5D91A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 115
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d91A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d91A01
5D91A 4O6MA 4O6NA 4Q7CA 4MNDA 5D92A
chains in the Genus database with same CATH superfamily
4OD5A 5A69A 4AL1A 4Y7VA 4CJCA 2BO7A 3CSKA 5C1HA 4D11A 2V3CC 5KYUB 4A4AA 5A6AA 5EK0A 1EZIA 1OXKA 2AESA 1SMYF 5BXCA 3GWLA 5A6KA 2WE9A 3NDBB 2YWAA 2UUIA 5EJZA 3EE5A 3V0QA 2KJGA 4D48A 1HJJA 1H9TA 4PFPA 2A0UA 2W0WA 4BJ6C 1YP3A 1R81A 3EHNA 4Y7GA 3VF0A 3L0IA 5C49A 3JTLO 3O6XA 3A11A 3EHMA 4BJ5A 3NMJA 3ZG1A 2IXNA 2X51A 3X1OA 1GM5A 5CQPA 1ZDFA 3HNJA 1H4CA 2A8UA 3V5YA 1MMDA 1C03A 2IBFA 4BG0A 4CSAC 4B4BA 2HUJA 4XEFA 3ABMC 2HV7A 1GX0A 1YA7O 1VZXA 3L1MA 4IARA 4J7YA 4E1KA 2LCHA 2UX8A 2FYDB 4OIOF 2CGEA 3EGDA 2X0CA 1Z90A 1S4PA 2Y3DA 2IM8A 3B0UX 2OCCC 3JSZA 2YQSA 4RD9A 2ZPAA 3W8HA 5IDTA 4D11C 4BJTA 1JAFA 5A6JA 4MVMA 3LEVA 3O3PA 1ORSC 2BO8A 2EPMX 5FU8A 1O5HA 3DWWA 4FRQA 2QLAA 2L6GA 1LZIA 2A6HF 2W0VA 2RIYA 2A68F 4M28A 2Q4JA 2C04A 2J8WA 2YHSA 3O55A 1RJ9B 2GFHA 5C38A 3CKNA 4IRPA 2NUPA 3ZTMA 3KYJA 3HNLA 5JSLA 1NMMB 1Z23A 2YEVA 4LLEA 3QVYA 1DOWA 2VCBA 2E3DA 4EBKA 3V0MA 2JCJA 2I5EA 1ZJ1A 4B3UA 1GA8A 3T7NA 1V4AA 1LKXA 2XL6A 4HCQA 4JTAB 5DS6A 5DS4A 1CGME 2FAPB 5C4CA 1MC3A 2RJ5A 3TJ6A 2NUPB 1ZU4A 4BEJA 1JPJA 3T4RA 5COGA 1YP4A 3JUJA 3U0YA 4GYTA 1B68A 4KNRA 3ST8A 3NYLA 3FXHA 4AK9A 1RKCA 1YROB 1S05A 3DJUB 4FRAA 3EZIA 3RMWA 2O1HA 4HOCA 1W55A 3Q7LA 1TW5A 4EKWA 2C0NA 2R7UA 1FWYA 3R2PA 4YL1A 5CQOA 1S4NA 4D0ZA 3IEEA 2A69F 3RF3A 4PJJA 3U2WA 4Y62A 5KYNA 3HL3A 4CJGA 4FESA 1EYRA 3SXAA 4AC3A 4MVRA 1JVDA 2XWMA 1AVOB 1G95A 2DGJA 3DAGA 2RJ0A 2YZSA 4KRVA 1VB5A 3DZAA 4NALA 1E86A 5C3AA 2EPOA 2G3KA 1VZTA 4N6CA 4Y64A 3V90A 1RXQA 2RD9A 3ASOC 1FR8A 3QTHA 1LS1A 2FFHA 3ZSUA 4KC1A 1NZEA 2VXLA 4G3QA 3T7OA 4MVQA 5J49A 2ICWG 1FGGA 1IZMA 3U3BA 4U5BE 3AG3C 3TQOA 3G50A 3FMSA 1VTMP 1LPEA 1LIHA 3K6BA 4RDAA 3CGXA 3EQLF 1OR3A 4ECMA 4XPYA 1T5OA 4XPWA 2P6VA 4Y7FA 1G3LA 2VASA 1MP4A 1K4VA 1LM3B 2LIGA 1VYKA 2QNLA 2KNHA 3DAFA 2EIMC 2YL3A 4DVZA 3KPHA 4M4KA 5EJ1A 2R25A 4YWQA 4Y6UA 3OKRA 4EBBA 2I15A 4G3PA 2J7PD 2GGQA 3UMIA 2FYCB 4Z9HA 4JD0A 4OINF 1G23A 4LW6A 3SXGA 4YN0B 3VRCA 3H65A 4FCEA 1S4OA 1OQMB 3MX3A 3K33A 2G3VA 4PR9A 4Y7UA 3UGPA 4EHPA 2UUHA 1VH1A 2BO4A 3I0CA 1PD1A 4N06A 3F46A 2PA4A 3EG9A 4KPXA 4I44A 1VGUA 4D4NA 2Z87A 2CNWD 1VH3A 2J9VA 5DS5A 2Y3HA 4D4XA 4ARWA 4CBEA 5CI8A 3FOQA 3M79A 5COFA 3JYYA 2KYHA 3HKKA 3KL4A 3C7JA 3AQCA 3RH3A 2MHRA 2NUTB 2J9BA 4U5EE 3SXKA 2LFDA 3LW6A 1GQ9A 1K05A 4Y6NA 2PX7A 3ITFA 4C3BA 2BC5A 3VAYA 1MQVA 3F1CA 3EG9B 1OMZA 2J0BA 3DXJF 3RYLA 4WJ0A 4CJOA 3EJNA 3QMKA 1SS9A 4E17A 1G4WR 2Q3TA 3NMIA 4FIYA 3SX5A 3Q7GA 1XZQA 1IINA 2JCOA 1OCOC 1ORYA 1H7IA 1NBBA 1OCRC 4P6IC 1OKKD 1BR1A 3C8GD 4KC2A 1FFTC 4Y63A 3AG4C 1R80A 1W57A 2MWQA 1G5ZA 1NFOA 3DE8A 4EEGA 3NYMA 1QSPA 1MP3A 3E25A 3RFYA 1ZZPA 3E9VA 1BR2A 3GEEA 1H5RA 3U9JA 2ICXA 1TZFA 2O9XA 1C17M 1FOAA 2XL8A 4FX5A 3RIPA 3SXDA 5JLIA 1PV3A 3TJ5A 5IFYA 5AGFA 2J9WA 4B2WA 2YL0A 2LQGA 2P0NA 3MYFA 2HFIA 1QQ3A 3U2XA 3TZTA 2EINC 2FYBA 1H5SD 1J8MF 3GORA 3FVYA 1ZHXA 1W77A 3U2TA 4AL0A 1JYLA 4XEVA 3EFOA 1ZW3A 1ORJA 3ECSA 2E8BA 5EIYA 1H5RB 3GEHA 3Q6MA 1LS4A 1H7LA 2AECA 4DRJB 3SEOA 4P02A 4O7GA 4PJMA 2AM5A 3IPMO 5C36A 1AEPA 1Y6DA 4CS9A 2XSEA 3Q7UA 1T6IA 2HV6A 4CX9A 1Q0MA 4IRUA 3L8JA 2F22A 2H7OA 2AP3A 4OIPF 2V0LA 3OEOA 1PZTA 3EFOB 5A6BD 4YS8A 4U5FE 1NU7D 1G0RA 1GWWA 1BDJB 3EH1A 3DUVA 5E3CA 5CIVA 3DMDA 3IOJA 1QGSA 3J06A 3FOOA 3D5NA 3A9CA 1K40A 1CPQA 5FCLA 4R32A 1E83A 5HS2A 4BQHA 2RIXA 3QVBA 1ZVZA 3ZDLA 2R7OA 1NWGB 3ABLC 4K6RA 2D5RB 2W4MA 1Z5ZA 4EVWA 3LLKA 2YKZA 4ANJA 4I1OB 1OW8A 1HMOA 2ZD9A 2QE9A 2OOCA 2EIKC 2AE7A 1D0XA 1I4YA 2PGVA 3CKOA 5L0HA 1TVYA 1VGTA 1H7HA 1LI5A 4KNVA 1WT1A 4HG6A 3KKBA 1NKHB 2ZXWC 1QZXA 3GODA 4GEHA 4B42A 3RQEA 4R7PA 3NKDA 2XS8A 4MVOA 1A0BA 3TULA 4EE5A 4CS9C 1YZAA 1GS9A 1OQCA 1F1MA 1BR4A 3O39A 4JTCB 3U8PA 4QI0A 5FZTA 3I0JA 1Q0DA 2RJ4A 1M57C 2CU2A 2APCA 4YT8A 5AJPA 5COMA 1U0BB 4U5DE 2JPUA 4Q7CA 3V0OA 4MNDA 3I0EA 1H7TA 4CJBA 1WWPA 3K1IC 2D0JA 4NAIA 1ZU5A 5CQMX 2P73A 2D4UA 3IOHA 2RITA 1LI7A 4O6MA 3RKOF 3T9OA 3SXMA 4JCZA 2R7TA 2AU5A 3ZGFA 2YCMA 2PFDA 3GM1A 2E87A 2J0XA 4U5HA 2OI6A 2TMVP 1HJLA 4FRDA 1Q0GA 1YARO 3DJNB 4DRIB 1NG1A 3C8GB 2A0BA 3RSBA 2Z86A 1HW2A 5DLJA 1UG7A 1RJ9A 4BMAA 1YZCA 5CMHA 4Q4ZF 3ZLKA 3UNGC 2JCKA 5CMJA 2Q9CA 1VLSA 3KIAA 2L6FA 5C1GA 3U9MA 3JUKA 2WZFA 3QVZA 2YQYA 2AGDA 3I0IX 4CS7A 2XWNA 3ZC4A 3POVA 5C47A 1GQAA 3L34A 2HZ8A 3U2UA 1IW7F 4Z9JA 2P1AA 3AGTA 1NHEB 4WABA 5JUAA 2BL2A 4G3SA 4DDZA 4LERA 3ZQYA 4W8KA 3K7DA 4BJ5C 4MTFA 1ZHWA 3S84A 3KMIA 1D1AA 1H9GA 3CAXA 1I4ZA 4YL3A 3M4CA 2D7IA 4HO4A 4OIRF 3EH2A 1WT0A 4YL0A 2W9YA 3JCUQ 3N24A 4XLPF 1G9RA 1OR2A 4HO2A 4DECA 3TK0A 4EIYA 3C18A 4HO5A 3OH2A 3SXYA 1RCPA 4CIPA 2XLOA 4I1MA 1D1BA 2HJ3A 1LZJA 1N1CA 2QUPA 2R9RB 4MS2A 4G87A 3JT1A 4B5BA 4JCHA 2QKXA 3WG7C 3DM9B 3BRJA 2R02A 2DB4A 2R05A 3I0HA 1G2VA 3LLIA 1M2VA 2FFVA 2YVKA 4KPZA 2WGZA 4B4GA 4PJNA 3NG1A 3SXEA 4IAOA 3H2VA 1QG8A 3HNIA 4FROA 4LW3A 4JVSA 4XTKA 4EBJA 1YYXA 1EA8A 5AJOA 3HNKA 4FRHA 3UMHA 1VICA 3T7MA 3SX7A 1E2XA 2P72A 3OAMA 3FDQA 4JKVA 1D0ZA 2YL1A 2NSFA 1WT2A 4ULWA 1FTSA 2XLWA 1M2VB 4GQHA 2X5SA 4PK4A 3GEIA 3FAJA 3W4YA 4YT2A 1YP2A 2LFFA 4GBPA 1YYJA 4U5GA 2AVKA 4CIHA 1Q0KA 1H7QA 4K7BA 1MMGA 3I0GA 2P6WA 2C03A 2JX0A 3AOUA 1JRAA 1LE4A 1V74B 5AJNA 3WODF 1VK5A 1KTMA 4H54A 4JZAA 1ZHJA 1JVGA 5KYWB 3T6JA 2EILC 3U2MA 4FAPB 2Y39A 1V82A 4DBRA 3U8VA 1HE1A 1VZUA 2Y4MA 2AM4A 2G62A 1V55C 2O1FA 5E3AA 2IXMA 3K66A 5DQZA 1WGWA 5KYXB 4DJ9A 1YA9A 2VCCA 3V8ZA 3EGXB 2A6EF 4HFKB 2R7RA 1WATA 3N9WA 4P9TA 3JRMO 4Q5SF 4HO0A 4HEAJ 1Q0FA 1T01A 5JT4A 1E84A 3S9OA 3POLA 4JJGA 1NLXA 2OEXA 1FRWA 3WHNA 2NUTA 