5D91A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
molecule keywords AF2299 protein,Phosphatidylinositol synthase
total genus 115
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d91A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d91A01
5D91A 4MNDA 4O6MA 4O6NA 4Q7CA 5D92A
chains in the Genus database with same CATH superfamily
5DS5A 4K6RA 2GGOA 5L0GA 3EHMA 2VSHA 2KW3C 3G4XA 1WT2A 4DDZA 3UMHA 2XL6A 1HJJA 4MYBA 4G3SA 1HMDA 4I3MA 3AG1C 1VH1A 2WAWA 1NKHB 3PNNA 1HM0A 2VK9A 1GQAA 2YRFA 3RF3A 4KNVA 1FMWA 4CIHA 2ZXPA 4JTAB 1O87A 2Q4FA 1YP3A 1QLEC 1XWJA 1JVDA 2LD6A 2G3VA 1BR1A 3EGXA 3NG1A 1JYKA 3RMVA 3EPVA 3ZTMA 1H7HA 3DJNB 3C8GA 3JUJA 1G4US 4JC7A 2Y4JA 4P9FA 2NUPA 1OMZA 1QKRA 3U3FA 2WZGA 2V0IA 1Y4CA 1ZCUA 4KQLA 5KYYB 2EILC 2A6EF 2O1FA 2AU5A 2YL1A 1SZIA 4AC3A 4NAIA 1YZAA 1ZCYA 1VTMP 4U5FE 1LL2A 1QZXA 4EEAA 3ZC4A 4FCUA 5KYUB 3GODA 5CMGX 2E87A 3CQZA 5A69A 3H2VA 3EH2A 3H65A 2A8WA 1T6UA 4KBLA 5CMFX 4D11A 3ZDLA 5I1FA 1FR0A 1FGXA 4ULVA 2VB6A 3SXYA 1N1CA 2AVKA 2XLWA 4O6NA 1HMOA 4MS2A 4L6RA 3V0MA 4G7OF 3KKBA 4IGGA 1JPNA 1WVCA 4O7GA 1GWWA 2YHSA 3ABMC 4QDLA 2O1HA 2EPKX 2XRHA 4H54A 1NHEB 2PNOA 3KPHA 2FYAA 5C36A 3US6A 4KC4A 4EE5A 1FZWA 2X5ZA 1HY5A 5BQGA 3JT1A 1B68A 1T6IA 1SS9A 4G3PA 4JD0A 4R32A 3M79A 5AGFA 5COMA 3DUVA 5JLIA 3EG9B 3I4UA 5C8RA 2QH5A 4KRVA 5FUHA 3W8IA 3RIPA 4Y6NA 4A4AA 3IOHA 2XM4A 4K1OA 2XL8A 1YP4A 2OCCC 3ZWIA 5L6VA 3NMJA 1IIMA 2R7VA 1T5OA 1I5NA 4NTFA 4FREA 3O39A 5KYNA 4Y7FA 2YEVA 4D0TA 1GA8A 5F5FA 1GS9A 1BR2A 1V83A 2HZ8A 3E70C 3I0FA 1GM5A 3GM1A 3IEEA 3PKQA 2LP4A 3LESA 1OCCC 3FAJA 2UUIA 3NYJA 4Q5SF 1LKXA 3RQGA 4CDVA 3DAGA 4FIXA 1G4WR 3LS1A 2L6HA 4KNRA 2AM3A 3IHUA 4UDVA 2BO4A 2D7RA 3NGWA 5CMIA 2VXLA 1XZQA 2XLHA 3UGPA 5CQNX 3N2ZB 3U3BA 1HV9A 2AH9A 4YT5A 3QZCA 2W45A 2J0XA 1FOAA 2Z86A 3C8GB 3K8DA 3SNHA 1Z6AA 5CI8A 2XLMA 1HM9A 3U2TA 4CJ8A 4KPXA 1TFKB 1G93A 2KNHA 3N0TA 4QI2A 5FTSA 4F4BA 4YL3A 2AWCA 4EBKA 4C3BA 4OD5A 1OQCA 1YARO 2G62A 2XLDA 5HSWA 4FRDA 1E2XA 5DDTA 2OU6A 1A41A 1ZZPA 3K1IA 3F47A 2W4BA 3BCVA 2R7UA 2H7VC 3C8ZA 2FYDB 4NTAA 5DQZA 4JISA 4U5DE 3W2WA 3KYIA 5C3BA 1INIA 4E0HA 2IXMA 2JX0A 4BEJA 4N6CA 4LACB 2AWYA 5EGYA 4PACA 3JCUQ 2XWLA 4BEMJ 2AESA 2L7AA 2D5RB 3T4RA 3I0IX 1JR8A 3MX3A 4JJFA 5C48A 2CW0F 1TR2A 1T01A 3C7JA 1FR9A 1C17M 4AAWA 1EYRA 3MBGA 2PA4A 5COFA 3JTJA 2XWMA 4R7PA 3B0VC 2FGYA 1HE1A 2MYSA 4AE4B 1ZI3A 3WG7C 4CJOA 2J45A 4K0DA 5CMJA 2QNLA 2Q9CA 4KC2A 4EE4A 2X51A 4DBQA 4HO6A 1NF5B 3TOLA 5A6BA 1FXJA 2R7TA 3W4YA 2IM8A 5DS4A 4RD9A 3ZF8A 5C4EA 5C47A 4DECA 4CX9A 2AE7A 1WT1A 4WGZA 3AQBA 1ZDGA 2E8BA 2FY7A 1VGUA 5L0IA 4X0RA 3V5YA 5IFYA 2HSQA 2XXAB 1WTYA 2XXAA 1NFOA 1M6TA 1JRAA 2AGDA 3Q7LA 3VRCA 1R7UA 2PP4A 5A6KA 4DE7A 4JTDB 5L0HA 4B3UA 1BBHA 2XWNA 1QVXA 3GORA 3Q6MA 1JV3A 4B5BA 1VB5A 4MVSA 1MMDA 4W8PA 1OR3A 2GDCA 3SP1A 1VK5A 2EPMX 1LZJA 4ARWA 1ZJ3A 1YROB 4B6IA 3DE9A 2Q9AA 1MQVA 5AJPA 4BQHA 5FTVA 1ZCVA 1PD1A 3Q6NA 4JRZA 4Y7VA 3RKOF 5JRAA 1RXQA 3VAYA 2DI3A 5FU8A 4U5GA 2YQJA 3K6BA 2FFUA 3U0CA 3ZGFA 1VZXA 5AJNA 1FXOA 