZA 1ZCTA 4E1KA 4EE4A 1ZI5A 2V0IA 3DJ4A 4Y63A 1EZIA 1LZ7A 3SX3A 2RIXA 3LW6A 5AJPA 2I5EA 2ZU8A 4KNXA 3U2TA 2RJ6A 1H7TA 2NXVA 3U2XA 2O1HA 3OC9A 2VSIA 4GBPA 5CMJA 2VS5A 3V8YA 3DUVA 5CQPA 2AM4A 2V0HA 1WT2A 3I0HA 1NKHB 3N9WA 5C47A 1W57A 4ECMA 1FWYA 2A8WA 2V0JA 1O7QA 3SXEA 1G93A 1O23B 2WAWA 2RJ7A 3V0PA 1LZIA 3USRA 3I0KA 3FOQA 5CMGX 2OI5A 3BRKX 3V0NA 1G3LA 1H5TB 4HO6A 1LL2A 1VGUA 1H7QA 2V0LA 2XWNA 3D5NA 4DDZA 1H7FA 2JCLA 3E26A 1LL0A 3KIAA 1NF5B 2Y4MA 2D0JA 4HG6A 2VD4A 5FUHA 2FYDB 4KXOA 3CKQA 2X60A 5FV9A 3V0LA 1INIA 2WGZA 1ZJOA 1JV1A 1YROB 1TZFA 5CMIA 3RMWA 5FTSA 2VXLA 1WT0A 5C1LA 1NWGB 2GGOA 4B4GA 4BMAA 4L41C 1H5TA 4EEMA 1MC3A 1TW1A 3SXCA 2YQCA 1KWSA
chains in the Genus database with same CATH superfamily
1JC5A 4HO3A 1U69A 2QH5A 2UX8A 4Z6UA 3L7TA 1KW3B 1LL3A 2AE7A 3RSBA 4GHCA 4D48A 3OKRA 2FYCB 1OQMB 2BO7A 4IAGA 1ZDFA 1ZI1A 3I0CA 4EEGA 2OEGA 2O1FA 3JTJA 2AH9A 4XWIA 3ZLLA 5IDTA 5C49A 4B42A 2ZU7A 3CGXA 5C3BA 5DHWA 3BZAA 2Z86A 4Z6MA 3BCVA 4M4KA 1R7VA 5CQOA 5FU0A 4D11C 1SS9A 2YQSA 2GGQA 1SQIA 4Y9XA 5DDTA 4N04A 4Q7CA 4Y7FA 1H7GA 1H5SB 2ZW6A 3E25A 4Y6UA 2Y4LA 4HC5A 1KLLA 1ZJPA 2OI7A 4LQBA 1T47A 2EI1A 2VK9A 3U0YA 1INJA 1FG5N 1VZXA 1G95A 1H7EA 3V0MA 3V8ZA 1VGWA 4FCEA 3CU0A 4GHGA 2YESA 3VW9A 1VZUA 1VH3A 1FR8A 3OH1A 1QINA 3W0UA 4ZDQA 4AAWA 2XMEA 2I5KA 4HOCA 2MZBA 3USQA 5EJZA 1V82A 4KC2A 1EILA 1NHEB 1IIMA 4Z6OA 3ECKA 1ZHJA 2WVKA 3D98A 4CVHA 1LZJA 1NMMB 3Q4SA 4Z6PA 4FQWA 2JCKA 1H5SA 3NGWA 5CQNX 4Z6WA 3RMUA 2I7BA 3OAMA 1V83A 3SX5A 1SQDA 2P7LA 4G3PA 1KNDA 2WVLA 3SXBA 4C2SA 1MP5A 1V84A 1TG5A 1ON6A 1F9ZA 2AM5A 1JVDA 5AJOA 1ZCVA 1VGTA 5C4FA 3OJJA 3CT8A 2PJSA 1HJLA 5C4DA 4JH1A 4AYJA 4MYBA 2J0AA 5IFYA 2IG9A 3T7MA 1OMXA 4HO8A 5FU8A 1EIRA 1F1VA 3U0XA 4GHHA 1ECSA 1HM0A 3JUJA 1H4DA 3V0QA 1FXJA 5EC3A 2JCOA 5FYEA 4B3UA 2FYBA 2X5ZA 5IDSA 2BO8A 3HPVA 2WVMA 1WSZA 4LW6A 4Z6QA 4AYLA 1O7OA 4KNRA 4BQHA 3G12A 5C4CA 3SPTA 5I1FA 2ZW7A 1H5RB 2WE9A 4ASYA 2Y6PA 4HO2A 4GHEA 2EI2A 2DPWA 1E5KA 5J49A 2RJ8A 3GM5A 2QNTA 2O1GA 4Y7VA 2P7OA 5BWHA 5C38A 1HM8A 1W77A 5CMFX 2P25A 3I0DA 2ZU9A 5C1HA 1H7HA 3Q80A 4JISA 4RT5A 3PNNA 4B4BA 2Y7AA 3SXAA 3HUHA 1LGTA 3OH0A 4KC4A 1ZI4A 3EY8A 1FGXA 1VPAA 1JIEA 4FREA 3SX8A 1GWVA 5CB9A 4G3QA 4KC1A 1NIQB 1XQAA 4D0ZA 1QIPA 3IOHA 2QKXA 3I0FA 1R81A 2EI0A 4B2XA 1FO9A 4NALA 1JVGA 3V91A 2ZHPA 4NB1A 2OEFA 4HO9A 3R6AA 3GHJA 1H5RA 3SXGA 4NVSA 1G8OA 4JH2A 2ICYA 1KWBB 1FO8A 1TW5A 2V0KA 3T7OA 1QGSA 2RJ5A 2YQHA 3VB0A 1KW9B 3OH3A 4Z6ZA 2YC3A 5KEFA 4Y7TA 4B5BA 1SP9A 1VGZA 2JCJA 1F1UA 4NB0A 1HM9A 4G3SA 1ZJ2A 4FRPA 1EIQA 2AM3A 1H7LA 5CQLX 2ZYQA 2WL9A 3OA4A 5BXCA 1NPBA 1ZI3A 4EE5A 3KOLA 3IUZA 4G6XA 4QB5A 2I7RA 3O3PA 2RJ4A 1LVWA 3ZGGA 1VH1A 3B59A 2Q4JA 4Y7GA 3L20A 3SX7A 4DECA 1FGGA 1JIFA 3EE5A 4NANA 4HO5A 4DE7A 1G2VA 1PZTA 1MP4A 3BQXA 1XZ6A 3I0IX 2AGDA 2P7KA 4JH5A 2P7MA 3HDPA 3RHEA 3TQDA 1S4OA 5HS2A 4IRQA 4CJCA 4M28A 4NB2A 2VS4A 3OULA 4CJBA 3FWWA 3RRIA 2BO4A 2P72A 1OMZA 4G87A 4Y64A 4D11A 4YS8A 3ZLKA 4KPXA 1I52A 3TZTA 2YCMA 4ASJA 3F1CA 3OPYB 4NAZA 2RJ0A 3QVBA 4R7PA 3ZW5A 1VZTA 1WVCA 4J18A 4M2BA 5CQMX 5C4EA 1ZCYA 3K8DA 3ECJA 3ZGFA 2XWLA 1XRKA 3RMVA 1ZCUA 1PZYB 5C4BA 1LQOA 4K6RA 2RJ1A 5JQQA 1KW8B 1HV9A 2XWMA 5DDVA 2ZA0A 2A8UA 4FRHA 3OH2A 4PAVA 3GUEA 1FZWA 3E0RA 3PKPA 5BWGA 1TVYA 1ZIZA 4FROA 4JH9A 2RIYA 4JH7A 3CKOA 2QGIA 2RK9A 4EE3A 4P00A 1HANA 2R5VA 1WT3A 3R4QA 1CJXA 3PKWA 2Z87A 1R80A 4KYHA 2WEEA 4JH4A 3SXDA 4ARWA 2QH0A 4Z04A 1GWWA 1R7YA 4KPZA 3LM4A 2RITA 4JH6A 3D8VA 4FRMA 2FFVA 3PKXA 1ON8A 2A4XA 3OPYA 1LQKA 4FRAA 2P7PA 4Z6SA 4HO4A 4HO0A 4NAKA 4EEAA 3OJNA 1H5SD 1W55A 4EVWA 1NKIA 5C6XA 