5B1BC 1HW1A 3SX8A 2WEEA 3U2VA 1YAUO 3FWWA 4C3DA 1HV9A 2VD4A 3ZQVA 3C8ZA 1C02A 2R03A 5JS5A 3T6BA 3O10A 2FYAA 4KNXA 2DPWA 2NPUA 3H2UA 3VM6A 2MYSA 4MVZA 5BUOA 3IHUA 1VOMA 1M2OA 1A7VA 3VYWA 1VGZA 1OW6A 2Q7RA 2QY9A 1TWCA 1WOLA 1FO8A 5IY5C 1CGOA 5L6SA 2W4BA 2J0AA 5C3BA 3L8IA 3W2VA 1KU2A 4JISA 2KQ9A 1O0RA 1LL3A 2Q9AA 2Y69C 3LJBA 3B0VC 3ATPA 2XWLA 2XLHA 3S0XA 4N4WA 4ER9A 3LS1A 5T3WA 4KT7A 4J30B 4E7ZA 4DE7A 5L6VA 1FAPB 4B6IA 2H8AA 2RJ6A 1XZPA 1O7OA 1FXJA 2IXOA 4C7OB 1G97A 1CPRA 1HMDA 2QH5A 4JRZA 1LZ7A 2X60A 4P00A 3USQA 2X5ZA 1ZCVA 3EZHA 1PZYB 3ABKC 3SPTA 4CJ8A 1SYQA 2ZU8A 2Y6PA 1FFHA 1YLMA 5B1AC 3RVZA 3RQGA 5E2QA 2RJ8A 5B3IA 2XLMA 4AX2A 4XPXA 4CDYA 4EUKB 4C2SA 2OQMA 1XWJA 4AAWA 5D91A 4XEKA 3GM3A 2WVLA 2HSBA 3DJ4A 3Q80A 1FNTc 4N6HA 4XLNF 1KNYA 3SP1A 2FFUA 2VS3A 2WVMA 3S90A 2W45A 1U89A 5TJ5E 2YL7A 3B0PA 256BA 4F4BA 1H7EA 2V26A 4YT5A 2YLIA 1FZWA 4OD4A 4B2XA 4JURI 4J18A 5CMFX 4DXWA 2WAWA 3HTKC 2WVNA 3M1CB 1RMVA 4LLCA 1WASA 1JR8A 2Y4JA 2XMEA 1ZJOA 4NANA 3ZIBA 3D98A 2GGOA 4WGZA 3LNMB 4JW1A 2HSQA 4KBLA 2DYRC 3QW1A 4U9EA 5C4BA 3PKQA 2XLVA 2J7PA 3T6GB 3RVYA 5F5HA 1QVXA 4EWCA 1ZJ3A 4L41C 1ZI1A 5BQIA 1D0YA 3N0TA 3M15A 1FXOA 4JJFA 2Z15A 3GWNA 2MZBA 5JQQA 2YC5A 2CNWA 4NTFA 4MYBA 5BQHA 4MQ9F 2ETSA 3E26A 4YK5A 2VSIA 2XLDA 2XXAA 2NXVA 3JSEO 3OH3A 1V83A 1ZCYA 4FRPA 1ZJPA 3IQCA 4L6RA 2L81A 1MP5A 3OH4A 3EPVA 3CZ6A 2VXMA 4ULVA 2JD3A 2IYLD 2YESA 2J46A 3NGWA 1OXBA 3FAPB 5CQNX 5L3VA 1T9KA 2M64A 2KK1A 2ASRA 1LL2A 1ZHZA 3DKAA 3V5ZA 1L3PA 3UR3C 4G7OF 1SR2A 4G7HF 2PF4E 4EEAA 4EEMA 4G78A 1R82A 1Y4CA 1QWJA 4MW8A 3PHF2 2XXAB 1XHBA 2YLDA 4QI2A 4J7TA 1O87A 2I7BA 1ON6A 3GUEA 2AH9A 3ASNC 2P61A 1EI7A 4Z9IA 4NY3A 5FU0A 1R4TA 1OKKA 1VGWA 5EGYA 3C8GA 1L7CA 3ZTZA 5KYYB 3SYNA 2J0WA 4DBQA 1FR0A 3AJMA 3PDMP 5IDSA 1IIMA 1GGQA 4LDRA 2JCLA 4HO9A 2LSEA 4CS8A 3JZ0A 1FG5N 2I5KA 2PNOA 1BZ4A 5F28E 1APCA 2EPKX 2QTVA 1AUEA 4KXOA 4NQFA 1ZHTA 2Y4LA 1ZW2A 5F5FA 2J45A 1K04A 2L7AA 2B0JA 4IB4A 5I1FA 5C48A 4RBNA 3PNNA 4E0HA 4HO3A 2A1DD 3OH1A 1H6GA 2RSEB 4U5CE 3I0FA 3RW0A 3LEOA 3CKQA 3W2WA 1JV3A 2WVOA 3F47A 5JP7A 2OKUA 1TWAA 1A7EA 1H5SA 1OCCC 2ZXOA 2XL4A 1Z6AA 4JEBA 4CDAA 1CGNA 2BO6A 3CQZA 4PACA 4ONSA 2DI3A 4K0DA 4FRMA 4Y9XA 5C4EA 2O1GA 2R7VA 1I52A 4E18A 1ZJ2A 4IAQA 2HS5A 4NTBA 1R7XA 3IQ5A 2YQHA 3JTJA 4JTDB 3TQDA 4CDVA 1ZI4A 3CKVA 1JMWA 1NSGB 4MW3A 1WT3A 2LD6A 4KI2A 5HV9A 2VB6A 1H5SB 1WVCA 3G4XA 1ON8A 3ZF8A 3MBGA 5C1LA 5JRAA 4KNWA 4NC3A 5A6BA 4PJLA 1R7YA 2BE5F 4FRBA 3EGDB 4LACB 1G8OA 2QGIA 3CU0A 3IQ6A 2R7WA 3OWTA 4Y7TA 1A7DA 4CS8C 4MTOA 2OEVA 1OMXA 5L3QA 2WL8A 3OA1A 2VS4A 2VC9A 1H7GA 2OI5A 5FV9A 5FUHA 4H4KC 2L6HA 3S29A 2WVQA 1H4DA 2KC3A 2R7XA 5DDVA 1OCZC 2OI7A 4YJWA 4AYLA 3SNHA 3LUTB 4EE3A 2H7BA 3AG1C 4MTGA 3V7OA 1H5SC 2V0IA 4WGYA 2Y3GA 2OEFA 1LVWA 2WZLA 2B0HA 1OW7A 2HMZA 3Q6NA 1WN0A 5T1DB 1O3UA 1NFNA 4NCQA 5CMIA 5JVEA 2VK9A 4FREA 2Q00A 5C4DA 4IGGA 1ZCTA 2Q4FA 3JYHA 4M2AA 1WTYA 2WZGA 2XS1A 4I3MA 2HJMA 1TW1A 1QKRA 1H3MA 2R7QA 1TKNA 2V0KA 5CI9A 1HM9A 1ZHYA 3GANA 3LESA 5E33A 1H5TA 1QGQA 3PMRA 3I5QA 1R7UA 5D92A 4KC4A 2XM4A 4MVSA 5KYWA 1RKEA 3K8EA 1MMNA 4JEAA 4MIXA 1DOVA 4FIXA 1E5KA 2GAQA 5BQGA 3NKEA 3N2ZB 1HY5A 2KSFA 5HSWA 1HM0A 1LZ0A 2PX0A 4AE4A 1E85A 4CVHA 5CQLX 3C63A 3MLGA 2R7SA 3CEXA 1H5TB 3IOIA 5KYXA 5EHHA 1QPUA 3EGXA 4LDKA 3B71A 1RKEB 1FR9A 3LS0A 2RJ9A 3MFNA 4IJJA 2XMHA 4G0HA 4MVUA 1VMAA 1Z3IX 3K1HA 3RQFA 4E0IA 2NSGA 3F1YA 1ST6A 1LL0A 3DE9A 3PCVA 3SXBA 2L9JA 3WAQA 4XQ1A 1LE2A 2EPLX 4AE4B 4X0RA 2VCAA 2V0HA 4IRQA 1MNEA 3AG2C 5B3SC 4M2BA 3ZWIA 3V0PA 4ASYA 4G7ZF 2EPNA 3FOPA 1EQ1A 3I0DA 3S27A 1JV1A 4ZDQA 5L0DA 3BCVA 1ZCUA 1VYIA 1ZIZA 4FRLA 2V0JA 4O79A 3KYIA 3B9QA 5DDTA 4U9DA 3JRTA 2GDCA 1ZYRF 2ICYA 3SZRA 2P7VA 3X2QC 5L0JA 5C3DA 1GX4A 4IWBA 1GWVA 3V8YA 2NG1A 4HFFB 1R7TA 5L0GA 2XRHA 3MYIA 1J8YF 2GWWA 2LK4A 1H7FA 2ZU9A 2VFZA 1JOGA 2RJ7A 3GM2A 2PP4A 1O23B 1M56C 1PD0A 1PCXA 5L0FA 3DD7A 2Y7AA 4NAKA 3AQBA 3U5SA 3E70C 3U3FA 1R5ID 3V91A 1UFBA 2CDQA 4C7OA 4J32B 3Q4SA 1G4US 1V54C 4AYJA 1FMVA 1ZDGA 4EE4A 2CW0F 4NTAA 2Q9BA 1ZJ0A 3AGUA 1NU9C 4DVYP 2XM0A 2YQCA 3QZCA 4DRHB 2A8WA 3V0LA 1JPNA 4ZLCA 2HMQA 2HKVA 4UEGA 1MNDA 1ZI3A 3NRHA 2YQJA 1FGXA 3OGZA 2YRFA 2DYSC 2KGOA 2AWCA 2VSHA 2IXPA 1TFOB 2KW3C 5CMGX 2PGYA 2RIZA 2PX3A 1NF5B 3TOMA 1WSZA 1FMWA 3G4ZA 4UDVA 1INIA 2Y4KA 3V0NA 4FQWA 3SX3A 2YLGA 4KQLA 3C62A 2Y3BA 2ZXPA 5AC5A 1FO9A 2I8BA 1TWHA 4JC7A 3IQTA 4QDLA 3R3IA 3TOLA 1G93A 1YVIA 1V84A 1EKYA 5C4FA 2XLEA 1HE9A 3UMKA 1LVKA 3USRA 4JE9A 3V5XA 5AC4A 3LAYA 4EEOA 1SF8A 2ZU7A 3ZLLA 4A2NB 4HO8A 1G1LA 2LP4A 4JIOA 2OJQA 1KWSA 4BPMA 5DVWA 5FTVA 3DI5A 3I0KA 3PKPA 2RJ1A 1GQCA 4PFOA 5K0IA 2M4EA 2OEGA 2FY7A 1NQIB 2WVKA 4E7SA 1M6TA 3ZGGA 3TD7A 5L0CA 4KC9A 4O6YA 3R2WA 1A41A 4W8PA 3I0LA 3S28A 3U0CA 1HM8A 1QLEC 3HJCA 3DK5A 4XWIA 1H4EA 5T3TA 1VPAA 4BEMJ 4XWJA 3I5PA 4OIQF 1INJA 2PBEA 3U2LA 1VM8A 3NMKA 3M4BA 4HO6A 1R7VA 4D0TA 2ZXRA 2FGYA 2X65A 3BRKX 3DM5A 1O7QA 3U0XA 1D1CA 1U6HA 2YC3A 4C3EA 3QW0A 3HLZA 3I4UA 2J9UA 1YJGA 1BBHA 2D7RA 1SZIA 3R7CA 2OG2A 5FTSA 1T6UA 3B29A 2CCYA 4O6NA 4BJ6A 2VS5A 1ZI5A 2WB7A 2CYDA 3K1IA 5FYEA 5GPGB 4B4MA 1G8XA 3LNRA 3OH0A 3FHDA 3SXCA 1I5NA 1XZ6A 1Z7Qc 2H7VC 2AM3A 3UGOA 2OJED 1MMAA 3KH2A 1VLTA 2GA0A 3US6A 1S7ZA 3BEHA 1TQGA 1Z63A 4CSAA 4M63A 4FWVA 2EIJC 5KYUA 1T6QA 5L0IA 1TR2A 1YDIA 3SXZA 3W8IA 4DOZA 1JYKA 5DQTA 4K1OA 4FCUA 2OU6A 4YT4A 3OC9A 4LDQA 4ZLDA 2AWYA 5KYYA 5C8RA 4P9FA 3ZVRA 3CKJA 3NYJA 1TWGA 3K8DA 1W2WA 3RMVA 3D8VA 4HE8D 1TFKB 2VH3A 4ASJA 2IOQA 4BJ1A
chains in the Genus database with same CATH topology