2Y6PA 2HMQA 3DM9B 4GBPA 4KNXA 3WHNA 3EQLF 3FVYA 1C03A 4HO8A 2LFDA 1H5RB 1ZI5A 1ZHYA 5A6JA 1T9KA 1MC3A 3OH4A 2PX3A 3UMIA 1H5SA 1R7XA 1V55C 4Q7CA 3NKDA 2OEFA 2D7IA 2A8UA 2A69F 3A11A 1FAPB 4P00A 1AVOB 4FQWA 3ZVRA 2FYBA 4Y9XA 4C7OA 5IDSA 1E5KA 1V4AA 2V0LA 2YQCA 1WT0A 1OKKD 4QI0A 3AG4C 3KMIA 5T3WA 1WN0A 1FWYA 4EHPA 3GM2A 1IZMA 4YS8A 3AG3C 1ORSC 4Y63A 3O55A 3EGDB 3RMWA 3SXCA 3S9OA 3IOJA 5BQHA 1VLTA 2XMHA 1EI7A 5C49A 1LIHA 3HNIA 3L34A 3FWWA 4ASJA 2WL8A 4FRLA 1YYJA 3K33A 4CSAC 3PMRA 2L6GA 1MP5A 1V54C 3EG9A 2P6VA 1YJGA 3U2VA 4LW3A 3SEOA 4EBBA 1S4PA 3OAMA 4FRBA 2Y39A 1LVKA 1MMNA 2EPOA 4CS9A 2Q4JA 4Z9JA 3U8PA 2GGQA 3K8EA 3DKAA 3HTKC 1ZHZA 4HG6A 1CPRA 4YJWA 4I44A 5K0IA 4XPWA 2J9VA 1H9GA 1R7TA 3I0HA 4HFFB 4D4NA 3PCVA 3Q4SA 2YLIA 2ICWG 4CJBA 2JCKA 1KTMA 256BA 1A7VA 1G8XA 4L41C 5DLJA 4BJ5C 1GX4A 1GGQA 1OQMB 5JVEA 4MIXA 4CDAA 1HE9A 1I4ZA 1Z23A 1CGOA 3VF0A 1W57A 4LERA 2NG1A 3JUKA 4FRMA 1AUEA 1YAUO 3NYLA 1W2WA 2XSEA 4NCQA 5BUOA 2R9RB 2KC3A 5C4CA 3RYLA 4KC1A 3CKNA 4IRPA 5CQPA 4B4BA 2TMVP 3V91A 3SXMA 3H2UA 2LSEA 5COGA 2WE9A 3FOQA 2R02A 1GWVA 4DRHB 3FDQA 3N24A 2QE9A 1V82A 3S27A 3EE5A 1D1CA 2CNWA 1TVYA 1YA9A 3JZ0A 3I0DA 2OI6A 1J8MF 3C62A 2R7RA 5AC5A 4B2WA 4CJCA 2YC5A 4MW3A 3O3PA 4RBNA 4LLEA 3O10A 4JURI 3I5QA 1JOGA 3V8ZA 2GFHA 5E2QA 1Z5ZA 2ZXRA 2IXPA 3HLZA 1LS1A 1ZI1A 3V5ZA 5L3VA 5T1DB 2AP3A 4HOCA 2W4MA 3A9CA 3W2VA 5C1LA 3N9WA 3R2WA 2AM5A 1OW8A 1SF8A 1UG7A 1CGNA 4BPMA 3FOPA 3D5NA 4FROA 4EEMA 2OQMA 1FG5N 2C03A 4AX2A 4IAQA 1S05A 3PDMP 5KYXA 3OEOA 4NC3A 5E33A 1APCA 2WVMA 2YWAA 3NMKA 1PV3A 1H5TB 5FZTA 4YL1A 1U0BB 2RJ0A 4HO9A 2HJ3A 2JCOA 4HO0A 2VD4A 1GQCA 1JV1A 4J30B 4IWBA 1Z7Qc 3UNGC 3LEVA 3AGTA 3BEHA 3TQOA 5A6BD 1OW6A 5TJ5E 1RCPA 4B4GA 1G23A 1O7OA 1D0ZA 1ZDFA 3LJBA 3CGXA 3NDBB 4E7ZA 4KI2A 3Q7GA 1AEPA 2FFHA 3RQFA 3PHF2 2LK4A 5L0FA 3M4CA 2HFIA 2RJ5A 4HFKB 4XPYA 4U5EE 4ANJA 4Y64A 2J0BA 2X0CA 4NANA 1ZU4A 3FAPB 3IQ6A 4XPXA 1C02A 2PGVA 1LE4A 3UMKA 2ZXWC 3T6GB 4J18A 1VZTA 4PFPA 4Y7UA 3O6XA 1OCOC 3JRMO 3I5PA 2W0VA 4CJGA 3NMIA 4FESA 4MW8A 1MP4A 1NSGB 1QGQA 5F28E 4AYJA 1U89A 1YVIA 5C1GA 1MMAA 3DM5A 3KYJA 4XEFA 2ASRA 1PCXA 3M15A 2RJ9A 5L3QA 2R7XA 3ECSA 3CZ6A 1G2VA 1YYXA 3ABLC 3K7DA 1H4CA 5E3CA 3SXBA 1FMVA 4BJ6A 5C3AA 1NFNA 2WVKA 1EA8A 4BMAA 4PJMA 1S7ZA 3POVA 4B2XA 1ZVZA 2C04A 3ASNC 2J9BA 2OEXA 4CS7A 1G9RA 3HNJA 5EHHA 3CKJA 3V0LA 5JUAA 4XWIA 3R2PA 3GEEA 5L0DA 3RVYA 2HSBA 4P02A 2PGYA 1R82A 2JCLA 4M2BA 3V7OA 3USQA 3Q7UA 1VZUA 2KJGA 1PD0A 2DPWA 2RJ8A 3B29A 2A0BA 4EVWA 3LW6A 3T7NA 2HJMA 4DVYP 1Q0MA 4IAOA 2Y3GA 4MNDA 1ZHTA 1FNTc 1MNDA 5L0CA 3V0PA 5BQIA 5FV9A 4PK4A 4U9EA 1V84A 1VICA 5EK0A 1YP2A 3DAFA 1W55A 4GEHA 1BZ4A 1SR2A 1D0XA 1E85A 3U5SA 1LI5A 2JD3A 2P1AA 2MZBA 4J32B 2RIXA 2R7WA 1H9TA 2KYHA 5KYXB 3ZG1A 1RJ9B 4LDRA 4IRQA 4XTKA 2OJQA 4YT8A 1ZYRF 3QW0A 2CYDA 3LUTB 2CU2A 1G97A 2P7VA 1S4OA 5J49A 1BR4A 3OWTA 2P73A 3IQTA 1TZFA 1R7VA 4K7BA 4UEGA 2W0WA 1WGWA 3JYHA 4NQFA 2JCJA 2O1GA 3JSEO 4OIRF 2APCA 4XQ1A 2HV7A 2B0HA 5B1AC 4C2SA 5IDTA 3L0IA 3GANA 3RFYA 3HL3A 4JTCB 