3I0GA 1G0RA 1G97A 4LW3A 2WL3A 4M2AA 2E3DA 3CKNA 5EIYA 4Z6RA 4Z6LA 1R7TA 2RJ9A 3IOIA 4FRQA 4Y62A 3ISQA 1H4EA 3SK2A 3I0JA 4NAYA 1FR9A 1QTOA 2PGVA 3I0EA 4JD0A 2W0VA 4D0TA 5C4PA 3OAJA 4MYMA 1MP3A 1Z90A 2IGAA 4Z6TA 3DK5A 2ZW5A 2C21A 4B4MA 3U2UA 5C48A 1VICA 4JH3A 3P8AA 3PKVA 3HPYA 1LKDA 2Y4JA 4KT7A 1G23A 3I0LA 1G9RA 5CJ3A 1JC4A 1JYKA 1R82A 3LHOA 2D7IA 3ZGJA 1GX0A 1LQPA 5D91A 1IINA 3POLA 1H3MA 1GA8A 1ZDGA 2AECA 2AESA 2J0BA 2X5SA 2CU2A 3HL3A 3R2WA 4GYMA 1Q0CA 4MIXA 3Q7UA 1FOAA 4NAIA 2VXMA 1G1LA 4JD1A 3ZF8A 2PX7A 4FRLA 1H4CA 2ICXA 2P7QA 4Y6NA 3CKVA 4KRVA 4PV5A 4KQLA 4OPNA 1GQ9A 4GHFA 2FY7A 2XMHA 1ZJ0A 2C0NA 5C1GA 1QWJA 1ZSWA 1HJJA 5C3DA 1MH6A 2VFZA 3ST8A 1U6LA 1GQCA 3IOJA 4FRBA 1QGQA 1KMYA 5D7ZA 1FXOA 3OXHA 4MTTA 1JV3A 3K8EA 3T7NA 3JUKA 3V0OA 1KWCB 4FRDA 5L6VA 2Y4KA 5C3AA 3EY7A 1EYRA 1WT1A 4HCQA 3HQ0A 3CKJA 1O0RA 3V90A 2VS3A 5L6SA 1GX4A 3FCDA 4MNDA 4MTRA 5DRHA 1MPYA 2PGYA 5FTVA 1BYLA 1R7UA 1S4PA 2EI3A 4FCUA 4O6NA 4UEGA 4B2WA 1YP2A 3U2VA 2FFUA 2A4WA 5C8RA 3PKQA 1VM8A 2APCA 3U2WA 2VSHA 5AJNA 1S4NA 1ZJ3A 2P73A 4Y7UA 5CMHA 4CJ8A 2P6WA 1R7XA 1JYLA 2D7RA 1FRWA 3F1YA 3OH4A 4FIYA 4AC3A 1SS4A 4P02A 1DHYA 4Z6NA 5DFGA 1XHBA 1YP3A 1H5SC 2FYAA 1NQIB 2X65A 1KNFA 2RIZA 3R3IA 4MTQA 1TSJA 1ZJ1A 1K4VA 1R9CA 1QG8A 2BO6A 2W0WA 2YQJA 4EEOA 5C36A 1LZ0A 2RJBA 2E8BA 1F1XA 2YC5A 3HNQA 2PA4A 4IRPA 2OI6A 5EJ1A 4KYKA 1YP4A 3OGZA 5D92A 1ZCTA 4E1KA 4EE4A 1ZI5A 3OJKA 2V0IA 2EHZA 3DJ4A 4Y63A 1EZIA 1LZ7A 4FIXA 3SX3A 2RIXA 3LW6A 3OJTA 5AJPA 2I5EA 1KW6B 2ZU8A 4KNXA 2RJ6A 3U2TA 3OUMA 1H7TA 2NXVA 1EWJA 2R6UA 3U2XA 2O1HA 3OC9A 2VSIA 1FA8A 4GBPA 5CMJA 2VS5A 3V8YA 3DUVA 5CQPA 2AM4A 2V0HA 1WT2A 3I0HA 3W0TA 1NKHB 4IR0A 3N9WA 5C47A 3ZI1A 1W57A 2Q48A 2RBBA 1FA5A 1FWYA 2A8WA 4ECMA 2V0JA 2ZI8A 1O7QA 3SXEA 1G93A 1O23B 2WAWA 4GHDA 2RJ7A 3V0PA 2RK0A 1FROA 1LZIA 3USRA 3I0KA 1F1RA 5CTOA 3FOQA 5CMGX 1XY7A 5C68A 4HUZA 2OI5A 3BRKX 3V0NA 1TFZA 1G3LA 1H5TB 4HO6A 2QQZA 1FA6A 3E5DA 5HCWA 1LL2A 4O6MA 1FA7A 1VGUA 1H7QA 2V0LA 2XWNA 3D5NA 4DDZA 1H7FA 2JCLA 1TWUA 1K4NA 3E26A 1LL0A 3KIAA 1NF5B 2Y4MA 2D0JA 4HG6A 2VD4A 1SP8A 5FUHA 5F6QA 4X2AA 2FYDB 4KXOA 3CKQA 2X60A 5FV9A 1KMZA 4Z6VA 3V0LA 1INIA 2WGZA 1Q0OA 1ZJOA 1JV1A 1YROB 1TZFA 4MTSA 5CMIA 3RMWA 5FTSA 1NNRA 2VXLA 1WT0A 5C1LA 1NWGB 2ZW4A 2GGOA 4B4GA 4L41C 4JH8A 4BMAA 1H5TA 4EEMA 1MC3A 1TW1A 3SXCA 5D4FA 1BH5A 2YQCA 1KWSA
chains in the Genus database with same CATH topology
4HO3A 2QH5A 2UX8A 1LL3A 2AE7A 3RSBA 4D48A 3OKRA 2FYCB 1OQMB 2BO7A 1ZDFA 1ZI1A 3I0CA 4EEGA 2OEGA 2O1FA 3JTJA 2AH9A 4XWIA 3ZLLA 5IDTA 5C49A 4B42A 2ZU7A 3CGXA 5C3BA 2Z86A 3BCVA 4M4KA 1R7VA 5CQOA 5FU0A 4D11C 1SS9A 2YQSA 2GGQA 4Y9XA 5DDTA 4Q7CA 4Y7FA 1H7GA 1H5SB 3E25A 4Y6UA 2Y4LA 1ZJPA 2OI7A 2VK9A 3U0YA 1INJA 1FG5N 1VZXA 1G95A 1H7EA 3V0MA 3V8ZA 1VGWA 4FCEA 3CU0A 2YESA 1VZUA 1VH3A 1FR8A 3OH1A 4ZDQA 4AAWA 2XMEA 2I5KA 4HOCA 2MZBA 3USQA 5EJZA 1V82A 4KC2A 1NHEB 1IIMA 2WVKA 1ZHJA 3D98A 4CVHA 1LZJA 1NMMB 3Q4SA 4FQWA 2JCKA 1H5SA 3NGWA 5CQNX 2I7BA 3OAMA 1V83A 3SX5A 4G3PA 2WVLA 3SXBA 4C2SA 1MP5A 1V84A 1ON6A 2AM5A 1JVDA 5AJOA 1ZCVA 1VGTA 5C4FA 1HJLA 5C4DA 4AYJA 4MYBA 2J0AA 5IFYA 3T7MA 1OMXA 4HO8A 5FU8A 3U0XA 1HM0A 3JUJA 1H4DA 3V0QA 1FXJA 2JCOA 5FYEA 4B3UA 2FYBA 2X5ZA 5IDSA 2BO8A 2WVMA 1WSZA 4LW6A 4AYLA 1O7OA 4KNRA 4BQHA 5C4CA 3SPTA 5I1FA 1H5RB 2WE9A 4ASYA 2Y6PA 4HO2A 2DPWA 1E5KA 5J49A 2RJ8A 2O1GA 4Y7VA 5C38A 1HM8A 1W77A 5CMFX 3I0DA 2ZU9A 5C1HA 1H7HA 3Q80A 4JISA 3PNNA 4B4BA 2Y7AA 3SXAA 3OH0A 4KC4A 1ZI4A 1FGXA 1VPAA 4FREA 3SX8A 1GWVA 4G3QA 4KC1A 4D0ZA 3IOHA 2QKXA 3I0FA 1R81A 4B2XA 1FO9A 4NALA 1JVGA 3V91A 2OEFA 4HO9A 