3K66A 5DQZA 4OD5A 3NYMA 1WGWA 4Y7VA 4CJCA 5KYXB 1MP3A 2R7XA 3E25A 2BO7A 3RFYA 3V8ZA 3CSKA 5DDVA 3EGXB 3E9VA 5C1HA 1BR2A 1OCZC 2OI7A 2A6EF 4HFKB 4YJWA 2R7RA 1H5RA 4D11A 2ICXA 1TZFA 3N9WA 2V3CC 2O9XA 5KYUB 4AYLA 3SNHA 1FOAA 4EE3A 2H7BA 4FX5A 1EZIA 3AG1C 2AESA 3V7OA 3RIPA 3SXDA 1SMYF 5BXCA 1H5SC 4Q5SF 2WE9A 2V0IA 3NDBB 5IFYA 2Y3GA 2OEFA 1LVWA 2WZLA 2J9WA 4HEAJ 3EE5A 4HO0A 5EJZA 3V0QA 2KJGA 3Q6NA 4B2WA 4D48A 1HJJA 5T1DB 3POLA 4PFPA 4JJGA 3U2XA 3TZTA 2EINC 2FYBA 5CMIA 1H5SD 2W0WA 4BJ6C 2VK9A 1YP3A 4FREA 1FRWA 1R81A 1J8MF 5C4DA 3FVYA 1ZHXA 3EHNA 1ZCTA 4Y7GA 2NUTA 1W77A 3U2TA 3L0IA 1JYLA 5C49A 3JYHA 3EFOA 5B1BC 3ECSA 2E8BA 4M2AA 5EIYA 3SX8A 2WZGA 4I3MA 2WEEA 1TW1A 3U2VA 1H3MA 3O6XA 2R7QA 3EHMA 4BJ5A 1H5RB 1TKNA 3ZG1A 3Q6MA 2V0KA 3FWWA 2IXNA 1H7LA 2X51A 4C3DA 3X1OA 2AECA 1HV9A 2VD4A 5CQPA 1ZDFA 5CI9A 1HM9A 1ZHYA 3GANA 3LESA 3T6BA 1H4CA 3SEOA 2A8UA 2FYAA 5E33A 4KNXA 4O7GA 4P02A 1MMDA 2DPWA 4PJMA 4BG0A 4CSAC 1H5TA 2AM5A 4B4BA 1QGQA 2MYSA 4EEGA 3PMRA 5C36A 3ABMC 2HV7A 3I5QA 5BUOA 1GX0A 1VZXA 4CS9A 1R7UA 2XSEA 3Q7UA 5D92A 1VOMA 2HV6A 4KC4A 5KYWA 1M2OA 4E1KA 2UX8A 3K8EA 4IRUA 3VYWA 2FYDB 1VGZA 1MMNA 4OIOF 2H7OA 4OIPF 2CGEA 2V0LA 2QY9A 3OEOA 4MIXA 1PZTA 1TWCA 3EFOB 4YS8A 3EGDA 1Z90A 4U5FE 1FO8A 4FIXA 1S4PA 1NU7D 2Y3DA 5IY5C 1E5KA 1G0RA 3B0UX 2W4BA 1GWWA 2J0AA 5C3BA 3EH1A 3W2VA 5L6SA 1KU2A 3NKEA 3N2ZB 3DUVA 5E3CA 4JISA 3DMDA 3IOJA 2KQ9A 2OCCC 5HSWA 1QGSA 3JSZA 1O0RA 2YQSA 1LL3A 2Q9AA 2Y69C 1HM0A 1LZ0A 3LJBA 3B0VC 2PX0A 4RD9A 4AE4A 2ZPAA 3W8HA 2XWLA 3S0XA 3D5NA 4CVHA 5IDTA 5CQLX 4BJTA 4D11C 3MLGA 5FCLA 3LS1A 2R7SA 1H5TB 3IOIA 3LEVA 5T3WA 5HS2A 5KYXA 4BQHA 3O3PA 2RIXA 5EHHA 3QVBA 4KT7A 4J30B 4E7ZA 2BO8A 3EGXA 4DE7A 5L6VA 2R7OA 4B6IA 1NWGB 2RJ6A 3ABLC 4K6RA 5FU8A 1FR9A 3LS0A 2RJ9A 2D5RB 2W4MA 1O5HA 4FRQA 1Z5ZA 4EVWA 1O7OA 3LLKA 1FXJA 4IJJA 1LZIA 2IXOA 2A6HF 2XMHA 4G0HA 4C7OB 1G97A 1VMAA 1Z3IX 4ANJA 4XWIA 4I1OB 3K1HA 2A68F 2QH5A 1LZ7A 2RIYA 2W0VA 4M28A 2Q4JA 2X60A 2C04A 4P00A 2YHSA 3USQA 3F1YA 2X5ZA 1ST6A 2EIKC 1ZCVA 1RJ9B 3EZHA 1LL0A 1PZYB 1D0XA 2AE7A 2GFHA 5C38A 3SXBA 2L9JA 3ABKC 3SPTA 2PGVA 3CKOA 3CKNA 4IRPA 2NUPA 4CJ8A 4AE4B 4X0RA 4D0TA 2V0HA 2ZU8A 4IRQA 1MNEA 1TVYA 1NMMB 2Y6PA 1Z23A 1FFHA 3AG2C 1H7HA 1VGTA 5B3SC 4M2BA 4KNVA 1WT1A 4HG6A 3V0PA 4ASYA 3KKBA 2YEVA 4LLEA 1NKHB 4G7ZF 2ZXWC 5B1AC 1QZXA 5E2QA 2E3DA 3GODA 4GEHA 2RJ8A 4B42A 4R7PA 4AX2A 3NKDA 3I0DA 3V0MA 3S27A 1JV1A 2JCJA 4ZDQA 2I5EA 3BCVA 1ZCUA 1VYIA 1ZJ1A 1ZIZA 4B3UA 4C2SA 1GA8A 4CS9C 3T7NA 4EE5A 4FRLA 4AAWA 2V0JA 1BR4A 5D91A 3O39A 4O79A 2WVLA 1LKXA 4QI0A 3DJ4A 3B9QA 3Q80A 4HCQA 5DDTA 3I0JA 3JRTA 5DS6A 2RJ4A 1M57C 5DS4A 2CU2A 1ZYRF 4XLNF 2APCA 3SP1A 4YT8A 2FFUA 2VS3A 5AJPA 5C4CA 4U5DE 1MC3A 4Q7CA 2ICYA 3V0OA 4MNDA 3SZRA 2RJ5A 2P7VA 2W45A 3X2QC 2WVMA 3I0EA 1H7TA 2NUPB 1ZU4A 5C3DA 1GX4A 4BEJA 4CJBA 3B0PA 1JPJA 3K1IC 4IWBA 1GWVA 3V8YA 4F4BA 1H7EA 3T4RA 2NG1A 4HFFB 2D0JA 4NAIA 2V26A 1ZU5A 2XRHA 4YT5A 1R7TA 2P73A 5CQMX 1J8YF 1H7FA 1YP4A 2ZU9A 2VFZA 3JUJA 1FZWA 3U0YA 3IOHA 4GYTA 4OD4A 4B2XA 4KNRA 4JURI 3NYLA 4AK9A 3ST8A 2RITA 2RJ7A 4J18A 2PP4A 1O23B 5CMFX 2WAWA 1M56C 1PD0A 3HTKC 1PCXA 3DJUB 1YROB 2WVNA 4O6MA 3M1CB 3RKOF 4FRAA 3DD7A 3EZIA 4LLCA 2R7TA 2Y4JA 2XMEA 2Y7AA 1ZJOA 4NANA 3ZGFA 4NAKA 2YCMA 3AQBA 2PFDA 3RMWA 2O1HA 2E87A 3ZIBA 4HOCA 1W55A 3E70C 2J0XA 3Q7LA 1TW5A 3D98A 2GGOA 4U5HA 3V91A 2OI6A 2C0NA 2R7UA 1HJLA 1FWYA 2CDQA 5CQOA 4C7OA 4J32B 4FRDA 1S4NA 4JW1A 4D0ZA 3Q4SA 4KBLA 3DJNB 2DYRC 1NG1A 3IEEA 2A69F 5C4BA 4PJJA 3RSBA 1V54C 4AYJA 3U2WA 1FMVA 2Z86A 3PKQA 1ZDGA 2J7PA 5DLJA 4Y62A 4EE4A 4FCUA 1RJ9A 4BMAA 2CW0F 5KYNA 3HL3A 5CMHA 5F5HA 4Q4ZF 1EYRA 4FESA 3SXAA 3ZLKA 2Q9BA 3UNGC 4AC3A 1ZJ0A 4DVYP 1NU9C 4EWCA 2JCKA 5CMJA 1ZJ3A 4L41C 2Q9CA 1ZI1A 2YQCA 3QZCA 1JVDA 1D0YA 2A8WA 3V0LA 1JPNA 2XWMA 3N0TA 4ZLCA 2DGJA 1G95A 3KIAA 3DAGA 2RJ0A 2YZSA 4KRVA 5C1GA 1FXOA 3DZAA 4JJFA 2Z15A 3JUKA 4UEGA 1MNDA 1ZI3A 2WZFA 3NRHA 2MZBA 4NALA 5JQQA 5C3AA 2YQJA 1FGXA 2YC5A 2G3KA 3OGZA 2AGDA 2DYSC 2KGOA 1VZTA 3I0IX 2VSHA 2IXPA 4CS7A 2CNWA 2XWNA 4Y64A 2KW3C 3ZC4A 3POVA 5CMGX 4MYBA 5C47A 2PGYA 4MQ9F 2RIZA 3L34A 2PX3A 1NF5B 3E26A 1WSZA 3V90A 2VSIA 3ASOC 1FR8A 3U2UA 1LS1A 2XXAA 1IW7F 2FFHA 3ZSUA 1FMWA 2NXVA 1NZEA 4KC1A 2VXLA 4G3QA 1INIA 3OH3A 2Y4KA 3T7OA 1V83A 5J49A 1ZCYA 4FRBA 4FRPA 1ZJPA 1NHEB 1FGGA 3V0NA 4FQWA 1IZMA 4G3SA 4DDZA 2L81A 4LERA 1MP5A 3OH4A 4KQLA 5FTVA 3EPVA 4W8KA 2Y3BA 3CZ6A 3K7DA 2ZXPA 3AG3C 2JD3A 4U5BE 4BJ5C 2VXMA 2IYLD 2YESA 1ZHWA 2J46A 1FO9A 3NGWA 3KMIA 2I8BA 1D1AA 1TWHA 5CQNX 4QDLA 5L3VA 3R3IA 1G93A 2D7IA 4HO4A 4OIRF 1LL2A 3K6BA 4RDAA 1ZHZA 1V84A 3EH2A 3CGXA 5C4FA 3UR3C 3EQLF 3UMKA 4ECMA 4G7OF 1LVKA 2P6VA 4Y7FA 4G7HF 2PF4E 3USRA 1WT0A 1G3LA 4EEAA 2VASA 4EEMA 1R82A 2W9YA 3JCUQ 3LAYA 1QWJA 4EEOA 3PHF2 2XXAB 1SF8A 1XHBA 3N24A 4XLPF 1MP4A 2ZU7A 1G9RA 1K4VA 3ZLLA 4A2NB 4QI2A 1O87A 1VYKA 2I7BA 4HO8A 4HO2A 2KNHA 3DAFA 4DECA 1ON6A 2EIMC 3GUEA 4DVZA 1G1LA 2AH9A 3ASNC 4HO5A 4M4KA 5EJ1A 1KWSA 3OH2A 4NY3A 5FU0A 4YWQA 5DVWA 1OKKA 1VGWA 4I1MA 3I0KA 5EGYA 3OKRA 3PKPA 4Y6UA 1D1BA 4EBBA 1LZJA 3SX3A 1N1CA 2RJ1A 1GQCA 4B5BA 4G87A 3JT1A 5KYYB 4JCHA 4PFOA 2QKXA 3SYNA 2J0WA 3WG7C 4DBQA 4G3PA 2J7PD 3DM9B 2GGQA 3UMIA 5IDSA 1IIMA 3I0HA 2M4EA 2FYCB 2OEGA 4JD0A 2FY7A 2JCLA 4OINF 1NQIB 1G23A 2WVKA 4LW6A 4HO9A 4E7SA 1G2VA 3ZGGA 2LSEA 3LLIA 3TD7A 4CS8A 1M2VA 4YN0B 2FFVA 3SXGA 3H65A 4KC9A 4O6YA 1FG5N 1S4OA 2I5KA 1OQMB 3I0LA 3R2WA 3S28A 3MX3A 1HM8A 2QTVA 1QLEC 3K33A 2G3VA 4KPZA 2WGZA 4KXOA 4Y7UA 3HJCA 3DK5A 3UGPA 1ZHTA 3OC9A 1H4EA 5T3TA 1VPAA 4PJNA 5F5FA 2Y4LA 4XWJA 2J45A 3I5PA 4OIQF 1VH1A 3NG1A 2BO4A 3SXEA 3I0CA 2B0JA 5I1FA 1PD1A 5C48A 4IAOA 4RBNA 1QG8A 1INJA 4FROA 4N06A 4LW3A 3PNNA 3F46A 4JVSA 2PA4A 3EG9A 4HO3A 2A1DD 1VM8A 3OH1A 4XTKA 4KPXA 4I44A 1VGUA 4HO6A 4U5CE 1R7VA 2Z87A 3I0FA 5AJOA 2CNWD 4FRHA 1VH3A 2ZXRA 2J9VA 3CKQA 2FGYA 3UMHA 3W2WA 5DS5A 1JV3A 2WVOA 1VICA 2X65A 3F47A 3BRKX 3T7MA 3SX7A 2Y3HA 3DM5A 1O7QA 4ARWA 4CBEA 3U0XA 5CI8A 1D1CA 2P72A 