3QW1A 3RVZA 4DVZA 3MYIA 2EPNA 2OJED 1PZTA 3SXKA 3I0CA 2RJ4A 4EEGA 1EZIA 5BXCA 4HEAJ 4ASYA 2EIKC 2X60A 4FCEA 3SXDA 3CKOA 1R5ID 1JVGA 2QTVA 1ZU5A 2IYLD 3ASOC 4JIOA 3E25A 4JJGA 4PJJA 5C1HA 3T7MA 3U0XA 3POLA 3LLKA 1VMAA 3G4ZA 1O0RA 2LIGA 3OKRA 4O6YA 4IJJA 3S0XA 1VH3A 1ON6A 4JKVA 1ZW2A 2M64A 3R3IA 1VYIA 1R81A 1ZIZA 4CVHA 2MHRA 3ZQYA 2BL2A 4MVOA 2ZD9A 3QVZA 2I15A 2CDQA 1TQGA 2V0HA 1FFHA 5CQOA 2PX7A 2Q7RA 1IW7F 2J0WA 2AM4A 1VGTA 2UUHA 5JP7A 4KNWA 2Z87A 2JPUA 3KIAA 1GX0A 2E3DA 1JAFA 3SX3A 1LL0A 5L6SA 3EFOB 1ST6A 2J7PD 1O5HA 5KYYA 1Y6DA 3ATPA 3AG2C 3U9JA 4ULWA 2GA0A 4FWVA 3MLGA 1RMVA 4XWJA 2HV6A 3LS0A 3ST8A 2WVOA 5D92A 2AECA 2Y3BA 2IXOA 3NRHA 1OMXA 3F1CA 3SX5A 2I8BA 3FXHA 5FU0A 5JS5A 2DYSC 2RSEB 2Y3HA 1EQ1A 2VS5A 1RKCA 1W77A 2YL0A 2Y7AA 2QKXA 4HO5A 1BDJB 3QVYA 1DOVA 1QGSA 2PF4E 2Y3DA 2VASA 2VC9A 3USRA 5L0JA 2ZU9A 1NLXA 3TJ6A 4GQHA 4EWCA 2RJ6A 2OI5A 2QUPA 5FYEA 2YZSA 3OH3A 4E18A 2RJ1A 3ZSUA 4U9DA 1LI7A 2EPLX 4EE3A 3S90A 4YWQA 3UGOA 4CDYA 1EKYA 5HS2A 2FAPB 4DRJB 3R7CA 2Y69C 1GQ9A 1OW7A 1D1AA 5AC4A 4EIYA 1KU2A 3F1YA 3JTLO 1VYKA 4NY3A 3S29A 4GYTA 1LE2A 2IBFA 2F22A 4FX5A 4IB4A 4CIPA 2Y4MA 5T3TA 2VCBA 2YLDA 2O9XA 3TULA 1ZJ1A 2NSGA 2VH3A 4C3EA 3U2UA 4JCHA 2XLEA 1K05A 1Z63A 4CSAA 3L1MA 2HKVA 5GPGB 2EINC 1NZEA 5C38A 5E3AA 3T9OA 1PZYB 3AGUA 2H7OA 4IRUA 4E1KA 3SZRA 1ON8A 2YESA 4AYLA 3DE8A 4DOZA 4FRAA 4DRIB 2YL7A 4P6IC 2J9WA 4EKWA 2XLOA 4BJTA 3U0YA 2A68F 4MVQA 3CAXA 2QY9A 3E9VA 5DS6A 2G3KA 4EBJA 5KYUA 2V0JA 1A0BA 1H5TA 1ORJA 3I0KA 2H7BA 2V26A 3KH2A 4AK9A 5JQQA 5F5HA 2H8AA 1D0YA 1HM8A 1H7IA 1H4DA 4MVUA 4B42A 5CIVA 2Q00A 4BJ5A 2Y4LA 4ZLDA 4ZLCA 3I0EA 1H4EA 1INJA 2Q3TA 1H6GA 3I0GA 4WABA 3DZAA 3SX8A 1LPEA 3DXJF 3U2MA 5FCLA 1OR2A 3AQCA 1H7GA 4JEBA 1QSPA 3Q80A 4CS9C 1LZ7A 1LZ0A 2WZFA 1VPAA 1OXKA 1HW1A 3RH3A 4DXWA 2YVKA 3GM3A 1I4YA 3IPMO 4ECMA 1NU7D 2R05A 1H7EA 3VYWA 2XLVA 1JPJA 2LQGA 3FMSA 4E0IA 2GAQA 1R7YA 2HMZA 3EGDA 1TW5A 3SX7A 2X65A 3GWNA 3CSKA 5C4BA 1YA7O 4DJ9A 1FR8A 4AE4A 3RQEA 4MVRA 4WGYA 1O23B 4G0HA 2KGOA 3EZIA 2WVQA 3OGZA 2HS5A 3SXAA 3OA1A 3LEOA 4KPZA 1R4TA 1QQ3A 4FAPB 1XZ6A 2FFVA 4E7SA 3WODF 4C3DA 2PFDA 1LS4A 2YQHA 4P9TA 1O3UA 4HCQA 4JE9A 4HO2A 3DI5A 2J8WA 3OH2A 1H5SD 3CEXA 1HJLA 2YQYA 4E17A 3V0NA 1M2OA 1TWHA 2BE5F 2LCHA 1JYLA 3MFNA 1WATA 1TFOB 4M63A 3RW0A 4AL1A 5CI9A 5DDVA 4YT2A 3JRTA 3D98A 1L7CA 2YC3A 1J8YF 3K66A 4OIOF 4ZDQA 3ZLKA 1G0RA 4MTOA 1WASA 1HW2A 3IQ5A 1M56C 1VGWA 4CS8C 1OCRC 2LFFA 1FO8A 2XMEA 4LDQA 3LNRA 4ER9A 5EJ1A 1IINA 1H5SC 4XEKA 2PBEA 3SXEA 1FTSA 4I1MA 4PJNA 3T6JA 3M4BA 3I0JA 3GEIA 2RJ7A 3RSBA 4D4XA 3LNMB 1RKEA 4Y7GA 4D0ZA 4FRQA 2D4UA 4B4MA 2ICYA 1H7QA 1H5SB 1E86A 1ORYA 4JEAA 2RITA 2HUJA 2EIJC 4XLPF 3LAYA 3L8IA 1M2VA 1Q0FA 1Z90A 1KWSA 4U5BE 3U2LA 1ZCTA 5CQLX 5AJOA 3OH0A 3QVBA 3SYNA 1NU9C 2WVLA 3E26A 3OH1A 1K04A 3BRJA 3NKEA 1L3PA 4KT7A 1OXBA 2ZPAA 3U9MA 1FO9A 3DWWA 1CGME 4YT4A 4U5CE 4FRHA 1JMWA 4FRPA 3V8YA 2Y4KA 4YN0B 3ZTZA 2OEGA 3J06A 4PR9A 2R7QA 1SYQA 3SXGA 1WT3A 2QGIA 3TOMA 4XEVA 1G8OA 2WZLA 2NXVA 2YL3A 5JSLA 5JT4A 