1H5RA 3SXGA 1G8OA 2ICYA 1FO8A 1TW5A 2V0KA 3T7OA 1QGSA 2RJ5A 2YQHA 3OH3A 2YC3A 4Y7TA 4B5BA 1VGZA 2JCJA 1HM9A 4G3SA 1ZJ2A 4FRPA 2AM3A 1H7LA 5CQLX 5BXCA 1ZI3A 4EE5A 3O3PA 2RJ4A 1LVWA 3ZGGA 1VH1A 2Q4JA 4Y7GA 3SX7A 4DECA 1FGGA 3EE5A 4NANA 4HO5A 4DE7A 1G2VA 1PZTA 1MP4A 1XZ6A 3I0IX 2AGDA 3TQDA 1S4OA 5HS2A 4IRQA 4CJCA 4M28A 2VS4A 4CJBA 3FWWA 2P72A 2BO4A 4G87A 1OMZA 4Y64A 4D11A 4YS8A 3ZLKA 4KPXA 1I52A 3TZTA 2YCMA 4ASJA 3F1CA 2RJ0A 3QVBA 4R7PA 1VZTA 1WVCA 4M2BA 4J18A 5CQMX 5C4EA 1ZCYA 3K8DA 3ZGFA 2XWLA 3RMVA 1ZCUA 1PZYB 5C4BA 4K6RA 2RJ1A 5JQQA 1HV9A 2XWMA 5DDVA 2A8UA 4FRHA 3OH2A 3GUEA 1FZWA 3PKPA 1TVYA 1ZIZA 4FROA 2RIYA 3CKOA 2QGIA 4EE3A 4P00A 1WT3A 2Z87A 1R80A 2WEEA 3SXDA 4ARWA 1GWWA 1R7YA 4KPZA 2RITA 3D8VA 4FRMA 2FFVA 1ON8A 4FRAA 4HO4A 4NAKA 4HO0A 4EEAA 1H5SD 1W55A 4EVWA 3I0GA 1G0RA 1G97A 4LW3A 4M2AA 2E3DA 3CKNA 5EIYA 4Y62A 1R7TA 2RJ9A 3IOIA 4FRQA 1H4EA 3I0JA 1FR9A 2PGVA 3I0EA 4JD0A 2W0VA 4D0TA 1MP3A 1Z90A 3DK5A 4B4MA 3U2UA 5C48A 1VICA 2Y4JA 4KT7A 1G23A 3I0LA 1G9RA 1JYKA 1R82A 2D7IA 1GX0A 5D91A 1IINA 3POLA 1H3MA 1GA8A 1ZDGA 2AECA 2AESA 2J0BA 2X5SA 2CU2A 3HL3A 3R2WA 4MIXA 3Q7UA 1FOAA 4NAIA 2VXMA 1G1LA 3ZF8A 2PX7A 4FRLA 1H4CA 2ICXA 4Y6NA 3CKVA 4KRVA 4KQLA 1GQ9A 2FY7A 2XMHA 1ZJ0A 2C0NA 5C1GA 1QWJA 1HJJA 5C3DA 3ST8A 2VFZA 1GQCA 3IOJA 4FRBA 1QGQA 1FXOA 1JV3A 3K8EA 3T7NA 3JUKA 3V0OA 4FRDA 5L6VA 2Y4KA 5C3AA 1EYRA 1WT1A 4HCQA 3CKJA 3V90A 1O0RA 2VS3A 5L6SA 1GX4A 4MNDA 2PGYA 5FTVA 1R7UA 1S4PA 4FCUA 4O6NA 4UEGA 4B2WA 1YP2A 3U2VA 2FFUA 5C8RA 3PKQA 1VM8A 2APCA 3U2WA 2VSHA 5AJNA 1S4NA 1ZJ3A 2P73A 4Y7UA 5CMHA 4CJ8A 2P6WA 1R7XA 1JYLA 2D7RA 1FRWA 3F1YA 3OH4A 4FIYA 4AC3A 4P02A 1XHBA 1YP3A 1H5SC 2FYAA 1NQIB 2X65A 2RIZA 3R3IA 1ZJ1A 1K4VA 2YQJA 1QG8A 2BO6A 2W0WA 4EEOA 5C36A 1LZ0A 2E8BA 2YC5A 2PA4A 4IRPA 2OI6A 5EJ1A 1YP4A 5D92A 3OGZA 1ZCTA 4E1KA 4EE4A 1ZI5A 2V0IA 3DJ4A 4Y63A 1EZIA 1LZ7A 4FIXA 3SX3A 2RIXA 3LW6A 5AJPA 2I5EA 2ZU8A 4KNXA 3U2TA 2RJ6A 1H7TA 2NXVA 3U2XA 2O1HA 3OC9A 2VSIA 4GBPA 5CMJA 2VS5A 3V8YA 3DUVA 5CQPA 2AM4A 2V0HA 1WT2A 3I0HA 1NKHB 3N9WA 5C47A 1W57A 4ECMA 1FWYA 2A8WA 2V0JA 1O7QA 3SXEA 1G93A 1O23B 2WAWA 2RJ7A 3V0PA 1LZIA 3USRA 3I0KA 3FOQA 5CMGX 2OI5A 3BRKX 3V0NA 1G3LA 1H5TB 4HO6A 1LL2A 4O6MA 1VGUA 1H7QA 2V0LA 2XWNA 3D5NA 4DDZA 1H7FA 2JCLA 3E26A 1LL0A 3KIAA 1NF5B 2Y4MA 2D0JA 4HG6A 2VD4A 5FUHA 2FYDB 4KXOA 3CKQA 2X60A 5FV9A 3V0LA 1INIA 2WGZA 1ZJOA 1JV1A 1YROB 1TZFA 5CMIA 3RMWA 5FTSA 2VXLA 1WT0A 5C1LA 1NWGB 2GGOA 4B4GA 4BMAA 4L41C 1H5TA 4EEMA 1MC3A 1TW1A 3SXCA 2YQCA 1KWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO3 A;  2QH5 A;  2UX8 A;  1LL3 A;  2AE7 A;  3RSB A;  4D48 A;  3OKR A;  2FYC B;  1OQM B;  2BO7 A;  1ZDF A;  1ZI1 A;  3I0C A;  4EEG A;  2OEG A;  2O1F A;  3JTJ A;  2AH9 A;  4XWI A;  3ZLL A;  5IDT A;  5C49 A;  4B42 A;  2ZU7 A;  3CGX A;  5C3B A;  2Z86 A;  3BCV A;  4M4K A;  1R7V A;  5CQO A;  5FU0 A;  4D11 C;  1SS9 A;  2YQS A;  2GGQ A;  4Y9X A;  5DDT A;  4Y7F A;  1H7G A;  1H5S B;  3E25 A;  4Y6U A;  2Y4L A;  1ZJP A;  2OI7 A;  3U0Y A;  1INJ A;  1FG5 N;  1VZX A;  1G95 A;  1H7E A;  3V0M A;  3V8Z A;  1VGW A;  4FCE A;  3CU0 A;  2YES A;  1VZU A;  1VH3 A;  1FR8 A;  3OH1 A;  4ZDQ A;  4AAW A;  2XME A;  2I5K A;  4HOC A;  2MZB A;  3USQ A;  5EJZ A;  1V82 A;  4KC2 A;  1NHE B;  1IIM A;  2WVK A;  1ZHJ A;  3D98 A;  4CVH A;  1LZJ A;  1NMM B;  3Q4S A;  4FQW A;  2JCK A;  1H5S A;  3NGW A;  5CQN X;  2I7B A;  3OAM A;  1V83 A;  3SX5 A;  4G3P A;  2WVL A;  3SXB A;  4C2S A;  1MP5 A;  1V84 A;  1ON6 A;  2AM5 A;  1JVD A;  5AJO A;  1ZCV A;  1VGT A;  5C4F A;  1HJL A;  5C4D A;  4AYJ A;  