3FOQA 1TWAA 2YC3A 3OAMA 4C3EA 3FDQA 1H5SA 4B4GA 1OCCC 2ZXOA 3HLZA 2XL4A 3I4UA 2J9UA 1D0ZA 3KL4A 1WT2A 4FCEA 1Z6AA 2D7RA 2BO6A 3AQCA 1SZIA 1FTSA 3CQZA 1M2VB 4ULWA 2OG2A 2X5SA 2NUTB 3RH3A 5FTSA 4PK4A 3FAJA 4K0DA 4U5EE 4YT2A 1YP2A 4FRMA 3LW6A 4GBPA 1GQ9A 4O6NA 4BJ6A 4Y9XA 2VS5A 5C4EA 4U5GA 1ZI5A 4Y6NA 2PX7A 2WB7A 4CIHA 2O1GA 3ITFA 4C3BA 2R7VA 1I52A 1H7QA 4K7BA 1MMGA 3VAYA 1ZJ2A 3I0GA 5FYEA 2P6WA 2C03A 3F1CA 3EG9B 1R7XA 4B4MA 2YQHA 1G8XA 3JTJA 3LNRA 1OMZA 3OH0A 3FHDA 3SXCA 2J0BA 1XZ6A 3DXJF 3RYLA 1ZI4A 3TQDA 3CKVA 2H7VC 4WJ0A 2AM3A 5AJNA 3WODF 3UGOA 1WT3A 1MMAA 4KI2A 1VK5A 3KH2A 2VB6A 3EJNA 3QMKA 1SS9A 4JZAA 1ZHJA 1H5SB 1JVGA 1S7ZA 1WVCA 5KYWB 1ON8A 2Q3TA 3T6JA 4FIYA 3SX5A 1Z63A 4CSAA 2EILC 4FWVA 2EIJC 4M63A 5KYUA 1TR2A 3Q7GA 2Y39A 3ZF8A 5C1LA 1IINA 3W8IA 1V82A 2JCOA 4DOZA 4DBRA 4KNWA 1OCOC 1JYKA 5DQTA 4PJLA 1OCRC 2BE5F 4YT4A 4P6IC 1R7YA 3EGDB 4LACB 1OKKD 1BR1A 1G8OA 1VZUA 2Y4MA 4ZLDA 2QGIA 3CU0A 2R7WA 3OWTA 4KC2A 5KYYA 4Y7TA 5C8RA 4CS8C 1FFTC 2AM4A 4Y63A 3ZVRA 1OMXA 3AG4C 5L3QA 2G62A 2WL8A 3OA1A 1R80A 1W57A 2VS4A 3CKJA 1V55C 3NYJA 2O1FA 5E3AA 2MWQA 1TWGA 3K8DA 1H7GA 1W2WA 2OI5A 5FV9A 3RMVA 5FUHA 3D8VA 2IXMA 4HE8D 4H4KC 3S29A 2VH3A 4ASJA 2IOQA 2WVQA 1H4DA 4BJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D91 A;  4O6M A;  4O6N A;  4Q7C A;  4MND A;  5D92 A; 
#chains in the Genus database with same CATH topology
 4OD5 A;  5A69 A;  4AL1 A;  4Y7V A;  4CJC A;  2BO7 A;  3CSK A;  5C1H A;  4D11 A;  2V3C C;  5KYU B;  4A4A A;  5A6A A;  5EK0 A;  1EZI A;  1OXK A;  2AES A;  1SMY F;  5BXC A;  3GWL A;  5A6K A;  2WE9 A;  3NDB B;  2YWA A;  2UUI A;  5EJZ A;  3EE5 A;  3V0Q A;  2KJG A;  4D48 A;  1HJJ A;  1H9T A;  4PFP A;  2A0U A;  2W0W A;  4BJ6 C;  1YP3 A;  1R81 A;  3EHN A;  4Y7G A;  3VF0 A;  3L0I A;  5C49 A;  3JTL O;  3O6X A;  3A11 A;  3EHM A;  4BJ5 A;  3NMJ A;  3ZG1 A;  2IXN A;  2X51 A;  3X1O A;  1GM5 A;  5CQP A;  1ZDF A;  3HNJ A;  1H4C A;  2A8U A;  3V5Y A;  1MMD A;  1C03 A;  2IBF A;  4BG0 A;  4CSA C;  4B4B A;  2HUJ A;  4XEF A;  3ABM C;  2HV7 A;  1GX0 A;  1YA7 O;  1VZX A;  3L1M A;  4IAR A;  4J7Y A;  4E1K A;  2LCH A;  2UX8 A;  2FYD B;  4OIO F;  2CGE A;  3EGD A;  2X0C A;  1Z90 A;  1S4P A;  2Y3D A;  2IM8 A;  3B0U X;  2OCC C;  3JSZ A;  2YQS A;  4RD9 A;  2ZPA A;  3W8H A;  5IDT A;  4D11 C;  4BJT A;  1JAF A;  5A6J A;  4MVM A;  3LEV A;  3O3P A;  1ORS C;  2BO8 A;  2EPM X;  5FU8 A;  1O5H A;  3DWW A;  4FRQ A;  2QLA A;  2L6G A;  1LZI A;  2A6H F;  2W0V A;  2RIY A;  2A68 F;  4M28 A;  2Q4J A;  2C04 A;  2J8W A;  2YHS A;  3O55 A;  1RJ9 B;  2GFH A;  5C38 A;  3CKN A;  4IRP A;  2NUP A;  3ZTM A;  3KYJ A;  3HNL A;  5JSL A;  1NMM B;  1Z23 A;  2YEV A;  4LLE A;  3QVY A;  1DOW A;  2VCB A;  2E3D A;  4EBK A;  3V0M A;  2JCJ A;  2I5E A;  1ZJ1 A;  4B3U A;  1GA8 A;  3T7N A;  1V4A A;  1LKX A;  2XL6 A;  4HCQ A;  4JTA B;  5DS6 A;  5DS4 A;  1CGM E;  2FAP B;  5C4C A;  1MC3 A;  2RJ5 A;  3TJ6 A;  2NUP B;  1ZU4 A;  4BEJ A;  1JPJ A;  3T4R A;  5COG A;  1YP4 A;  3JUJ A;  3U0Y A;  4GYT A;  1B68 A;  4KNR A;  3ST8 A;  3NYL A;  3FXH A;  4AK9 A;  1RKC A;  1YRO B;  1S05 A;  3DJU B;  4FRA A;  3EZI A;  3RMW A;  2O1H A;  4HOC A;  1W55 A;  3Q7L A;  1TW5 A;  4EKW A;  2C0N A;  2R7U A;  1FWY A;  3R2P A;  4YL1 A;  5CQO A;  1S4N A;  4D0Z A;  3IEE A;  2A69 F;  3RF3 A;  4PJJ A;  3U2W A;  4Y62 A;  5KYN A;  3HL3 A;  4CJG A;  4FES A;  1EYR A;  3SXA A;  4AC3 A;  4MVR A;  1JVD A;  2XWM A;  1AVO B;  1G95 A;  2DGJ A;  3DAG A;  2RJ0 A;  2YZS A;  4KRV A;  1VB5 A;  3DZA A;  4NAL A;  1E86 A;  5C3A A;  2EPO A;  2G3K A;  1VZT A;  4N6C A;  4Y64 A;  3V90 A;  1RXQ A;  2RD9 A;  3ASO C;  1FR8 A;  3QTH A;  1LS1 A;  2FFH A;  3ZSU A;  4KC1 A;  1NZE A;  2VXL A;  4G3Q A;  3T7O A;  4MVQ A;  5J49 A;  2ICW G;  1FGG A;  1IZM A;  3U3B A;  4U5B E;  3AG3 C;  3TQO A;  3G50 A;  3FMS A;  1VTM P;  1LPE A;  1LIH A;  3K6B A;  4RDA A;  3CGX A;  3EQL F;  1OR3 A;  4ECM A;  4XPY A;  1T5O A;  4XPW A;  2P6V A;  4Y7F A;  1G3L A;  2VAS A;  1MP4 A;  1K4V A;  1LM3 B;  2LIG A;  1VYK A;  2QNL A;  2KNH A;  3DAF A;  2EIM C;  2YL3 A;  4DVZ A;  3KPH A;  4M4K A;  5EJ1 A;  2R25 A;  4YWQ A;  4Y6U A;  3OKR A;  4EBB A;  2I15 A;  4G3P A;  2J7P D;  2GGQ A;  3UMI A;  2FYC B;  4Z9H A;  4JD0 A;  4OIN F;  1G23 A;  4LW6 A;  3SXG A;  4YN0 B;  3VRC A;  3H65 A;  4FCE A;  1S4O A;  1OQM B;  3MX3 A;  3K33 A;  2G3V A;  4PR9 A;  4Y7U A;  3UGP A;  4EHP A;  2UUH A;  1VH1 A;  2BO4 A;  3I0C A;  1PD1 A;  4N06 A;  3F46 A;  2PA4 A;  3EG9 A;  4KPX A;  4I44 A;  1VGU A;  4D4N A;  2Z87 A;  2CNW D;  1VH3 A;  2J9V A;  5DS5 A;  2Y3H A;  4D4X A;  4ARW A;  4CBE A;  5CI8 A;  3FOQ A;  3M79 A;  5COF A;  3JYY A;  2KYH A;  3HKK A;  3KL4 A;  3C7J A;  3AQC A;  3RH3 A;  2MHR A;  2NUT B;  2J9B A;  4U5E E;  3SXK A;  2LFD A;  3LW6 A;  1GQ9 A;  1K05 A;  4Y6N A;  2PX7 A;  3ITF A;  4C3B A;  2BC5 A;  3VAY A;  1MQV A;  3F1C A;  3EG9 B;  1OMZ A;  2J0B A;  3DXJ F;  3RYL A;  4WJ0 A;  4CJO A;  3EJN A;  3QMK A;  1SS9 A;  4E17 A;  1G4W R;  2Q3T A;  3NMI A;  4FIY A;  3SX5 A;  3Q7G A;  1XZQ A;  1IIN A;  2JCO A;  1OCO C;  1ORY A;  1H7I A;  1NBB A;  1OCR C;  4P6I C;  1OKK D;  1BR1 A;  3C8G D;  4KC2 A;  1FFT C;  4Y63 A;  3AG4 C;  1R80 A;  1W57 A;  2MWQ A;  1G5Z A;  1NFO A;  3DE8 A;  4EEG A;  3NYM A;  1QSP A;  1MP3 A;  3E25 A;  3RFY A;  1ZZP A;  3E9V A;  1BR2 A;  3GEE A;  1H5R A;  3U9J A;  2ICX A;  1TZF A;  2O9X A;  1C17 M;  1FOA A;  2XL8 A;  4FX5 A;  3RIP A;  3SXD A;  5JLI A;  1PV3 A;  3TJ5 A;  5IFY A;  5AGF A;  2J9W A;  4B2W A;  2YL0 A;  2LQG A;  2P0N A;  3MYF A;  2HFI A;  1QQ3 A;  3U2X A;  3TZT A;  2EIN C;  2FYB A;  1H5S D;  1J8M F;  3GOR A;  3FVY A;  1ZHX A;  1W77 A;  3U2T A;  4AL0 A;  1JYL A;  4XEV A;  3EFO A;  1ZW3 A;  