2XS8A 3HJCA 2NPUA 2RD9A 3VM6A 4O79A 2R03A 2J7PA 3V0QA 3DD7A 1M57C 4G78A 3TD7A 2WB7A 2I5EA 1ZJ0A 4PJLA 2MWQA 3T7OA 3M1CB 4Z9IA 1OKKA 3ZIBA 2EIMC 2P0NA 2Q9BA 2BO6A 1E84A 2L81A 4Z9HA 3D8VA 1A7EA 3GUEA 1M2VB 3U8VA 5IY5C 4MTGA 3X1OA 4YK5A 1H7FA 4MVMA 2KK1A 2WEEA 3GEHA 1ZJOA 3TJ5A 3GWLA 1FGGA 3QMKA 4XLNF 4DBRA 2M4EA 3U2XA 4EEOA 4MVZA 1VLSA 1SMYF 3L8JA 2B0JA 4CBEA 1VGZA 4RDAA 3F46A 3SXZA 1TWCA 4M28A 5A6AA 1MP3A 3S28A 3WAQA 1K4VA 2YCMA 4Y6UA 1F1MA 4MTFA 1LZIA 3B9QA 2RIYA 2J9UA 4PFOA 5CMHA 3K1IC 3S84A 2VXMA 2NUTA 1DOWA 2VS4A 3PKPA 1ZI4A 1ZHXA 1QPUA 5D91A 2ETSA 2PX0A 1VM8A 2VCCA 4JCZA 2CCYA 2X5SA 4BG0A 5DQTA 3LLIA 2OI7A 3EH1A 4OIQF 2P61A 1NMMB 1MMGA 1WSZA 5C3DA 2NUTB 2A1DD 4NALA 4JVSA 2R25A 2R7SA 1WOLA 1VOMA 3DJUB 2OOCA 3DJ4A 5EJZA 1A7DA 4Y7TA 2C0NA 1XZPA 3FOOA 1ZHJA 2L9JA 1TWAA 2DGJA 2DYRC 3V5XA 2OG2A 2DB4A 3ZQVA 3EHNA 1S4NA 1Q0KA 2V3CC 3HNLA 3U2WA 1XHBA 1NQIB 3EJNA 4G7HF 3G50A 1H7LA 2P6WA 1H3MA 2IOQA 4YL0A 2L6FA 4JW1A 4C7OB 2KSFA 2BO8A 2NUPB 2VS3A 1H5RA 2BO7A 3SPTA 4W8KA 3V0OA 1UFBA 1D1BA 3CKQA 4Y62A 1Q0DA 3NYMA 2WVNA 4KXOA 3EFOA 4OD4A 2D0JA 2I5KA 3DMDA 3X2QC 3BRKX 3V90A 3TZTA 2Z15A 3JSZA 1K40A 2CGEA 3W8HA 2ZU8A 1ZHWA 1FFTC 3UR3C 4J7YA 2P72A 2V0KA 3HKKA 2ICXA 5DVWA 1E83A 3EZHA 2A0UA 4J7TA 3KL4A 3CKVA 5B3SC 4LDKA 3ABKC 4Q4ZF 1ZJ2A 1V74B 3ZLLA 2UX8A 1ZJPA 1OCZC 1R80A 2XS1A 4G7ZF 3T6BA 3QTHA 4MQ9F 5KYWB 1LL3A 4O6MA 1WWPA 1LM3B 4N6HA 2VSIA 4G3QA 2XM0A 4FIYA 2W9YA 5C4FA 5KYWA 4JZAA 2ZU7A 1CPQA 3B71A 3I0LA 2OEVA 5EIYA 4AL0A 4H4KC 2A6HF 2FYCB 4N4WA 1NBBA 4BJ6C 4CS8A 1NG1A 4M4KA 3C18A 5B1BC 1KNYA 1U6HA 4EUKB 4D48A 3AJMA 5B3IA 2BC5A 3FHDA 1Q0GA 2WGZA 3K1HA 4KC9A 2I7BA 2J46A 2QLAA 4A2NB 3IQCA 5CQMX 2YQSA 2YKZA 1YLMA 2J0AA 4U5HA 2R7OA 3IOIA 4N06A 1YDIA 3TK0A 1NWGB 1Z3IX 2GWWA 2OKUA 1I52A 2ZXOA 2YLGA 1QWJA 5C4DA 3B0PA 5HV9A 1TKNA 1LVWA 2RIZA 2NSFA 3C63A 3EGXB 3HNKA 4LLCA 4ONSA 2XL4A 1G5ZA 1MNEA 4HO3A 3C8GD 1ZW3A 3AOUA 3CU0A 4D11C 1RKEB 2CNWD 2VCAA 1G1LA 4M2AA 4WJ0A 1G3LA 4I1OB 1RJ9A 1TW1A 4LW6A 4HE8D 1YZCA 1TWGA 3OC9A 4OIPF 1H7TA 4BJ1A 1FRWA 4G87A 3DK5A 3B0UX 3ITFA 1O7QA 4NAKA 3TQDA 4HO4A 3ZGGA 4OINF 4IARA 2KQ9A 3JYYA 2IXNA 1T6QA 2VFZA 1QG8A 4NTBA 3MYFA 1G95A
chains in the Genus database with same CATH topology
1ZCVA 5DS5A 1PD1A 2CU2A 4K6RA 3Q6NA 1G97A 2GGOA 1M56C 4Y7VA 2P7VA 3EHMA 1VGWA 3RKOF 4CS8C 1S4OA 2VSHA 2KW3C 1WT2A 4DDZA 5J49A 1OCRC 1BR4A 3OWTA 2P73A 1TZFA 3VAYA 1FO8A 1R7VA 4K7BA 2XMEA 3LNRA 2W0WA 1WGWA 3JYHA 4UEGA 4U5GA 5FU8A 3UMHA 1HJJA 3K6BA 2YQJA 4MYBA 2JCJA 4G3SA 2FFUA 2O1GA 5EJ1A 1IINA 3ZGFA 4I3MA 4OIRF 1VZXA 2APCA 5AJNA 3AG1C 1FXOA 1VH1A 2WAWA 1H5SC 2Y6PA 2HV7A 1NKHB 3SXEA 1FTSA 5B1AC 3PNNA 4C2SA 1HM0A 2VK9A 4I1MA 5IDTA 4PJNA 3L0IA 3T6JA 3DM9B 4GBPA 3I0JA 4KNXA 2RJ7A 4KNVA 1FMWA 3EQLF 3FVYA 4CIHA 2ZXPA 3RSBA 4HO8A 3GANA 3RFYA 1O87A 1H5RB 3HL3A 1YP3A 4Y7GA 4D0ZA 1ZI5A 1ZHYA 4FRQA 1QLEC 4B4MA 1JVDA 2ICYA 1H7QA 1MC3A 2G3VA 4DVZA 1BR1A 3OH4A 1PZTA 2PX3A 3UMIA 3I0CA 1H5SA 3EGXA 3NG1A 1H5SB 1JYKA 1R7XA 2RJ4A 1V55C 4Q7CA 3RMVA 3EPVA 