4MYB A;  5IFY A;  3T7M A;  1OMX A;  4HO8 A;  5FU8 A;  3U0X A;  1HM0 A;  3JUJ A;  1H4D A;  3V0Q A;  1FXJ A;  2JCO A;  5FYE A;  4B3U A;  2FYB A;  2X5Z A;  5IDS A;  2BO8 A;  2WVM A;  1WSZ A;  4LW6 A;  4AYL A;  1O7O A;  4KNR A;  4BQH A;  5C4C A;  3SPT A;  5I1F A;  1H5R B;  2WE9 A;  4ASY A;  2Y6P A;  4HO2 A;  2DPW A;  1E5K A;  5J49 A;  2RJ8 A;  2O1G A;  4Y7V A;  5C38 A;  1HM8 A;  1W77 A;  5CMF X;  3I0D A;  2ZU9 A;  5C1H A;  1H7H A;  3Q80 A;  4JIS A;  3PNN A;  4B4B A;  2Y7A A;  3SXA A;  3OH0 A;  4KC4 A;  1ZI4 A;  1FGX A;  1VPA A;  4FRE A;  3SX8 A;  1GWV A;  4G3Q A;  4KC1 A;  4D0Z A;  3IOH A;  2QKX A;  3I0F A;  1R81 A;  4B2X A;  1FO9 A;  4NAL A;  1JVG A;  3V91 A;  2OEF A;  4HO9 A;  1H5R A;  3SXG A;  1G8O A;  2ICY A;  1FO8 A;  1TW5 A;  2V0K A;  3T7O A;  1QGS A;  2RJ5 A;  2YQH A;  3OH3 A;  2YC3 A;  4Y7T A;  4B5B A;  1VGZ A;  2JCJ A;  1HM9 A;  4G3S A;  1ZJ2 A;  4FRP A;  2AM3 A;  1H7L A;  5CQL X;  5BXC A;  1ZI3 A;  4EE5 A;  3O3P A;  2RJ4 A;  1LVW A;  3ZGG A;  1VH1 A;  2Q4J A;  4Y7G A;  3SX7 A;  4DEC A;  1FGG A;  3EE5 A;  4NAN A;  4HO5 A;  4DE7 A;  1G2V A;  1PZT A;  1MP4 A;  1XZ6 A;  3I0I X;  2AGD A;  3TQD A;  1S4O A;  5HS2 A;  4IRQ A;  4CJC A;  4M28 A;  2VS4 A;  4CJB A;  3FWW A;  2P72 A;  2BO4 A;  4G87 A;  1OMZ A;  4Y64 A;  4D11 A;  4YS8 A;  3ZLK A;  4KPX A;  1I52 A;  3TZT A;  2YCM A;  4ASJ A;  3F1C A;  2RJ0 A;  3QVB A;  4R7P A;  1VZT A;  1WVC A;  4M2B A;  4J18 A;  5CQM X;  5C4E A;  1ZCY A;  3K8D A;  3ZGF A;  2XWL A;  3RMV A;  1ZCU A;  1PZY B;  5C4B A;  4K6R A;  2RJ1 A;  5JQQ A;  1HV9 A;  2XWM A;  5DDV A;  2A8U A;  4FRH A;  3OH2 A;  3GUE A;  1FZW A;  3PKP A;  1TVY A;  1ZIZ A;  4FRO A;  2RIY A;  3CKO A;  2QGI A;  4EE3 A;  4P00 A;  1WT3 A;  2Z87 A;  1R80 A;  2WEE A;  3SXD A;  4ARW A;  1GWW A;  1R7Y A;  4KPZ A;  2RIT A;  3D8V A;  4FRM A;  2FFV A;  1ON8 A;  4FRA A;  4HO4 A;  4NAK A;  4HO0 A;  4EEA A;  1H5S D;  1W55 A;  4EVW A;  3I0G A;  1G0R A;  1G97 A;  4LW3 A;  4M2A A;  2E3D A;  3CKN A;  5EIY A;  4Y62 A;  1R7T A;  2RJ9 A;  3IOI A;  4FRQ A;  1H4E A;  3I0J A;  1FR9 A;  2PGV A;  3I0E A;  4JD0 A;  2W0V A;  4D0T A;  1MP3 A;  1Z90 A;  3DK5 A;  4B4M A;  3U2U A;  5C48 A;  1VIC A;  2Y4J A;  4KT7 A;  1G23 A;  3I0L A;  1G9R A;  1JYK A;  1R82 A;  2D7I A;  1GX0 A;  1IIN A;  3POL A;  1H3M A;  1GA8 A;  1ZDG A;  2AEC A;  2AES A;  2X5S A;  2CU2 A;  3HL3 A;  3R2W A;  3Q7U A;  1FOA A;  4NAI A;  2VXM A;  1G1L A;  3ZF8 A;  2PX7 A;  4FRL A;  1H4C A;  2ICX A;  4Y6N A;  3CKV A;  4KRV A;  4KQL A;  1GQ9 A;  2FY7 A;  2XMH A;  1ZJ0 A;  5C1G A;  5C3D A;  1QWJ A;  1HJJ A;  3ST8 A;  2VFZ A;  1GQC A;  3IOJ A;  4FRB A;  1QGQ A;  1FXO A;  1JV3 A;  3K8E A;  3T7N A;  3JUK A;  3V0O A;  4FRD A;  5L6V A;  2Y4K A;  5C3A A;  1EYR A;  1WT1 A;  4HCQ A;  3CKJ A;  3V90 A;  1O0R A;  2VS3 A;  5L6S A;  1GX4 A;  4MND A;  2PGY A;  5FTV A;  1R7U A;  1S4P A;  4FCU A;  4UEG A;  4B2W A;  1YP2 A;  3U2V A;  2FFU A;  5C8R A;  3PKQ A;  1VM8 A;  2APC A;  3U2W A;  2VSH A;  5AJN A;  1S4N A;  1ZJ3 A;  2P73 A;  4Y7U A;  5CMH A;  4CJ8 A;  2P6W A;  1R7X A;  1JYL A;  2D7R A;  1FRW A;  3F1Y A;  3OH4 A;  4AC3 A;  4P02 A;  1XHB A;  1YP3 A;  1H5S C;  2FYA A;  1NQI B;  2X65 A;  2RIZ A;  3R3I A;  1ZJ1 A;  1K4V A;  2YQJ A;  1QG8 A;  2BO6 A;  2W0W A;  4EEO A;  5C36 A;  1LZ0 A;  2E8B A;  2YC5 A;  2PA4 A;  4IRP A;  2OI6 A;  5EJ1 A;  1YP4 A;  3OGZ A;  1ZCT A;  4E1K A;  4EE4 A;  1ZI5 A;  2V0I A;  3DJ4 A;  4Y63 A;  1EZI A;  1LZ7 A;  3SX3 A;  2RIX A;  3LW6 A;  5AJP A;  2I5E A;  2ZU8 A;  4KNX A;  3U2T A;  2RJ6 A;  1H7T A;  2NXV A;  