1ORJ A;  3ECS A;  2E8B A;  5EIY A;  1H5R B;  3GEH A;  3Q6M A;  1LS4 A;  1H7L A;  2AEC A;  4DRJ B;  3SEO A;  4P02 A;  4O7G A;  4PJM A;  2AM5 A;  3IPM O;  5C36 A;  1AEP A;  1Y6D A;  4CS9 A;  2XSE A;  3Q7U A;  1T6I A;  2HV6 A;  4CX9 A;  1Q0M A;  4IRU A;  3L8J A;  2F22 A;  2H7O A;  2AP3 A;  4OIP F;  2V0L A;  3OEO A;  1PZT A;  3EFO B;  5A6B D;  4YS8 A;  4U5F E;  1NU7 D;  1G0R A;  1GWW A;  1BDJ B;  3EH1 A;  3DUV A;  5E3C A;  5CIV A;  3DMD A;  3IOJ A;  1QGS A;  3J06 A;  3FOO A;  3D5N A;  3A9C A;  1K40 A;  1CPQ A;  5FCL A;  4R32 A;  1E83 A;  5HS2 A;  4BQH A;  2RIX A;  3QVB A;  1ZVZ A;  3ZDL A;  2R7O A;  1NWG B;  3ABL C;  4K6R A;  2D5R B;  2W4M A;  1Z5Z A;  4EVW A;  3LLK A;  2YKZ A;  4ANJ A;  4I1O B;  1OW8 A;  1HMO A;  2ZD9 A;  2QE9 A;  2OOC A;  2EIK C;  2AE7 A;  1D0X A;  1I4Y A;  2PGV A;  3CKO A;  5L0H A;  1TVY A;  1VGT A;  1H7H A;  1LI5 A;  4KNV A;  1WT1 A;  4HG6 A;  3KKB A;  1NKH B;  2ZXW C;  1QZX A;  3GOD A;  4GEH A;  4B42 A;  3RQE A;  4R7P A;  3NKD A;  2XS8 A;  4MVO A;  1A0B A;  3TUL A;  4EE5 A;  4CS9 C;  1YZA A;  1GS9 A;  1OQC A;  1F1M A;  1BR4 A;  3O39 A;  4JTC B;  3U8P A;  4QI0 A;  5FZT A;  3I0J A;  1Q0D A;  2RJ4 A;  1M57 C;  2CU2 A;  2APC A;  4YT8 A;  5AJP A;  5COM A;  1U0B B;  4U5D E;  2JPU A;  4Q7C A;  3V0O A;  4MND A;  3I0E A;  1H7T A;  4CJB A;  1WWP A;  3K1I C;  2D0J A;  4NAI A;  1ZU5 A;  5CQM X;  2P73 A;  2D4U A;  3IOH A;  2RIT A;  1LI7 A;  4O6M A;  3RKO F;  3T9O A;  3SXM A;  4JCZ A;  2R7T A;  2AU5 A;  3ZGF A;  2YCM A;  2PFD A;  3GM1 A;  2E87 A;  2J0X A;  4U5H A;  2OI6 A;  2TMV P;  1HJL A;  4FRD A;  1Q0G A;  1YAR O;  3DJN B;  4DRI B;  1NG1 A;  3C8G B;  2A0B A;  3RSB A;  2Z86 A;  1HW2 A;  5DLJ A;  1UG7 A;  1RJ9 A;  4BMA A;  1YZC A;  5CMH A;  4Q4Z F;  3ZLK A;  3UNG C;  2JCK A;  5CMJ A;  2Q9C A;  1VLS A;  3KIA A;  2L6F A;  5C1G A;  3U9M A;  3JUK A;  2WZF A;  3QVZ A;  2YQY A;  2AGD A;  3I0I X;  4CS7 A;  2XWN A;  3ZC4 A;  3POV A;  5C47 A;  1GQA A;  3L34 A;  2HZ8 A;  3U2U A;  1IW7 F;  4Z9J A;  2P1A A;  3AGT A;  1NHE B;  4WAB A;  5JUA A;  2BL2 A;  4G3S A;  4DDZ A;  4LER A;  3ZQY A;  4W8K A;  3K7D A;  4BJ5 C;  4MTF A;  1ZHW A;  3S84 A;  3KMI A;  1D1A A;  1H9G A;  3CAX A;  1I4Z A;  4YL3 A;  3M4C A;  2D7I A;  4HO4 A;  4OIR F;  3EH2 A;  1WT0 A;  4YL0 A;  2W9Y A;  3JCU Q;  3N24 A;  4XLP F;  1G9R A;  1OR2 A;  4HO2 A;  4DEC A;  3TK0 A;  4EIY A;  3C18 A;  4HO5 A;  3OH2 A;  3SXY A;  1RCP A;  4CIP A;  2XLO A;  4I1M A;  1D1B A;  2HJ3 A;  1LZJ A;  1N1C A;  2QUP A;  2R9R B;  4MS2 A;  4G87 A;  3JT1 A;  4B5B A;  4JCH A;  2QKX A;  3WG7 C;  3DM9 B;  3BRJ A;  2R02 A;  2DB4 A;  2R05 A;  3I0H A;  1G2V A;  3LLI A;  1M2V A;  2FFV A;  2YVK A;  4KPZ A;  2WGZ A;  4B4G A;  4PJN A;  3NG1 A;  3SXE A;  4IAO A;  3H2V A;  1QG8 A;  3HNI A;  4FRO A;  4LW3 A;  4JVS A;  4XTK A;  4EBJ A;  1YYX A;  1EA8 A;  5AJO A;  3HNK A;  4FRH A;  3UMH A;  1VIC A;  3T7M A;  3SX7 A;  1E2X A;  2P72 A;  3OAM A;  3FDQ A;  4JKV A;  1D0Z A;  2YL1 A;  2NSF A;  1WT2 A;  4ULW A;  1FTS A;  2XLW A;  1M2V B;  4GQH A;  2X5S A;  4PK4 A;  3GEI A;  3FAJ A;  3W4Y A;  4YT2 A;  1YP2 A;  2LFF A;  4GBP A;  1YYJ A;  4U5G A;  2AVK A;  4CIH A;  1Q0K A;  1H7Q A;  4K7B A;  1MMG A;  3I0G A;  2P6W A;  2C03 A;  2JX0 A;  3AOU A;  1JRA A;  1LE4 A;  1V74 B;  5AJN A;  3WOD F;  1VK5 A;  1KTM A;  4H54 A;  4JZA A;  1ZHJ A;  1JVG A;  5KYW B;  3T6J A;  2EIL C;  3U2M A;  4FAP B;  2Y39 A;  1V82 A;  4DBR A;  3U8V A;  1HE1 A;  1VZU A;  2Y4M A;  2AM4 A;  2G62 A;  1V55 C;  2O1F A;  5E3A A;  2IXM A;  3K66 A;  5DQZ A;  1WGW A;  5KYX B;  4DJ9 A;  1YA9 A;  2VCC A;  3V8Z A;  3EGX B;  2A6E F;  4HFK B;  2R7R A;  1WAT A;  3N9W A;  4P9T A;  3JRM O;  4Q5S F;  4HO0 A;  4HEA J;  1Q0F A;  1T01 A;  5JT4 A;  1E84 A;  3S9O A;  3POL A;  4JJG A;  1NLX A;  2OEX A;  1FRW A;  3WHN A;  2NUT A;  5B1B C;  1HW1 A;  3SX8 A;  2WEE A;  3U2V A;  1YAU O;  3FWW A;  4C3D A;  1HV9 A;  2VD4 A;  3ZQV A;  3C8Z A;  1C02 A;  2R03 A;  5JS5 A;  3T6B A;  3O10 A;  2FYA A;  4KNX A;  2DPW A;  2NPU A;  3H2U A;  3VM6 A;  2MYS A;  4MVZ A;  5BUO A;  3IHU A;  1VOM A;  1M2O A;  1A7V A;  3VYW A;  1VGZ A;  1OW6 A;  2Q7R A;  2QY9 A;  1TWC A;  1WOL A;  1FO8 A;  5IY5 C;  1CGO A;  5L6S A;  2W4B A;  2J0A A;  5C3B A;  3L8I A;  3W2V A;  1KU2 A;  4JIS A;  2KQ9 A;  1O0R A;  1LL3 A;  2Q9A A;  2Y69 C;  3LJB A;  3B0V C;  3ATP A;  2XWL A;  2XLH A;  3S0X A;  4N4W A;  4ER9 A;  3LS1 A;  5T3W A;  4KT7 A;  4J30 B;  4E7Z A;  4DE7 A;  5L6V A;  1FAP B;  4B6I A;  2H8A A;  2RJ6 A;  1XZP A;  1O7O A;  1FXJ A;  2IXO A;  4C7O B;  1G97 A;  1CPR A;  1HMD A;  2QH5 A;  4JRZ A;  1LZ7 A;  2X60 A;  4P00 A;  3USQ A;  2X5Z A;  1ZCV A;  3EZH A;  1PZY B;  3ABK C;  3SPT A;  4CJ8 A;  1SYQ A;  2ZU8 A;  2Y6P A;  1FFH A;  1YLM A;  5B1A C;  3RVZ A;  3RQG A;  5E2Q A;  2RJ8 A;  5B3I A;  2XLM A;  4AX2 A;  4XPX A;  4CDY A;  4EUK B;  4C2S A;  2OQM A;  1XWJ A;  4AAW A;  5D91 A;  4XEK A;  3GM3 A;  2WVL A;  2HSB A;  3DJ4 A;  3Q80 A;  1FNT c;  4N6H A;  4XLN F;  1KNY A;  3SP1 A;  2FFU A;  2VS3 A;  2WVM A;  3S90 A;  2W45 A;  1U89 A;  5TJ5 E;  2YL7 A;  3B0P A;  256B A;  4F4B A;  1H7E A;  2V26 A;  4YT5 A;  2YLI A;  1FZW A;  4OD4 A;  4B2X A;  4JUR I;  4J18 A;  5CMF X;  4DXW A;  2WAW A;  3HTK C;  2WVN A;  3M1C B;  1RMV A;  4LLC A;  1WAS A;  1JR8 A;  2Y4J A;  2XME A;  1ZJO A;  4NAN A;  3ZIB A;  3D98 A;  2GGO A;  4WGZ A;  3LNM B;  4JW1 A;  2HSQ A;  4KBL A;  2DYR C;  3QW1 A;  4U9E A;  5C4B A;  3PKQ A;  2XLV A;  2J7P A;  3T6G B;  3RVY A;  5F5H A;  1QVX A;  4EWC A;  1ZJ3 A;  4L41 C;  1ZI1 A;  5BQI A;  1D0Y A;  3N0T A;  3M15 A;  1FXO A;  4JJF A;  2Z15 A;  3GWN A;  2MZB A;  5JQQ A;  2YC5 A;  2CNW A;  4NTF A;  4MYB A;  5BQH A;  4MQ9 F;  2ETS A;  