3NKDA 1H7HA 2D7IA 2OEFA 4EEGA 3DJNB 2A8UA 1EZIA 2A69F 2RITA 3JUJA 4HEAJ 5BXCA 4ASYA 2EIKC 4P00A 2X60A 4FCEA 2Y4JA 2EIJC 4XLPF 4FQWA 3SXDA 3LAYA 2NUPA 1OMZA 3CKOA 1M2VA 3ZVRA 2FYBA 4Y9XA 1JVGA 1Z90A 2QTVA 5IDSA 4C7OA 1ZU5A 2IYLD 3ASOC 1KWSA 4U5BE 1ZCTA 3E25A 5CQLX 2WZGA 4JJGA 2V0IA 3OH0A 3QVBA 4PJJA 5AJOA 5C1HA 3T7MA 3SYNA 1E5KA 2V0LA 1ZCUA 3POLA 3U0XA 3LLKA 2YQCA 4KQLA 1WT0A 1VMAA 5KYYB 1NU9C 1OKKD 2EILC 4QI0A 2A6EF 3AG4C 3KMIA 2O1FA 1O0RA 2WVLA 3E26A 5T3WA 3OH1A 1SZIA 4AC3A 1FWYA 3NKEA 4YS8A 1IZMA 3OKRA 4NAIA 4O6YA 4KT7A 4IJJA 3S0XA 1VH3A 1ZCYA 3AG3C 1ON6A 4U5FE 2ZPAA 1LL2A 4Y63A 1QZXA 3EGDB 3RMWA 1FO9A 3R3IA 3SXCA 1VYIA 4EEAA 3ZC4A 4YT4A 1R81A 3IOJA 1ZIZA 4CVHA 4FCUA 5KYUB 3GODA 4U5CE 2XMHA 4FRHA 5CMGX 5C49A 4FRPA 2E87A 2Y4KA 4YN0B 2OEGA 3V8YA 3L34A 3FWWA 2R7QA 4ASJA 2WL8A 3SXGA 1WT3A 2QGIA 2CDQA 3CQZA 4FRLA 2V0HA 3K33A 4CSAC 3PMRA 1FFHA 3EH2A 3H65A 1G8OA 2PX7A 1MP5A 5CQOA 1IW7F 1V54C 2J0WA 2WZLA 1VGTA 2AM4A 2NXVA 2A8WA 3HJCA 3EG9A 2P6VA 4KBLA 4KNWA 2Z87A 4O79A 5CMFX 4D11A 2J7PA 3KIAA 1GX0A 3V0QA 2E3DA 5I1FA 3U2VA 3DD7A 1FGXA 1M57C 2VB6A 4LW3A 3SX3A 1N1CA 3SEOA 3TD7A 2WB7A 4EBBA 1LL0A 1S4PA 2I5EA 1ZJ0A 4O6NA 4PJLA 3OAMA 2MWQA 4FRBA 2Y39A 5L6SA 3T7OA 3EFOB 1LVKA 1MMNA 1OKKA 1ST6A 2J7PD 3M1CB 1O5HA 5KYYA 3ZIBA 3V0MA 2EIMC 4G7OF 2Q9BA 3AG2C 3KKBA 1JPNA 2BO6A 4CS9A 2Q4JA 1WVCA 2L81A 2GGQA 4ULWA 3D8VA 4O7GA 1GWWA 3GUEA 4FWVA 1M2VB 2YHSA 3ABMC 3MLGA 4QDLA 2O1HA 3K8EA 5IY5C 4XWJA 3HTKC 2HV6A 1ZHZA 3X1OA 4HG6A 3LS0A 4YJWA 4I44A 2XRHA 1H7FA 1NHEB 3ST8A 2WVOA 5D92A 2FYAA 2AECA 2WEEA 2J9VA 5C36A 2Y3BA 1R7TA 3I0HA 4KC4A 1ZJOA 4HFFB 2IXOA 3NRHA 1OMXA 3F1CA 3Q4SA 3SX5A 1FGGA 4EE5A 1FZWA 2I8BA 2X5ZA 5FU0A 4CJBA 3QMKA 2JCKA 1G8XA 4XLNF 4DBRA 3JT1A 2M4EA 5DLJA 4L41C 2DYSC 4BJ5C 3U2XA 4EEOA 2Y3HA 1GX4A 1SMYF 1SS9A 2VS5A 1OQMB 4G3PA 4JD0A 1W77A 4MIXA 2B0JA 4CBEA 1VGZA 4RDAA 1Z23A 2Y7AA 3F46A 2QKXA 1W57A 4LERA 1TWCA 2NG1A 3DUVA 3JUKA 4FRMA 3EG9B 3I4UA 4HO5A 5C8RA 2QH5A 3NYLA 4KRVA 1W2WA 2XSEA 5BUOA 5FUHA 3W8IA 1QGSA 2PF4E 3RIPA 2Y3DA 1MP3A 3RYLA 4KC1A 3S28A 3CKNA 4M28A 4Y6NA 1K4VA 2YCMA 3IOHA 4Y6UA 2VASA 4IRPA 5CQPA 1YP4A 4B4BA 2OCCC 3USRA 3V91A 5L6VA 2LSEA 3FOQA 2WE9A 1IIMA 2ZU9A 1GWVA 4EWCA 3FDQA 2R7VA 1LZIA 3B9QA 3N24A 2OI5A 2RIYA 2RJ6A 4D0TA 2J9UA 4PFOA 1V82A 5FYEA 3S27A 5CMHA 2YZSA 3K1IC 3O39A 3EE5A 1D1CA 2RJ1A 2CNWA 1TVYA 3OH3A 5KYNA 2VXMA 4Y7FA 2YEVA 3ZSUA 2NUTA 2VS4A 1GA8A 1J8MF 2OI6A 3I0DA 1ZI4A 5F5FA 3PKPA 2R7RA 4EE3A 1ZHXA 4YWQA 4B2WA 5D91A 4CJCA 1BR2A 2YC5A 1V83A 3UGOA 3O3PA 2PX0A 3E70C 4RBNA 1VM8A 4LLEA 3I0FA 5HS2A 2X5SA 4JURI 4BG0A 2Y69C 3I5QA 3V8ZA 5DQTA 3LLIA 2GFHA 1GQ9A 5E2QA 3IEEA 3PKQA 1D1AA 3LESA 1Z5ZA 2OI7A 1OCCC 3EH1A 2ZXRA 1KU2A 4OIQF 3F1YA 1VYKA 3HLZA 2IXPA 3FAJA 4NY3A 3S29A 1LS1A 1NMMB 1ZI1A 4GYTA 1MMGA 1WSZA 5C3DA 2NUTB 3NYJA 5T1DB 4FX5A 5L3VA 4HOCA 2W4MA 4Q5SF 1LKXA 2A1DD 4JVSA 3W2VA 4NALA 3N9WA 5C1LA 2Y4MA 3R2WA 3DAGA 5T3TA 2R7SA 2AM5A 4FIXA 1SF8A 1VOMA 3DJUB 2O9XA 3LS1A 3DJ4A 5EJZA 1ZJ1A 3D5NA 4KNRA 4Y7TA 2AM3A 