3U2X A;  2O1H A;  3OC9 A;  2VSI A;  4GBP A;  5CMJ A;  2VS5 A;  3V8Y A;  3DUV A;  5CQP A;  2AM4 A;  2V0H A;  1WT2 A;  3I0H A;  1NKH B;  3N9W A;  5C47 A;  1W57 A;  4ECM A;  1FWY A;  2A8W A;  2V0J A;  1O7Q A;  3SXE A;  1G93 A;  1O23 B;  2WAW A;  2RJ7 A;  3V0P A;  1LZI A;  3USR A;  3I0K A;  3FOQ A;  5CMG X;  2OI5 A;  3BRK X;  3V0N A;  1G3L A;  1H5T B;  4HO6 A;  1LL2 A;  1VGU A;  1H7Q A;  2V0L A;  2XWN A;  3D5N A;  4DDZ A;  1H7F A;  2JCL A;  3E26 A;  1LL0 A;  3KIA A;  1NF5 B;  2Y4M A;  2D0J A;  4HG6 A;  2VD4 A;  5FUH A;  2FYD B;  4KXO A;  3CKQ A;  2X60 A;  5FV9 A;  3V0L A;  1INI A;  2WGZ A;  1ZJO A;  1JV1 A;  1YRO B;  1TZF A;  5CMI A;  3RMW A;  5FTS A;  2VXL A;  1WT0 A;  5C1L A;  1NWG B;  2GGO A;  4B4G A;  4BMA A;  4L41 C;  1H5T A;  4EEM A;  1MC3 A;  1TW1 A;  3SXC A;  2YQC A;  1KWS A; 
#chains in the Genus database with same CATH topology
 1JC5 A;  4HO3 A;  1U69 A;  2QH5 A;  2UX8 A;  4Z6U A;  3L7T A;  1KW3 B;  1LL3 A;  2AE7 A;  3RSB A;  4GHC A;  4D48 A;  3OKR A;  2FYC B;  1OQM B;  2BO7 A;  4IAG A;  1ZDF A;  1ZI1 A;  3I0C A;  4EEG A;  2OEG A;  2O1F A;  3JTJ A;  2AH9 A;  4XWI A;  3ZLL A;  5IDT A;  5C49 A;  4B42 A;  2ZU7 A;  3CGX A;  5C3B A;  5DHW A;  3BZA A;  2Z86 A;  4Z6M A;  3BCV A;  4M4K A;  1R7V A;  5CQO A;  5FU0 A;  4D11 C;  1SS9 A;  2YQS A;  2GGQ A;  1SQI A;  4Y9X A;  5DDT A;  4N04 A;  4Q7C A;  4Y7F A;  1H7G A;  1H5S B;  2ZW6 A;  3E25 A;  4Y6U A;  2Y4L A;  4HC5 A;  1KLL A;  1ZJP A;  2OI7 A;  4LQB A;  1T47 A;  2EI1 A;  2VK9 A;  3U0Y A;  1INJ A;  1FG5 N;  1VZX A;  1G95 A;  1H7E A;  3V0M A;  3V8Z A;  1VGW A;  4FCE A;  3CU0 A;  4GHG A;  2YES A;  3VW9 A;  1VZU A;  1VH3 A;  1FR8 A;  3OH1 A;  1QIN A;  3W0U A;  4ZDQ A;  4AAW A;  2XME A;  2I5K A;  4HOC A;  2MZB A;  3USQ A;  5EJZ A;  1V82 A;  4KC2 A;  1EIL A;  1NHE B;  1IIM A;  4Z6O A;  3ECK A;  1ZHJ A;  2WVK A;  3D98 A;  4CVH A;  1LZJ A;  1NMM B;  3Q4S A;  4Z6P A;  4FQW A;  2JCK A;  1H5S A;  3NGW A;  5CQN X;  4Z6W A;  3RMU A;  2I7B A;  3OAM A;  1V83 A;  3SX5 A;  1SQD A;  2P7L A;  4G3P A;  1KND A;  2WVL A;  3SXB A;  4C2S A;  1MP5 A;  1V84 A;  1TG5 A;  1ON6 A;  1F9Z A;  2AM5 A;  1JVD A;  5AJO A;  1ZCV A;  1VGT A;  5C4F A;  3OJJ A;  3CT8 A;  2PJS A;  1HJL A;  5C4D A;  4JH1 A;  4AYJ A;  4MYB A;  2J0A A;  5IFY A;  2IG9 A;  3T7M A;  1OMX A;  4HO8 A;  5FU8 A;  1EIR A;  1F1V A;  3U0X A;  4GHH A;  1ECS A;  1HM0 A;  3JUJ A;  1H4D A;  3V0Q A;  1FXJ A;  5EC3 A;  2JCO A;  5FYE A;  4B3U A;  2FYB A;  2X5Z A;  5IDS A;  2BO8 A;  3HPV A;  2WVM A;  1WSZ A;  4LW6 A;  4Z6Q A;  4AYL A;  1O7O A;  4KNR A;  4BQH A;  3G12 A;  5C4C A;  3SPT A;  5I1F A;  2ZW7 A;  1H5R B;  2WE9 A;  4ASY A;  2Y6P A;  4HO2 A;  4GHE A;  2EI2 A;  2DPW A;  1E5K A;  5J49 A;  2RJ8 A;  3GM5 A;  2QNT A;  2O1G A;  4Y7V A;  2P7O A;  5BWH A;  5C38 A;  1HM8 A;  1W77 A;  5CMF X;  2P25 A;  3I0D A;  2ZU9 A;  5C1H A;  1H7H A;  3Q80 A;  4JIS A;  4RT5 A;  3PNN A;  4B4B A;  2Y7A A;  3SXA A;  3HUH A;  1LGT A;  3OH0 A;  4KC4 A;  1ZI4 A;  3EY8 A;  1FGX A;  1VPA A;  1JIE A;  4FRE A;  3SX8 A;  1GWV A;  5CB9 A;  4G3Q A;  4KC1 A;  1NIQ B;  1XQA A;  4D0Z A;  1QIP A;  3IOH A;  2QKX A;  3I0F A;  1R81 A;  2EI0 A;  4B2X A;  1FO9 A;  4NAL A;  1JVG A;  3V91 A;  2ZHP A;  4NB1 A;  2OEF A;  4HO9 A;  3R6A A;  3GHJ A;  1H5R A;  3SXG A;  4NVS A;  1G8O A;  4JH2 A;  2ICY A;  1KWB B;  1FO8 A;  1TW5 A;  2V0K A;  3T7O A;  1QGS A;  2RJ5 A;  2YQH A;  3VB0 A;  1KW9 B;  3OH3 A;  4Z6Z A;  2YC3 A;  5KEF A;  4Y7T A;  4B5B A;  1SP9 A;  1VGZ A;  2JCJ A;  1F1U A;  4NB0 A;  1HM9 A;  4G3S A;  1ZJ2 A;  