3E26 A;  4YK5 A;  2VSI A;  2XLD A;  2XXA A;  2NXV A;  3JSE O;  3OH3 A;  1V83 A;  1ZCY A;  4FRP A;  1ZJP A;  3IQC A;  4L6R A;  2L81 A;  1MP5 A;  3OH4 A;  3EPV A;  3CZ6 A;  2VXM A;  4ULV A;  2JD3 A;  2IYL D;  2YES A;  2J46 A;  3NGW A;  1OXB A;  3FAP B;  5CQN X;  5L3V A;  1T9K A;  2M64 A;  2KK1 A;  2ASR A;  1LL2 A;  1ZHZ A;  3DKA A;  3V5Z A;  1L3P A;  3UR3 C;  4G7O F;  1SR2 A;  4G7H F;  2PF4 E;  4EEA A;  4EEM A;  4G78 A;  1R82 A;  1Y4C A;  1QWJ A;  4MW8 A;  3PHF 2;  2XXA B;  1XHB A;  2YLD A;  4QI2 A;  4J7T A;  1O87 A;  2I7B A;  1ON6 A;  3GUE A;  2AH9 A;  3ASN C;  2P61 A;  1EI7 A;  4Z9I A;  4NY3 A;  5FU0 A;  1R4T A;  1OKK A;  1VGW A;  5EGY A;  3C8G A;  1L7C A;  3ZTZ A;  5KYY B;  3SYN A;  2J0W A;  4DBQ A;  1FR0 A;  3AJM A;  3PDM P;  5IDS A;  1IIM A;  1GGQ A;  4LDR A;  2JCL A;  4HO9 A;  2LSE A;  4CS8 A;  3JZ0 A;  1FG5 N;  2I5K A;  2PNO A;  1BZ4 A;  5F28 E;  1APC A;  2EPK X;  2QTV A;  1AUE A;  4KXO A;  4NQF A;  1ZHT A;  2Y4L A;  1ZW2 A;  5F5F A;  2J45 A;  1K04 A;  2L7A A;  2B0J A;  4IB4 A;  5I1F A;  5C48 A;  4RBN A;  3PNN A;  4E0H A;  4HO3 A;  2A1D D;  3OH1 A;  1H6G A;  2RSE B;  4U5C E;  3I0F A;  3RW0 A;  3LEO A;  3CKQ A;  3W2W A;  1JV3 A;  2WVO A;  3F47 A;  5JP7 A;  2OKU A;  1TWA A;  1A7E A;  1H5S A;  1OCC C;  2ZXO A;  2XL4 A;  1Z6A A;  4JEB A;  4CDA A;  1CGN A;  2BO6 A;  3CQZ A;  4PAC A;  4ONS A;  2DI3 A;  4K0D A;  4FRM A;  4Y9X A;  5C4E A;  2O1G A;  2R7V A;  1I52 A;  4E18 A;  1ZJ2 A;  4IAQ A;  2HS5 A;  4NTB A;  1R7X A;  3IQ5 A;  2YQH A;  3JTJ A;  4JTD B;  3TQD A;  4CDV A;  1ZI4 A;  3CKV A;  1JMW A;  1NSG B;  4MW3 A;  1WT3 A;  2LD6 A;  4KI2 A;  5HV9 A;  2VB6 A;  1H5S B;  1WVC A;  3G4X A;  1ON8 A;  3ZF8 A;  3MBG A;  5C1L A;  5JRA A;  4KNW A;  4NC3 A;  5A6B A;  4PJL A;  1R7Y A;  2BE5 F;  4FRB A;  3EGD B;  4LAC B;  1G8O A;  2QGI A;  3CU0 A;  3IQ6 A;  2R7W A;  3OWT A;  4Y7T A;  1A7D A;  4CS8 C;  4MTO A;  2OEV A;  1OMX A;  5L3Q A;  2WL8 A;  3OA1 A;  2VS4 A;  2VC9 A;  1H7G A;  2OI5 A;  5FV9 A;  5FUH A;  4H4K C;  2L6H A;  3S29 A;  2WVQ A;  1H4D A;  2KC3 A;  2R7X A;  5DDV A;  1OCZ C;  2OI7 A;  4YJW A;  4AYL A;  3SNH A;  3LUT B;  4EE3 A;  2H7B A;  3AG1 C;  4MTG A;  3V7O A;  1H5S C;  2V0I A;  4WGY A;  2Y3G A;  2OEF A;  1LVW A;  2WZL A;  2B0H A;  1OW7 A;  2HMZ A;  3Q6N A;  1WN0 A;  5T1D B;  1O3U A;  1NFN A;  4NCQ A;  5CMI A;  5JVE A;  2VK9 A;  4FRE A;  2Q00 A;  5C4D A;  4IGG A;  1ZCT A;  2Q4F A;  3JYH A;  4M2A A;  1WTY A;  2WZG A;  2XS1 A;  4I3M A;  2HJM A;  1TW1 A;  1QKR A;  1H3M A;  2R7Q A;  1TKN A;  2V0K A;  5CI9 A;  1HM9 A;  1ZHY A;  3GAN A;  3LES A;  5E33 A;  1H5T A;  1QGQ A;  3PMR A;  3I5Q A;  1R7U A;  5D92 A;  4KC4 A;  2XM4 A;  4MVS A;  5KYW A;  1RKE A;  3K8E A;  1MMN A;  4JEA A;  4MIX A;  1DOV A;  4FIX A;  1E5K A;  2GAQ A;  5BQG A;  3NKE A;  3N2Z B;  1HY5 A;  2KSF A;  5HSW A;  1HM0 A;  1LZ0 A;  2PX0 A;  4AE4 A;  1E85 A;  4CVH A;  5CQL X;  3C63 A;  3MLG A;  2R7S A;  3CEX A;  1H5T B;  3IOI A;  5KYX A;  5EHH A;  1QPU A;  3EGX A;  4LDK A;  3B71 A;  1RKE B;  1FR9 A;  3LS0 A;  2RJ9 A;  3MFN A;  4IJJ A;  2XMH A;  4G0H A;  4MVU A;  1VMA A;  1Z3I X;  3K1H A;  3RQF A;  4E0I A;  2NSG A;  3F1Y A;  1ST6 A;  1LL0 A;  3DE9 A;  3PCV A;  3SXB A;  2L9J A;  3WAQ A;  4XQ1 A;  1LE2 A;  2EPL X;  4AE4 B;  4X0R A;  2VCA A;  2V0H A;  4IRQ A;  1MNE A;  3AG2 C;  5B3S C;  4M2B A;  3ZWI A;  3V0P A;  4ASY A;  4G7Z F;  2EPN A;  3FOP A;  1EQ1 A;  3I0D A;  3S27 A;  1JV1 A;  4ZDQ A;  5L0D A;  3BCV A;  1ZCU A;  1VYI A;  1ZIZ A;  4FRL A;  2V0J A;  4O79 A;  3KYI A;  3B9Q A;  5DDT A;  4U9D A;  3JRT A;  2GDC A;  1ZYR F;  2ICY A;  3SZR A;  2P7V A;  3X2Q C;  5L0J A;  5C3D A;  1GX4 A;  4IWB A;  1GWV A;  3V8Y A;  2NG1 A;  4HFF B;  1R7T A;  5L0G A;  2XRH A;  3MYI A;  1J8Y F;  2GWW A;  2LK4 A;  1H7F A;  2ZU9 A;  2VFZ A;  1JOG A;  2RJ7 A;  3GM2 A;  2PP4 A;  1O23 B;  1M56 C;  1PD0 A;  1PCX A;  5L0F A;  3DD7 A;  2Y7A A;  4NAK A;  3AQB A;  3U5S A;  3E70 C;  3U3F A;  1R5I D;  3V91 A;  1UFB A;  2CDQ A;  4C7O A;  4J32 B;  3Q4S A;  1G4U S;  1V54 C;  4AYJ A;  1FMV A;  1ZDG A;  4EE4 A;  2CW0 F;  4NTA A;  2Q9B A;  1ZJ0 A;  3AGU A;  1NU9 C;  4DVY P;  2XM0 A;  2YQC A;  3QZC A;  4DRH B;  2A8W A;  3V0L A;  1JPN A;  4ZLC A;  2HMQ A;  2HKV A;  4UEG A;  1MND A;  1ZI3 A;  3NRH A;  2YQJ A;  1FGX A;  3OGZ A;  2YRF A;  2DYS C;  2KGO A;  2AWC A;  2VSH A;  2IXP A;  1TFO B;  2KW3 C;  5CMG X;  2PGY A;  2RIZ A;  2PX3 A;  1NF5 B;  3TOM A;  1WSZ A;  1FMW A;  3G4Z A;  4UDV A;  1INI A;  2Y4K A;  3V0N A;  4FQW A;  3SX3 A;  2YLG A;  4KQL A;  3C62 A;  2Y3B A;  2ZXP A;  5AC5 A;  1FO9 A;  2I8B A;  1TWH A;  4JC7 A;  3IQT A;  4QDL A;  3R3I A;  3TOL A;  1G93 A;  1YVI A;  1V84 A;  1EKY A;  5C4F A;  2XLE A;  1HE9 A;  3UMK A;  1LVK A;  3USR A;  4JE9 A;  3V5X A;  5AC4 A;  3LAY A;  4EEO A;  1SF8 A;  2ZU7 A;  3ZLL A;  4A2N B;  4HO8 A;  1G1L A;  2LP4 A;  4JIO A;  2OJQ A;  1KWS A;  4BPM A;  5DVW A;  5FTV A;  3DI5 A;  3I0K A;  3PKP A;  2RJ1 A;  1GQC A;  4PFO A;  5K0I A;  2M4E A;  2OEG A;  2FY7 A;  1NQI B;  2WVK A;  4E7S A;  1M6T A;  3ZGG A;  3TD7 A;  5L0C A;  4KC9 A;  4O6Y A;  3R2W A;  1A41 A;  4W8P A;  3I0L A;  3S28 A;  3U0C A;  1HM8 A;  1QLE C;  3HJC A;  3DK5 A;  4XWI A;  1H4E A;  5T3T A;  1VPA A;  4BEM J;  4XWJ A;  3I5P A;  4OIQ F;  1INJ A;  2PBE A;  3U2L A;  1VM8 A;  3NMK A;  3M4B A;  4HO6 A;  1R7V A;  4D0T A;  2ZXR A;  2FGY A;  2X65 A;  3BRK X;  3DM5 A;  1O7Q A;  3U0X A;  1D1C A;  1U6H A;  2YC3 A;  4C3E A;  3QW0 A;  3HLZ A;  3I4U A;  2J9U A;  1YJG A;  1BBH A;  2D7R A;  1SZI A;  3R7C A;  2OG2 A;  5FTS A;  1T6U A;  3B29 A;  2CCY A;  4O6N A;  4BJ6 A;  2VS5 A;  1ZI5 A;  2WB7 A;  2CYD A;  3K1I A;  5FYE A;  5GPG B;  4B4M A;  1G8X A;  3LNR A;  3OH0 A;  3FHD A;  3SXC A;  1I5N A;  1XZ6 A;  1Z7Q c;  2H7V C;  2AM3 A;  3UGO A;  2OJE D;  1MMA A;  3KH2 A;  1VLT A;  2GA0 A;  3US6 A;  1S7Z A;  3BEH A;  1TQG A;  1Z63 A;  4CSA A;  4M63 A;  4FWV A;  2EIJ C;  5KYU A;  1T6Q A;  5L0I A;  1TR2 A;  1YDI A;  3SXZ A;  3W8I A;  4DOZ A;  1JYK A;  5DQT A;  4K1O A;  4FCU A;  2OU6 A;  4YT4 A;  3OC9 A;  4LDQ A;  4ZLD A;  2AWY A;  5KYY A;  5C8R A;  4P9F A;  3ZVR A;  3CKJ A;  3NYJ A;  1TWG A;  3K8D A;  1W2W A;  3RMV A;  3D8V A;  4HE8 D;  1TFK B;  2VH3 A;  4ASJ A;  2IOQ A;  4BJ1 A; 