2C0NA 1ZHJA 2VH3A 4C3EA 3U2UA 4FROA 4JCHA 2L9JA 2BO4A 1TWAA 4EEMA 2D7RA 3NGWA 5CMIA 2VXLA 1FG5N 2C03A 4AX2A 2DGJA 2DYRC 3UGPA 5CQNX 3N2ZB 5KYXA 1HV9A 3OEOA 5E33A 1Z63A 2AH9A 2WVMA 2OG2A 4CSAA 4YT5A 1H5TB 3QZCA 2W45A 2EINC 3EHNA 1NZEA 2J0XA 1S4NA 1FOAA 2Z86A 5C38A 5E3AA 2RJ0A 4HO9A 2V3CC 3U2WA 2JCOA 1PZYB 3K8DA 1XHBA 4HO0A 2H7OA 3SNHA 1NQIB 3EJNA 1Z6AA 5CI8A 4G7HF 1GQCA 1JV1A 2VD4A 1HM9A 3U2TA 4CJ8A 4IRUA 4E1KA 4J30B 3SZRA 1ON8A 4KPXA 2YESA 4IWBA 1H7LA 4AYLA 1G93A 2P6WA 1H3MA 2KNHA 4DOZA 2IOQA 4FRAA 3UNGC 3N0TA 4C7OB 4JW1A 4QI2A 5FTSA 2BO8A 4F4BA 3LEVA 2NUPB 2VS3A 1H5RA 4B4GA 1G23A 2BO7A 4P6IC 4C3BA 2J9WA 4OD5A 3SPTA 4W8KA 1O7OA 1D0ZA 1ZDFA 3V0OA 1D1BA 2G62A 3LJBA 3CGXA 3CKQA 4Y62A 3NYMA 5HSWA 3U0YA 4BJTA 2WVNA 4FRDA 3NDBB 2A68F 3EFOA 4E7ZA 4KXOA 4OD4A 5DDTA 2QY9A 3E9VA 5DS6A 2G3KA 4KI2A 2D0JA 3Q7GA 2I5KA 2FFHA 5KYUA 3DMDA 3X2QC 3PHF2 2V0JA 3BRKX 3V90A 1H5TA 3TZTA 2Z15A 3JSZA 2RJ5A 3F47A 2W4BA 4DECA 2CGEA 4HFKB 3W8HA 2ZU8A 1ZHWA 2R7UA 3BCVA 1FFTC 2H7VC 3UR3C 3I0KA 4U5EE 4ANJA 2FYDB 2P72A 5DQZA 4Y64A 2H7BA 2V26A 2J0BA 3KH2A 2V0KA 1ZU4A 4NANA 4JISA 4U5DE 3W2WA 2ICXA 5DVWA 5C3BA 4AK9A 1INIA 2PGVA 5JQQA 2IXMA 5F5HA 3UMKA 4BEJA 2ZXWC 4LACB 5EGYA 1D0YA 1HM8A 1H4DA 3I0IX 4J18A 1VZTA 3EZHA 3JCUQ 4B42A 4PFPA 4Y7UA 3O6XA 3KL4A 4BJ5A 2XWLA 1OCOC 3I5PA 2W0VA 2Y4LA 4ZLDA 4ZLCA 2AESA 3T4RA 2D5RB 5B3SC 4FESA 1INJA 1H4EA 1MP4A 3ABKC 3MX3A 3CKVA 1QGQA 4JJFA 5C48A 4Q4ZF 2CW0F 2Q3TA 4AYJA 1TR2A 1ZJ2A 3I0GA 1FR9A 3ZLLA 3DZAA 2UX8A 4AAWA 1ZJPA 1OCZC 1EYRA 5C1GA 1R80A 3SX8A 4G7ZF 1MMAA 3T6BA 2PA4A 3DM5A 4MQ9F 3JTJA 3DXJF 5KYWB 1LL3A 4O6MA 1PCXA 5FCLA 2XWMA 4R7PA 2RJ9A 2VSIA 5L3QA 3B0VC 2MYSA 2FGYA 4FREA 4G3QA 3AQCA 1H7GA 4AE4B 1ZI3A 3WG7C 2W9YA 4FIYA 2R7XA 3ECSA 3CZ6A 1G2VA 3Q80A 5C4FA 2J45A 3ABLC 3K7DA 4K0DA 4CS9C 1H4CA 2WZFA 1LZ7A 1LZ0A 1VPAA 5CMJA 5E3CA 3RH3A 4JZAA 5KYWA 2ZU7A 3SXBA 1FMVA 4BJ6A 5C3AA 2Q9CA 3I0LA 4ECMA 2WVKA 4KC2A 4BMAA 1NU7D 1H7EA 3VYWA 5EIYA 4PJMA 1S7ZA 4EE4A 4H4KC 2A6HF 2FYCB 1JPJA 2X51A 4DBQA 4BJ6C 3POVA 4B2XA 4HO6A 4CS8A 1NG1A 2C04A 1R7YA 3EGDA 3ASNC 1NF5B 1TW5A 3SX7A 2X65A 4M4KA 4CS7A 1G9RA 5B1BC 3CSKA 5EHHA 4D48A 3CKJA 3V0LA 4XWIA 3FHDA 5C4BA 2WGZA 3K1HA 4KC9A 2I7BA 2J46A 1FXJA 1FR8A 2R7TA 4A2NB 4AE4A 5CQMX 2YQSA 2J0AA 4P02A 5DS4A 1O23B 4U5HA 2R7OA 4RD9A 3IOIA 4G0HA 2KGOA 2PGYA 3ZF8A 5C4EA 3EZIA 2WVQA 4N06A 1R82A 2JCLA 4M2BA 5C47A 2AE7A 3V7OA 3OGZA 1WT1A 3USQA 1NWGB 3Q7UA 3SXAA 1VZUA 1Z3IX 2KJGA 1PD0A 3AQBA 2DPWA 1I52A 1ZDGA 3OA1A 2ZXOA 1QWJA 2RJ8A 5C4DA 4KPZA 2E8BA 1XZ6A 2FFVA 2FY7A 3B0PA 1VGUA 4EVWA 4X0RA 4E7SA 3I0EA 1TKNA 3WODF 1LVWA 2RIZA 5IFYA 4C3DA 2XXAB 2PFDA 2XXAA 3LW6A 3Q7LA 2AGDA 3EGXB 3T7NA 4LLCA 2XL4A 1MNEA 2YQHA 1R7UA 4HO3A 2PP4A 4HCQA 4DVYP 4DE7A 3CU0A 4HO2A 4IAOA 3OH2A 4B3UA 2Y3GA 4D11C 1H5SD 2CNWD 1G1LA 4MNDA 4M2AA 4WJ0A 1HJLA 1ZHTA 1G3LA 4I1OB 1RJ9A 1TW1A 1MNDA 4LW6A 2XWNA 4HE8D 3V0NA 1M2OA 3Q6MA 1TWGA 3V0PA 1JV3A 1TWHA 4B5BA 3OC9A 2BE5F 5FV9A 4PK4A 1VICA 1V84A 1MMDA 4OIPF 1JYLA 1H7TA 1YP2A 3DAFA 