4FRP A;  1EIQ A;  2AM3 A;  1H7L A;  5CQL X;  2ZYQ A;  2WL9 A;  3OA4 A;  5BXC A;  1NPB A;  1ZI3 A;  4EE5 A;  3KOL A;  3IUZ A;  4G6X A;  4QB5 A;  2I7R A;  3O3P A;  2RJ4 A;  1LVW A;  3ZGG A;  1VH1 A;  3B59 A;  2Q4J A;  4Y7G A;  3L20 A;  3SX7 A;  4DEC A;  1FGG A;  1JIF A;  3EE5 A;  4NAN A;  4HO5 A;  4DE7 A;  1G2V A;  1PZT A;  1MP4 A;  3BQX A;  1XZ6 A;  3I0I X;  2AGD A;  2P7K A;  4JH5 A;  2P7M A;  3HDP A;  3RHE A;  3TQD A;  1S4O A;  5HS2 A;  4IRQ A;  4CJC A;  4M28 A;  4NB2 A;  2VS4 A;  3OUL A;  4CJB A;  3FWW A;  3RRI A;  2BO4 A;  2P72 A;  1OMZ A;  4G87 A;  4Y64 A;  4D11 A;  4YS8 A;  3ZLK A;  4KPX A;  1I52 A;  3TZT A;  2YCM A;  4ASJ A;  3F1C A;  3OPY B;  4NAZ A;  2RJ0 A;  3QVB A;  4R7P A;  3ZW5 A;  1VZT A;  1WVC A;  4J18 A;  4M2B A;  5CQM X;  5C4E A;  1ZCY A;  3K8D A;  3ECJ A;  3ZGF A;  2XWL A;  1XRK A;  3RMV A;  1ZCU A;  1PZY B;  5C4B A;  1LQO A;  4K6R A;  2RJ1 A;  5JQQ A;  1KW8 B;  1HV9 A;  2XWM A;  5DDV A;  2ZA0 A;  2A8U A;  4FRH A;  3OH2 A;  4PAV A;  3GUE A;  1FZW A;  3E0R A;  3PKP A;  5BWG A;  1TVY A;  1ZIZ A;  4FRO A;  4JH9 A;  2RIY A;  4JH7 A;  3CKO A;  2QGI A;  2RK9 A;  4EE3 A;  4P00 A;  1HAN A;  2R5V A;  1WT3 A;  3R4Q A;  1CJX A;  3PKW A;  2Z87 A;  1R80 A;  4KYH A;  2WEE A;  4JH4 A;  3SXD A;  4ARW A;  2QH0 A;  4Z04 A;  1GWW A;  1R7Y A;  4KPZ A;  3LM4 A;  2RIT A;  4JH6 A;  3D8V A;  4FRM A;  2FFV A;  3PKX A;  1ON8 A;  2A4X A;  3OPY A;  1LQK A;  4FRA A;  2P7P A;  4Z6S A;  4HO4 A;  4HO0 A;  4NAK A;  4EEA A;  3OJN A;  1H5S D;  1W55 A;  4EVW A;  1NKI A;  5C6X A;  3I0G A;  1G0R A;  1G97 A;  4LW3 A;  2WL3 A;  4M2A A;  2E3D A;  3CKN A;  5EIY A;  4Z6R A;  4Z6L A;  1R7T A;  2RJ9 A;  3IOI A;  4FRQ A;  4Y62 A;  3ISQ A;  1H4E A;  3SK2 A;  3I0J A;  4NAY A;  1FR9 A;  1QTO A;  2PGV A;  3I0E A;  4JD0 A;  2W0V A;  4D0T A;  5C4P A;  3OAJ A;  4MYM A;  1MP3 A;  1Z90 A;  2IGA A;  4Z6T A;  3DK5 A;  2ZW5 A;  2C21 A;  4B4M A;  3U2U A;  5C48 A;  1VIC A;  4JH3 A;  3P8A A;  3PKV A;  3HPY A;  1LKD A;  2Y4J A;  4KT7 A;  1G23 A;  3I0L A;  1G9R A;  5CJ3 A;  1JC4 A;  1JYK A;  1R82 A;  3LHO A;  2D7I A;  3ZGJ A;  1GX0 A;  1LQP A;  5D91 A;  1IIN A;  3POL A;  1H3M A;  1GA8 A;  1ZDG A;  2AEC A;  2AES A;  2J0B A;  2X5S A;  2CU2 A;  3HL3 A;  3R2W A;  4GYM A;  1Q0C A;  4MIX A;  3Q7U A;  1FOA A;  4NAI A;  2VXM A;  1G1L A;  4JD1 A;  3ZF8 A;  2PX7 A;  4FRL A;  1H4C A;  2ICX A;  2P7Q A;  4Y6N A;  3CKV A;  4KRV A;  4PV5 A;  4KQL A;  4OPN A;  1GQ9 A;  4GHF A;  2FY7 A;  2XMH A;  1ZJ0 A;  2C0N A;  5C1G A;  1QWJ A;  1ZSW A;  1HJJ A;  5C3D A;  1MH6 A;  2VFZ A;  3ST8 A;  1U6L A;  1GQC A;  3IOJ A;  4FRB A;  1QGQ A;  1KMY A;  5D7Z A;  1FXO A;  3OXH A;  4MTT A;  1JV3 A;  3K8E A;  3T7N A;  3JUK A;  3V0O A;  1KWC B;  4FRD A;  5L6V A;  2Y4K A;  5C3A A;  3EY7 A;  1EYR A;  1WT1 A;  4HCQ A;  3HQ0 A;  3CKJ A;  1O0R A;  3V90 A;  2VS3 A;  5L6S A;  1GX4 A;  3FCD A;  4MND A;  4MTR A;  5DRH A;  1MPY A;  2PGY A;  5FTV A;  1BYL A;  1R7U A;  1S4P A;  2EI3 A;  4FCU A;  4O6N A;  4UEG A;  4B2W A;  1YP2 A;  3U2V A;  2FFU A;  2A4W A;  5C8R A;  3PKQ A;  1VM8 A;  2APC A;  3U2W A;  2VSH A;  5AJN A;  1S4N A;  1ZJ3 A;  2P73 A;  4Y7U A;  5CMH A;  4CJ8 A;  2P6W A;  1R7X A;  1JYL A;  2D7R A;  1FRW A;  3F1Y A;  3OH4 A;  4FIY A;  4AC3 A;  1SS4 A;  4P02 A;  1DHY A;  4Z6N A;  5DFG A;  1XHB A;  1YP3 A;  1H5S C;  2FYA A;  1NQI B;  2X65 A;  1KNF A;  2RIZ A;  3R3I A;  4MTQ A;  1TSJ A;  1ZJ1 A;  1K4V A;  1R9C A;  1QG8 A;  2BO6 A;  2W0W A;  2YQJ A;  4EEO A;  5C36 A;  1LZ0 A;  2RJB A;  2E8B A;  1F1X A;  2YC5 A;  3HNQ A;  2PA4 A;  