#chains in the Genus database with same CATH homology
 3K66 A;  5DQZ A;  4OD5 A;  3NYM A;  1WGW A;  4Y7V A;  4CJC A;  5KYX B;  1MP3 A;  2R7X A;  3E25 A;  2BO7 A;  3RFY A;  3V8Z A;  3CSK A;  5DDV A;  3EGX B;  3E9V A;  5C1H A;  1BR2 A;  1OCZ C;  2OI7 A;  2A6E F;  4HFK B;  4YJW A;  2R7R A;  1H5R A;  4D11 A;  2ICX A;  1TZF A;  3N9W A;  2V3C C;  2O9X A;  5KYU B;  4AYL A;  3SNH A;  1FOA A;  4EE3 A;  2H7B A;  4FX5 A;  1EZI A;  3AG1 C;  2AES A;  3V7O A;  3RIP A;  3SXD A;  1SMY F;  5BXC A;  1H5S C;  4Q5S F;  2WE9 A;  2V0I A;  3NDB B;  5IFY A;  2Y3G A;  2OEF A;  1LVW A;  2WZL A;  2J9W A;  4HEA J;  3EE5 A;  4HO0 A;  5EJZ A;  3V0Q A;  2KJG A;  3Q6N A;  4B2W A;  4D48 A;  1HJJ A;  5T1D B;  3POL A;  4PFP A;  4JJG A;  3U2X A;  3TZT A;  2EIN C;  2FYB A;  5CMI A;  1H5S D;  2W0W A;  4BJ6 C;  2VK9 A;  1YP3 A;  4FRE A;  1FRW A;  1R81 A;  1J8M F;  5C4D A;  3FVY A;  1ZHX A;  3EHN A;  1ZCT A;  4Y7G A;  2NUT A;  1W77 A;  3U2T A;  3L0I A;  1JYL A;  5C49 A;  3JYH A;  3EFO A;  5B1B C;  3ECS A;  2E8B A;  4M2A A;  5EIY A;  3SX8 A;  2WZG A;  4I3M A;  2WEE A;  1TW1 A;  3U2V A;  1H3M A;  3O6X A;  2R7Q A;  3EHM A;  4BJ5 A;  1H5R B;  1TKN A;  3ZG1 A;  3Q6M A;  2V0K A;  3FWW A;  2IXN A;  1H7L A;  2X51 A;  4C3D A;  3X1O A;  2AEC A;  1HV9 A;  2VD4 A;  5CQP A;  1ZDF A;  5CI9 A;  1HM9 A;  1ZHY A;  3GAN A;  3LES A;  3T6B A;  1H4C A;  3SEO A;  2A8U A;  2FYA A;  5E33 A;  4KNX A;  4O7G A;  4P02 A;  1MMD A;  2DPW A;  4PJM A;  4BG0 A;  4CSA C;  1H5T A;  2AM5 A;  4B4B A;  1QGQ A;  2MYS A;  4EEG A;  3PMR A;  5C36 A;  3ABM C;  2HV7 A;  3I5Q A;  5BUO A;  1GX0 A;  1VZX A;  4CS9 A;  1R7U A;  2XSE A;  3Q7U A;  5D92 A;  1VOM A;  2HV6 A;  4KC4 A;  5KYW A;  1M2O A;  4E1K A;  2UX8 A;  3K8E A;  4IRU A;  3VYW A;  2FYD B;  1VGZ A;  1MMN A;  4OIO F;  2H7O A;  4OIP F;  2CGE A;  2V0L A;  2QY9 A;  3OEO A;  4MIX A;  1PZT A;  1TWC A;  3EFO B;  4YS8 A;  3EGD A;  1Z90 A;  4U5F E;  1FO8 A;  4FIX A;  1S4P A;  1NU7 D;  2Y3D A;  5IY5 C;  1E5K A;  1G0R A;  3B0U X;  2W4B A;  1GWW A;  2J0A A;  5C3B A;  3EH1 A;  3W2V A;  5L6S A;  1KU2 A;  3NKE A;  3N2Z B;  3DUV A;  5E3C A;  4JIS A;  3DMD A;  3IOJ A;  2KQ9 A;  2OCC C;  5HSW A;  1QGS A;  3JSZ A;  1O0R A;  2YQS A;  1LL3 A;  2Q9A A;  2Y69 C;  1HM0 A;  1LZ0 A;  3LJB A;  3B0V C;  2PX0 A;  4RD9 A;  4AE4 A;  2ZPA A;  3W8H A;  2XWL A;  3S0X A;  3D5N A;  4CVH A;  5IDT A;  5CQL X;  4BJT A;  4D11 C;  3MLG A;  5FCL A;  3LS1 A;  2R7S A;  1H5T B;  3IOI A;  3LEV A;  5T3W A;  5HS2 A;  5KYX A;  4BQH A;  3O3P A;  2RIX A;  5EHH A;  3QVB A;  4KT7 A;  4J30 B;  4E7Z A;  2BO8 A;  3EGX A;  4DE7 A;  5L6V A;  2R7O A;  4B6I A;  1NWG B;  2RJ6 A;  3ABL C;  4K6R A;  5FU8 A;  1FR9 A;  3LS0 A;  2RJ9 A;  2D5R B;  2W4M A;  1O5H A;  4FRQ A;  1Z5Z A;  4EVW A;  1O7O A;  3LLK A;  1FXJ A;  4IJJ A;  1LZI A;  2IXO A;  2A6H F;  2XMH A;  4G0H A;  4C7O B;  1G97 A;  1VMA A;  1Z3I X;  4ANJ A;  4XWI A;  4I1O B;  3K1H A;  2A68 F;  2QH5 A;  1LZ7 A;  2RIY A;  2W0V A;  4M28 A;  2Q4J A;  2X60 A;  2C04 A;  4P00 A;  2YHS A;  3USQ A;  3F1Y A;  2X5Z A;  1ST6 A;  2EIK C;  1ZCV A;  1RJ9 B;  3EZH A;  1LL0 A;  1PZY B;  1D0X A;  2AE7 A;  2GFH A;  5C38 A;  3SXB A;  2L9J A;  3ABK C;  3SPT A;  2PGV A;  3CKO A;  3CKN A;  4IRP A;  2NUP A;  4CJ8 A;  4AE4 B;  4X0R A;  4D0T A;  2V0H A;  2ZU8 A;  4IRQ A;  1MNE A;  1TVY A;  1NMM B;  2Y6P A;  1Z23 A;  1FFH A;  3AG2 C;  1H7H A;  1VGT A;  5B3S C;  4M2B A;  4KNV A;  1WT1 A;  4HG6 A;  3V0P A;  4ASY A;  3KKB A;  2YEV A;  4LLE A;  1NKH B;  4G7Z F;  2ZXW C;  5B1A C;  1QZX A;  5E2Q A;  2E3D A;  3GOD A;  4GEH A;  2RJ8 A;  4B42 A;  4R7P A;  4AX2 A;  3NKD A;  3I0D A;  3V0M A;  3S27 A;  1JV1 A;  2JCJ A;  4ZDQ A;  2I5E A;  3BCV A;  1ZCU A;  1VYI A;  1ZJ1 A;  1ZIZ A;  4B3U A;  4C2S A;  1GA8 A;  4CS9 C;  3T7N A;  4EE5 A;  4FRL A;  4AAW A;  2V0J A;  1BR4 A;  5D91 A;  3O39 A;  4O79 A;  2WVL A;  1LKX A;  4QI0 A;  3DJ4 A;  3B9Q A;  3Q80 A;  4HCQ A;  5DDT A;  3I0J A;  3JRT A;  5DS6 A;  2RJ4 A;  1M57 C;  5DS4 A;  2CU2 A;  1ZYR F;  4XLN F;  2APC A;  3SP1 A;  4YT8 A;  2FFU A;  2VS3 A;  5AJP A;  5C4C A;  4U5D E;  1MC3 A;  4Q7C A;  2ICY A;  3V0O A;  4MND A;  3SZR A;  2RJ5 A;  2P7V A;  2W45 A;  3X2Q C;  2WVM A;  3I0E A;  1H7T A;  2NUP B;  1ZU4 A;  5C3D A;  1GX4 A;  4BEJ A;  4CJB A;  3B0P A;  1JPJ A;  3K1I C;  4IWB A;  1GWV A;  3V8Y A;  4F4B A;  1H7E A;  3T4R A;  2NG1 A;  4HFF B;  2D0J A;  4NAI A;  2V26 A;  1ZU5 A;  2XRH A;  4YT5 A;  1R7T A;  2P73 A;  5CQM X;  1J8Y F;  1H7F A;  1YP4 A;  2ZU9 A;  2VFZ A;  3JUJ A;  1FZW A;  3U0Y A;  3IOH A;  4GYT A;  4OD4 A;  4B2X A;  4KNR A;  4JUR I;  3NYL A;  4AK9 A;  3ST8 A;  2RIT A;  2RJ7 A;  4J18 A;  2PP4 A;  1O23 B;  5CMF X;  2WAW A;  1M56 C;  1PD0 A;  3HTK C;  1PCX A;  3DJU B;  1YRO B;  2WVN A;  4O6M A;  3M1C B;  3RKO F;  4FRA A;  3DD7 A;  3EZI A;  4LLC A;  2R7T A;  2Y4J A;  2XME A;  2Y7A A;  1ZJO A;  4NAN A;  3ZGF A;  4NAK A;  2YCM A;  3AQB A;  2PFD A;  3RMW A;  2O1H A;  2E87 A;  3ZIB A;  4HOC A;  1W55 A;  3E70 C;  2J0X A;  3Q7L A;  1TW5 A;  3D98 A;  2GGO A;  4U5H A;  3V91 A;  2OI6 A;  2C0N A;  2R7U A;  1HJL A;  1FWY A;  2CDQ A;  5CQO A;  4C7O A;  4J32 