1W55A 4GEHA 4BJ1A 4M63A 3SP1A 3ZLKA 1VK5A 1D0XA 1FRWA 5CI9A 4G87A 3DK5A 3B0UX 3ITFA 1O7QA 2JD3A 4NAKA 5DDVA 3TQDA 2MZBA 4J32B 2RIXA 2R7WA 4YT2A 5KYXB 3JRTA 3ZG1A 4HO4A 1RJ9B 3D98A 3ZGGA 5C4CA 4OINF 1LZJA 4ARWA 1ZJ3A 2KQ9A 4XTKA 4IRQA 2IXNA 1YROB 4B6IA 2YC3A 2Q9AA 4YT8A 2VFZA 5AJPA 1J8YF 3K66A 1QG8A 4OIOF 4BQHA 1ZYRF 4ZDQA 1G95A 5FTVA 1G0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D91 A;  4MND A;  4O6M A;  4O6N A;  4Q7C A;  5D92 A; 
#chains in the Genus database with same CATH topology
 5DS5 A;  4K6R A;  2GGO A;  5L0G A;  3EHM A;  2VSH A;  2KW3 C;  3G4X A;  1WT2 A;  4DDZ A;  3UMH A;  2XL6 A;  1HJJ A;  4MYB A;  4G3S A;  1HMD A;  4I3M A;  3AG1 C;  1VH1 A;  2WAW A;  1NKH B;  3PNN A;  1HM0 A;  2VK9 A;  1GQA A;  2YRF A;  3RF3 A;  4KNV A;  1FMW A;  4CIH A;  2ZXP A;  4JTA B;  1O87 A;  2Q4F A;  1YP3 A;  1QLE C;  1XWJ A;  1JVD A;  2LD6 A;  2G3V A;  1BR1 A;  3EGX A;  3NG1 A;  1JYK A;  3RMV A;  3EPV A;  3ZTM A;  1H7H A;  3DJN B;  3C8G A;  3JUJ A;  1G4U S;  4JC7 A;  2Y4J A;  4P9F A;  2NUP A;  1OMZ A;  1QKR A;  3U3F A;  2WZG A;  2V0I A;  1Y4C A;  1ZCU A;  4KQL A;  5KYY B;  2EIL C;  2A6E F;  2O1F A;  2AU5 A;  2YL1 A;  1SZI A;  4AC3 A;  4NAI A;  1YZA A;  1ZCY A;  1VTM P;  4U5F E;  1LL2 A;  1QZX A;  4EEA A;  3ZC4 A;  4FCU A;  5KYU B;  3GOD A;  5CMG X;  2E87 A;  3CQZ A;  5A69 A;  3H2V A;  3EH2 A;  3H65 A;  2A8W A;  1T6U A;  4KBL A;  5CMF X;  4D11 A;  3ZDL A;  5I1F A;  1FR0 A;  1FGX A;  4ULV A;  2VB6 A;  3SXY A;  1N1C A;  2AVK A;  2XLW A;  4O6N A;  1HMO A;  4MS2 A;  4L6R A;  3V0M A;  4G7O F;  3KKB A;  4IGG A;  1JPN A;  1WVC A;  4O7G A;  1GWW A;  2YHS A;  3ABM C;  4QDL A;  2O1H A;  2EPK X;  2XRH A;  4H54 A;  1NHE B;  2PNO A;  3KPH A;  2FYA A;  5C36 A;  3US6 A;  4KC4 A;  4EE5 A;  1FZW A;  2X5Z A;  1HY5 A;  5BQG A;  3JT1 A;  1B68 A;  1T6I A;  1SS9 A;  4G3P A;  4JD0 A;  4R32 A;  3M79 A;  5AGF A;  5COM A;  3DUV A;  5JLI A;  3EG9 B;  3I4U A;  5C8R A;  2QH5 A;  4KRV A;  5FUH A;  3W8I A;  3RIP A;  4Y6N A;  4A4A A;  3IOH A;  2XM4 A;  4K1O A;  2XL8 A;  1YP4 A;  2OCC C;  3ZWI A;  5L6V A;  3NMJ A;  1IIM A;  2R7V A;  1T5O A;  1I5N A;  4NTF A;  4FRE A;  3O39 A;  5KYN A;  4Y7F A;  2YEV A;  4D0T A;  1GA8 A;  5F5F A;  1GS9 A;  1BR2 A;  1V83 A;  2HZ8 A;  3E70 C;  3I0F A;  1GM5 A;  3GM1 A;  3IEE A;  3PKQ A;  2LP4 A;  3LES A;  1OCC C;  3FAJ A;  2UUI A;  3NYJ A;  4Q5S F;  1LKX A;  3RQG A;  4CDV A;  3DAG A;  4FIX A;  1G4W R;  3LS1 A;  2L6H A;  4KNR A;  2AM3 A;  3IHU A;  4UDV A;  2BO4 A;  2D7R A;  3NGW A;  5CMI A;  2VXL A;  1XZQ A;  2XLH A;  3UGP A;  5CQN X;  3N2Z B;  3U3B A;  1HV9 A;  2AH9 A;  4YT5 A;  3QZC A;  2W45 A;  2J0X A;  1FOA A;  2Z86 A;  3C8G B;  3K8D A;  3SNH A;  1Z6A A;  5CI8 A;  2XLM A;  1HM9 A;  3U2T A;  4CJ8 A;  4KPX A;  1TFK B;  1G93 A;  2KNH A;  3N0T A;  4QI2 A;  5FTS A;  4F4B A;  4YL3 A;  2AWC A;  4EBK A;  4C3B A;  4OD5 A;  1OQC A;  1YAR O;  2G62 A;  2XLD A;  5HSW A;  4FRD A;  1E2X A;  5DDT A;  2OU6 A;  1A41 A;  1ZZP A;  3K1I A;  3F47 