4IRP A;  2OI6 A;  5EJ1 A;  4KYK A;  1YP4 A;  3OGZ A;  5D92 A;  1ZCT A;  4E1K A;  4EE4 A;  1ZI5 A;  3OJK A;  2V0I A;  2EHZ A;  3DJ4 A;  4Y63 A;  1EZI A;  1LZ7 A;  4FIX A;  3SX3 A;  2RIX A;  3LW6 A;  3OJT A;  5AJP A;  2I5E A;  1KW6 B;  2ZU8 A;  4KNX A;  2RJ6 A;  3U2T A;  3OUM A;  1H7T A;  2NXV A;  1EWJ A;  2R6U A;  3U2X A;  2O1H A;  3OC9 A;  2VSI A;  1FA8 A;  4GBP A;  5CMJ A;  2VS5 A;  3V8Y A;  3DUV A;  5CQP A;  2AM4 A;  2V0H A;  1WT2 A;  3I0H A;  3W0T A;  1NKH B;  4IR0 A;  3N9W A;  5C47 A;  3ZI1 A;  1W57 A;  2Q48 A;  2RBB A;  1FA5 A;  1FWY A;  2A8W A;  4ECM A;  2V0J A;  2ZI8 A;  1O7Q A;  3SXE A;  1G93 A;  1O23 B;  2WAW A;  4GHD A;  2RJ7 A;  3V0P A;  2RK0 A;  1FRO A;  1LZI A;  3USR A;  3I0K A;  1F1R A;  5CTO A;  3FOQ A;  5CMG X;  1XY7 A;  5C68 A;  4HUZ A;  2OI5 A;  3BRK X;  3V0N A;  1TFZ A;  1G3L A;  1H5T B;  4HO6 A;  2QQZ A;  1FA6 A;  3E5D A;  5HCW A;  1LL2 A;  4O6M A;  1FA7 A;  1VGU A;  1H7Q A;  2V0L A;  2XWN A;  3D5N A;  4DDZ A;  1H7F A;  2JCL A;  1TWU A;  1K4N A;  3E26 A;  1LL0 A;  3KIA A;  1NF5 B;  2Y4M A;  2D0J A;  4HG6 A;  2VD4 A;  1SP8 A;  5FUH A;  5F6Q A;  4X2A A;  2FYD B;  4KXO A;  3CKQ A;  2X60 A;  5FV9 A;  1KMZ A;  4Z6V A;  3V0L A;  1INI A;  2WGZ A;  1Q0O A;  1ZJO A;  1JV1 A;  1YRO B;  1TZF A;  4MTS A;  5CMI A;  3RMW A;  5FTS A;  1NNR A;  2VXL A;  1WT0 A;  5C1L A;  1NWG B;  2ZW4 A;  2GGO A;  4B4G A;  4L41 C;  4JH8 A;  4BMA A;  1H5T A;  4EEM A;  1MC3 A;  1TW1 A;  3SXC A;  5D4F A;  1BH5 A;  2YQC A;  1KWS A; 
#chains in the Genus database with same CATH homology
 4HO3 A;  2QH5 A;  2UX8 A;  1LL3 A;  2AE7 A;  3RSB A;  4D48 A;  3OKR A;  2FYC B;  1OQM B;  2BO7 A;  1ZDF A;  1ZI1 A;  3I0C A;  4EEG A;  2OEG A;  2O1F A;  3JTJ A;  2AH9 A;  4XWI A;  3ZLL A;  5IDT A;  5C49 A;  4B42 A;  2ZU7 A;  3CGX A;  5C3B A;  2Z86 A;  3BCV A;  4M4K A;  1R7V A;  5CQO A;  5FU0 A;  4D11 C;  1SS9 A;  2YQS A;  2GGQ A;  4Y9X A;  5DDT A;  4Q7C A;  4Y7F A;  1H7G A;  1H5S B;  3E25 A;  4Y6U A;  2Y4L A;  1ZJP A;  2OI7 A;  2VK9 A;  3U0Y A;  1INJ A;  1FG5 N;  1VZX A;  1G95 A;  1H7E A;  3V0M A;  3V8Z A;  1VGW A;  4FCE A;  3CU0 A;  2YES A;  1VZU A;  1VH3 A;  1FR8 A;  3OH1 A;  4ZDQ A;  4AAW A;  2XME A;  2I5K A;  4HOC A;  2MZB A;  3USQ A;  5EJZ A;  1V82 A;  4KC2 A;  1NHE B;  1IIM A;  2WVK A;  1ZHJ A;  3D98 A;  4CVH A;  1LZJ A;  1NMM B;  3Q4S A;  4FQW A;  2JCK A;  1H5S A;  3NGW A;  5CQN X;  2I7B A;  3OAM A;  1V83 A;  3SX5 A;  4G3P A;  2WVL A;  3SXB A;  4C2S A;  1MP5 A;  1V84 A;  1ON6 A;  2AM5 A;  1JVD A;  5AJO A;  1ZCV A;  1VGT A;  5C4F A;  1HJL A;  5C4D A;  4AYJ A;  4MYB A;  2J0A A;  5IFY A;  3T7M A;  1OMX A;  4HO8 A;  5FU8 A;  3U0X A;  1HM0 A;  3JUJ A;  1H4D A;  3V0Q A;  1FXJ A;  2JCO A;  5FYE A;  4B3U A;  2FYB A;  2X5Z A;  5IDS A;  2BO8 A;  2WVM A;  1WSZ A;  4LW6 A;  4AYL A;  1O7O A;  4KNR A;  4BQH A;  5C4C A;  3SPT A;  5I1F A;  1H5R B;  2WE9 A;  4ASY A;  2Y6P A;  4HO2 A;  2DPW A;  1E5K A;  5J49 A;  2RJ8 A;  2O1G A;  4Y7V A;  5C38 A;  1HM8 A;  1W77 A;  5CMF X;  3I0D A;  2ZU9 A;  5C1H A;  1H7H A;  3Q80 A;  4JIS A;  3PNN A;  4B4B A;  2Y7A A;  3SXA A;  3OH0 A;  4KC4 A;  1ZI4 A;  1FGX A;  1VPA A;  4FRE A;  3SX8 A;  1GWV A;  4G3Q A;  4KC1 A;  4D0Z A;  3IOH A;  2QKX A;  3I0F A;  1R81 A;  4B2X A;  1FO9 A;  4NAL A;  1JVG A;  3V91 A;  2OEF A;  4HO9 A;  1H5R A;  3SXG A;  1G8O A;  2ICY A;  1FO8 A;  1TW5 A;  2V0K A;  3T7O A;  1QGS A;  2RJ5 A;  2YQH A;  3OH3 A;  2YC3 A;  4Y7T A;  4B5B A;  1VGZ A;  2JCJ A;  1HM9 A;  4G3S A;  1ZJ2 A;  4FRP A;  2AM3 A;  1H7L A;  5CQL X;  5BXC A;  1ZI3 A;  4EE5 