B;  4FRD A;  1S4N A;  4JW1 A;  4D0Z A;  3Q4S A;  4KBL A;  3DJN B;  2DYR C;  1NG1 A;  3IEE A;  2A69 F;  5C4B A;  4PJJ A;  3RSB A;  1V54 C;  4AYJ A;  3U2W A;  1FMV A;  2Z86 A;  3PKQ A;  1ZDG A;  2J7P A;  5DLJ A;  4Y62 A;  4EE4 A;  4FCU A;  1RJ9 A;  4BMA A;  2CW0 F;  5KYN A;  3HL3 A;  5CMH A;  5F5H A;  4Q4Z F;  1EYR A;  4FES A;  3SXA A;  3ZLK A;  2Q9B A;  3UNG C;  4AC3 A;  1ZJ0 A;  4DVY P;  1NU9 C;  4EWC A;  2JCK A;  5CMJ A;  1ZJ3 A;  4L41 C;  2Q9C A;  1ZI1 A;  2YQC A;  3QZC A;  1JVD A;  1D0Y A;  2A8W A;  3V0L A;  1JPN A;  2XWM A;  3N0T A;  4ZLC A;  2DGJ A;  1G95 A;  3KIA A;  3DAG A;  2RJ0 A;  2YZS A;  4KRV A;  5C1G A;  1FXO A;  3DZA A;  4JJF A;  2Z15 A;  3JUK A;  4UEG A;  1MND A;  1ZI3 A;  2WZF A;  3NRH A;  2MZB A;  4NAL A;  5JQQ A;  5C3A A;  2YQJ A;  1FGX A;  2YC5 A;  2G3K A;  3OGZ A;  2AGD A;  2DYS C;  2KGO A;  1VZT A;  3I0I X;  2VSH A;  2IXP A;  4CS7 A;  2CNW A;  2XWN A;  4Y64 A;  2KW3 C;  3ZC4 A;  3POV A;  5CMG X;  4MYB A;  5C47 A;  2PGY A;  4MQ9 F;  2RIZ A;  3L34 A;  2PX3 A;  1NF5 B;  3E26 A;  1WSZ A;  3V90 A;  2VSI A;  3ASO C;  1FR8 A;  3U2U A;  1LS1 A;  2XXA A;  1IW7 F;  2FFH A;  3ZSU A;  1FMW A;  2NXV A;  1NZE A;  4KC1 A;  2VXL A;  4G3Q A;  1INI A;  3OH3 A;  2Y4K A;  3T7O A;  1V83 A;  5J49 A;  1ZCY A;  4FRB A;  4FRP A;  1ZJP A;  1NHE B;  1FGG A;  3V0N A;  4FQW A;  1IZM A;  4G3S A;  4DDZ A;  2L81 A;  4LER A;  1MP5 A;  3OH4 A;  4KQL A;  5FTV A;  3EPV A;  4W8K A;  2Y3B A;  3CZ6 A;  3K7D A;  2ZXP A;  3AG3 C;  2JD3 A;  4U5B E;  4BJ5 C;  2VXM A;  2IYL D;  2YES A;  1ZHW A;  2J46 A;  1FO9 A;  3NGW A;  3KMI A;  2I8B A;  1D1A A;  1TWH A;  5CQN X;  4QDL A;  5L3V A;  3R3I A;  1G93 A;  2D7I A;  4HO4 A;  4OIR F;  1LL2 A;  3K6B A;  4RDA A;  1ZHZ A;  1V84 A;  3EH2 A;  3CGX A;  5C4F A;  3UR3 C;  3EQL F;  3UMK A;  4ECM A;  4G7O F;  1LVK A;  2P6V A;  4Y7F A;  4G7H F;  2PF4 E;  3USR A;  1WT0 A;  1G3L A;  4EEA A;  2VAS A;  4EEM A;  1R82 A;  2W9Y A;  3JCU Q;  3LAY A;  1QWJ A;  4EEO A;  3PHF 2;  2XXA B;  1SF8 A;  1XHB A;  3N24 A;  4XLP F;  1MP4 A;  2ZU7 A;  1G9R A;  1K4V A;  3ZLL A;  4A2N B;  4QI2 A;  1O87 A;  1VYK A;  2I7B A;  4HO8 A;  4HO2 A;  2KNH A;  3DAF A;  4DEC A;  1ON6 A;  2EIM C;  3GUE A;  4DVZ A;  1G1L A;  2AH9 A;  3ASN C;  4HO5 A;  4M4K A;  5EJ1 A;  1KWS A;  3OH2 A;  4NY3 A;  5FU0 A;  4YWQ A;  5DVW A;  1OKK A;  1VGW A;  4I1M A;  3I0K A;  5EGY A;  3OKR A;  3PKP A;  4Y6U A;  1D1B A;  4EBB A;  1LZJ A;  3SX3 A;  1N1C A;  2RJ1 A;  1GQC A;  4B5B A;  4G87 A;  3JT1 A;  5KYY B;  4JCH A;  4PFO A;  2QKX A;  3SYN A;  2J0W A;  3WG7 C;  4DBQ A;  4G3P A;  2J7P D;  3DM9 B;  2GGQ A;  3UMI A;  5IDS A;  1IIM A;  3I0H A;  2M4E A;  2FYC B;  2OEG A;  4JD0 A;  2FY7 A;  2JCL A;  4OIN F;  1NQI B;  1G23 A;  2WVK A;  4LW6 A;  4HO9 A;  4E7S A;  1G2V A;  3ZGG A;  2LSE A;  3LLI A;  3TD7 A;  4CS8 A;  1M2V A;  4YN0 B;  2FFV A;  3SXG A;  3H65 A;  4KC9 A;  4O6Y A;  1FG5 N;  1S4O A;  2I5K A;  1OQM B;  3I0L A;  3R2W A;  3S28 A;  3MX3 A;  1HM8 A;  2QTV A;  1QLE C;  3K33 A;  2G3V A;  4KPZ A;  2WGZ A;  4KXO A;  4Y7U A;  3HJC A;  3DK5 A;  3UGP A;  1ZHT A;  3OC9 A;  1H4E A;  5T3T A;  1VPA A;  4PJN A;  5F5F A;  2Y4L A;  4XWJ A;  2J45 A;  3I5P A;  4OIQ F;  1VH1 A;  3NG1 A;  2BO4 A;  3SXE A;  3I0C A;  2B0J A;  5I1F A;  1PD1 A;  5C48 A;  4IAO A;  4RBN A;  1QG8 A;  1INJ A;  4FRO A;  4N06 A;  4LW3 A;  3PNN A;  3F46 A;  4JVS A;  2PA4 A;  3EG9 A;  4HO3 A;  2A1D D;  1VM8 A;  3OH1 A;  4XTK A;  4KPX A;  4I44 A;  1VGU A;  4HO6 A;  4U5C E;  1R7V A;  2Z87 A;  3I0F A;  5AJO A;  2CNW D;  4FRH A;  1VH3 A;  2ZXR A;  2J9V A;  3CKQ A;  2FGY A;  3UMH A;  3W2W A;  5DS5 A;  1JV3 A;  2WVO A;  1VIC A;  2X65 A;  3F47 A;  3BRK X;  3T7M A;  3SX7 A;  2Y3H A;  3DM5 A;  1O7Q A;  4ARW A;  4CBE A;  3U0X A;  5CI8 A;  1D1C A;  2P72 A;  3FOQ A;  1TWA A;  2YC3 A;  3OAM A;  4C3E A;  3FDQ A;  1H5S A;  4B4G A;  1OCC C;  2ZXO A;  3HLZ A;  2XL4 A;  3I4U A;  2J9U A;  1D0Z A;  3KL4 A;  1WT2 A;  4FCE A;  1Z6A A;  2D7R A;  2BO6 A;  3AQC A;  1SZI A;  1FTS A;  3CQZ A;  1M2V B;  4ULW A;  2OG2 A;  2X5S A;  2NUT B;  3RH3 A;  5FTS A;  4PK4 A;  3FAJ A;  4K0D A;  4U5E E;  4YT2 A;  1YP2 A;  4FRM A;  3LW6 A;  4GBP A;  1GQ9 A;  4O6N A;  4BJ6 A;  4Y9X A;  2VS5 A;  5C4E A;  4U5G A;  1ZI5 A;  4Y6N A;  2PX7 A;  2WB7 A;  4CIH A;  2O1G A;  3ITF A;  4C3B A;  2R7V A;  1I52 A;  1H7Q A;  4K7B A;  1MMG A;  3VAY A;  1ZJ2 A;  3I0G A;  5FYE A;  2P6W A;  2C03 A;  3F1C A;  3EG9 B;  1R7X A;  4B4M A;  2YQH A;  1G8X A;  3JTJ A;  3LNR A;  1OMZ A;  3OH0 A;  3FHD A;  3SXC A;  2J0B A;  1XZ6 A;  3DXJ F;  3RYL A;  1ZI4 A;  3TQD A;  3CKV A;  2H7V C;  4WJ0 A;  2AM3 A;  5AJN A;  3WOD F;  3UGO A;  1WT3 A;  1MMA A;  4KI2 A;  1VK5 A;  3KH2 A;  2VB6 A;  3EJN A;  3QMK A;  1SS9 A;  4JZA A;  1ZHJ A;  1H5S B;  1JVG A;  1S7Z A;  1WVC A;  5KYW B;  1ON8 A;  2Q3T A;  3T6J A;  4FIY A;  3SX5 A;  1Z63 A;  4CSA A;  2EIL C;  4FWV A;  2EIJ C;  4M63 A;  5KYU A;  1TR2 A;  3Q7G A;  2Y39 A;  3ZF8 A;  5C1L A;  1IIN A;  3W8I A;  1V82 A;  2JCO A;  4DOZ A;  4DBR A;  4KNW A;  1OCO C;  1JYK A;  5DQT A;  4PJL A;  1OCR C;  2BE5 F;  4YT4 A;  4P6I C;  1R7Y A;  3EGD B;  4LAC B;  1OKK D;  1BR1 A;  1G8O A;  1VZU A;  2Y4M A;  4ZLD A;  2QGI A;  3CU0 A;  2R7W A;  3OWT A;  4KC2 A;  5KYY A;  4Y7T A;  5C8R A;  4CS8 C;  1FFT C;  2AM4 A;  4Y63 A;  3ZVR A;  1OMX A;  3AG4 C;  5L3Q A;  2G62 A;  2WL8 A;  3OA1 A;  1R80 A;  1W57 A;  2VS4 A;  3CKJ A;  1V55 C;  3NYJ A;  2O1F A;  5E3A A;  2MWQ A;  1TWG A;  3K8D A;  1H7G A;  1W2W A;  2OI5 A;  5FV9 A;  3RMV A;  5FUH A;  3D8V A;  2IXM A;  4HE8 D;  4H4K C;  3S29 A;  2VH3 A;  4ASJ A;  2IOQ A;  2WVQ A;  1H4D A;  4BJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...