A;  3O3P A;  2RJ4 A;  1LVW A;  3ZGG A;  1VH1 A;  2Q4J A;  4Y7G A;  3SX7 A;  4DEC A;  1FGG A;  3EE5 A;  4NAN A;  4HO5 A;  4DE7 A;  1G2V A;  1PZT A;  1MP4 A;  1XZ6 A;  3I0I X;  2AGD A;  3TQD A;  1S4O A;  5HS2 A;  4IRQ A;  4CJC A;  4M28 A;  2VS4 A;  4CJB A;  3FWW A;  2P72 A;  2BO4 A;  4G87 A;  1OMZ A;  4Y64 A;  4D11 A;  4YS8 A;  3ZLK A;  4KPX A;  1I52 A;  3TZT A;  2YCM A;  4ASJ A;  3F1C A;  2RJ0 A;  3QVB A;  4R7P A;  1VZT A;  1WVC A;  4M2B A;  4J18 A;  5CQM X;  5C4E A;  1ZCY A;  3K8D A;  3ZGF A;  2XWL A;  3RMV A;  1ZCU A;  1PZY B;  5C4B A;  4K6R A;  2RJ1 A;  5JQQ A;  1HV9 A;  2XWM A;  5DDV A;  2A8U A;  4FRH A;  3OH2 A;  3GUE A;  1FZW A;  3PKP A;  1TVY A;  1ZIZ A;  4FRO A;  2RIY A;  3CKO A;  2QGI A;  4EE3 A;  4P00 A;  1WT3 A;  2Z87 A;  1R80 A;  2WEE A;  3SXD A;  4ARW A;  1GWW A;  1R7Y A;  4KPZ A;  2RIT A;  3D8V A;  4FRM A;  2FFV A;  1ON8 A;  4FRA A;  4HO4 A;  4NAK A;  4HO0 A;  4EEA A;  1H5S D;  1W55 A;  4EVW A;  3I0G A;  1G0R A;  1G97 A;  4LW3 A;  4M2A A;  2E3D A;  3CKN A;  5EIY A;  4Y62 A;  1R7T A;  2RJ9 A;  3IOI A;  4FRQ A;  1H4E A;  3I0J A;  1FR9 A;  2PGV A;  3I0E A;  4JD0 A;  2W0V A;  4D0T A;  1MP3 A;  1Z90 A;  3DK5 A;  4B4M A;  3U2U A;  5C48 A;  1VIC A;  2Y4J A;  4KT7 A;  1G23 A;  3I0L A;  1G9R A;  1JYK A;  1R82 A;  2D7I A;  1GX0 A;  5D91 A;  1IIN A;  3POL A;  1H3M A;  1GA8 A;  1ZDG A;  2AEC A;  2AES A;  2J0B A;  2X5S A;  2CU2 A;  3HL3 A;  3R2W A;  4MIX A;  3Q7U A;  1FOA A;  4NAI A;  2VXM A;  1G1L A;  3ZF8 A;  2PX7 A;  4FRL A;  1H4C A;  2ICX A;  4Y6N A;  3CKV A;  4KRV A;  4KQL A;  1GQ9 A;  2FY7 A;  2XMH A;  1ZJ0 A;  2C0N A;  5C1G A;  1QWJ A;  1HJJ A;  5C3D A;  3ST8 A;  2VFZ A;  1GQC A;  3IOJ A;  4FRB A;  1QGQ A;  1FXO A;  1JV3 A;  3K8E A;  3T7N A;  3JUK A;  3V0O A;  4FRD A;  5L6V A;  2Y4K A;  5C3A A;  1EYR A;  1WT1 A;  4HCQ A;  3CKJ A;  3V90 A;  1O0R A;  2VS3 A;  5L6S A;  1GX4 A;  4MND A;  2PGY A;  5FTV A;  1R7U A;  1S4P A;  4FCU A;  4O6N A;  4UEG A;  4B2W A;  1YP2 A;  3U2V A;  2FFU A;  5C8R A;  3PKQ A;  1VM8 A;  2APC A;  3U2W A;  2VSH A;  5AJN A;  1S4N A;  1ZJ3 A;  2P73 A;  4Y7U A;  5CMH A;  4CJ8 A;  2P6W A;  1R7X A;  1JYL A;  2D7R A;  1FRW A;  3F1Y A;  3OH4 A;  4FIY A;  4AC3 A;  4P02 A;  1XHB A;  1YP3 A;  1H5S C;  2FYA A;  1NQI B;  2X65 A;  2RIZ A;  3R3I A;  1ZJ1 A;  1K4V A;  2YQJ A;  1QG8 A;  2BO6 A;  2W0W A;  4EEO A;  5C36 A;  1LZ0 A;  2E8B A;  2YC5 A;  2PA4 A;  4IRP A;  2OI6 A;  5EJ1 A;  1YP4 A;  5D92 A;  3OGZ A;  1ZCT A;  4E1K A;  4EE4 A;  1ZI5 A;  2V0I A;  3DJ4 A;  4Y63 A;  1EZI A;  1LZ7 A;  4FIX A;  3SX3 A;  2RIX A;  3LW6 A;  5AJP A;  2I5E A;  2ZU8 A;  4KNX A;  3U2T A;  2RJ6 A;  1H7T A;  2NXV A;  3U2X A;  2O1H A;  3OC9 A;  2VSI A;  4GBP A;  5CMJ A;  2VS5 A;  3V8Y A;  3DUV A;  5CQP A;  2AM4 A;  2V0H A;  1WT2 A;  3I0H A;  1NKH B;  3N9W A;  5C47 A;  1W57 A;  4ECM A;  1FWY A;  2A8W A;  2V0J A;  1O7Q A;  3SXE A;  1G93 A;  1O23 B;  2WAW A;  2RJ7 A;  3V0P A;  1LZI A;  3USR A;  3I0K A;  3FOQ A;  5CMG X;  2OI5 A;  3BRK X;  3V0N A;  1G3L A;  1H5T B;  4HO6 A;  1LL2 A;  4O6M A;  1VGU A;  1H7Q A;  2V0L A;  2XWN A;  3D5N A;  4DDZ A;  1H7F A;  2JCL A;  3E26 A;  1LL0 A;  3KIA A;  1NF5 B;  2Y4M A;  2D0J A;  4HG6 A;  2VD4 A;  5FUH A;  2FYD B;  4KXO A;  3CKQ A;  2X60 A;  5FV9 A;  3V0L A;  1INI A;  2WGZ A;  1ZJO A;  1JV1 A;  1YRO B;  1TZF A;  5CMI A;  3RMW A;  5FTS A;  2VXL A;  1WT0 A;  5C1L A;  1NWG B;  2GGO A;  4B4G A;  4BMA A;  4L41 C;  1H5T A;  4EEM A;  1MC3 A;  1TW1 A;  3SXC A;  2YQC A;  1KWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...