A;  2W4B A;  3BCV A;  2R7U A;  2H7V C;  3C8Z A;  2FYD B;  4NTA A;  5DQZ A;  4JIS A;  4U5D E;  3W2W A;  3KYI A;  5C3B A;  1INI A;  4E0H A;  2IXM A;  2JX0 A;  4BEJ A;  4N6C A;  4LAC B;  2AWY A;  5EGY A;  4PAC A;  3JCU Q;  2XWL A;  4BEM J;  2AES A;  2L7A A;  2D5R B;  3T4R A;  3I0I X;  1JR8 A;  3MX3 A;  4JJF A;  5C48 A;  2CW0 F;  1TR2 A;  1T01 A;  3C7J A;  1FR9 A;  1C17 M;  4AAW A;  1EYR A;  3MBG A;  2PA4 A;  5COF A;  3JTJ A;  2XWM A;  4R7P A;  3B0V C;  2FGY A;  1HE1 A;  2MYS A;  4AE4 B;  1ZI3 A;  3WG7 C;  4CJO A;  2J45 A;  4K0D A;  5CMJ A;  2QNL A;  2Q9C A;  4KC2 A;  4EE4 A;  2X51 A;  4DBQ A;  4HO6 A;  1NF5 B;  3TOL A;  5A6B A;  1FXJ A;  2R7T A;  3W4Y A;  2IM8 A;  5DS4 A;  4RD9 A;  3ZF8 A;  5C4E A;  5C47 A;  4DEC A;  4CX9 A;  2AE7 A;  1WT1 A;  4WGZ A;  3AQB A;  1ZDG A;  2E8B A;  2FY7 A;  1VGU A;  5L0I A;  4X0R A;  3V5Y A;  5IFY A;  2HSQ A;  2XXA B;  1WTY A;  2XXA A;  1NFO A;  1M6T A;  1JRA A;  2AGD A;  3Q7L A;  3VRC A;  1R7U A;  2PP4 A;  5A6K A;  4DE7 A;  4JTD B;  5L0H A;  4B3U A;  1BBH A;  2XWN A;  1QVX A;  3GOR A;  3Q6M A;  1JV3 A;  4B5B A;  1VB5 A;  4MVS A;  1MMD A;  4W8P A;  1OR3 A;  2GDC A;  3SP1 A;  1VK5 A;  2EPM X;  1LZJ A;  4ARW A;  1ZJ3 A;  1YRO B;  4B6I A;  3DE9 A;  2Q9A A;  1MQV A;  5AJP A;  4BQH A;  5FTV A;  1ZCV A;  1PD1 A;  3Q6N A;  4JRZ A;  4Y7V A;  3RKO F;  5JRA A;  1RXQ A;  3VAY A;  2DI3 A;  5FU8 A;  4U5G A;  2YQJ A;  3K6B A;  2FFU A;  3U0C A;  3ZGF A;  1VZX A;  5AJN A;  1FXO A;  2Y6P A;  2HMQ A;  3DM9 B;  4GBP A;  4KNX A;  3WHN A;  3EQL F;  3FVY A;  1C03 A;  4HO8 A;  2LFD A;  1H5R B;  1ZI5 A;  1ZHY A;  5A6J A;  1T9K A;  1MC3 A;  3OH4 A;  2PX3 A;  3UMI A;  1H5S A;  1R7X A;  1V55 C;  4Q7C A;  3NKD A;  2OEF A;  2D7I A;  2A8U A;  2A69 F;  3A11 A;  1FAP B;  4P00 A;  1AVO B;  4FQW A;  3ZVR A;  2FYB A;  4Y9X A;  4C7O A;  5IDS A;  1E5K A;  1V4A A;  2V0L A;  2YQC A;  1WT0 A;  1OKK D;  4QI0 A;  3AG4 C;  3KMI A;  5T3W A;  1WN0 A;  1FWY A;  4EHP A;  3GM2 A;  1IZM A;  4YS8 A;  3AG3 C;  1ORS C;  4Y63 A;  3O55 A;  3EGD B;  3RMW A;  3SXC A;  3S9O A;  3IOJ A;  5BQH A;  1VLT A;  2XMH A;  1EI7 A;  5C49 A;  1LIH A;  3HNI A;  3L34 A;  3FWW A;  4ASJ A;  2WL8 A;  4FRL A;  1YYJ A;  3K33 A;  4CSA C;  3PMR A;  2L6G A;  1MP5 A;  1V54 C;  3EG9 A;  2P6V A;  1YJG A;  3U2V A;  4LW3 A;  3SEO A;  4EBB A;  1S4P A;  3OAM A;  4FRB A;  2Y39 A;  1LVK A;  1MMN A;  2EPO A;  4CS9 A;  2Q4J A;  4Z9J A;  3U8P A;  2GGQ A;  3K8E A;  3DKA A;  3HTK C;  1ZHZ A;  4HG6 A;  1CPR A;  4YJW A;  4I44 A;  5K0I A;  4XPW A;  2J9V A;  1H9G A;  1R7T A;  3I0H A;  4HFF B;  4D4N A;  3PCV A;  3Q4S A;  2YLI A;  2ICW G;  4CJB A;  2JCK A;  1KTM A;  256B A;  1A7V A;  1G8X A;  4L41 C;  5DLJ A;  4BJ5 C;  1GX4 A;  1GGQ A;  1OQM B;  5JVE A;  4MIX A;  4CDA A;  1HE9 A;  1I4Z A;  1Z23 A;  1CGO A;  3VF0 A;  1W57 A;  4LER A;  2NG1 A;  3JUK A;  4FRM A;  1AUE A;  1YAU O;  3NYL A;  1W2W A;  2XSE A;  4NCQ A;  5BUO A;  2R9R B;  2KC3 A;  5C4C A;  3RYL A;  4KC1 A;  3CKN A;  4IRP A;  5CQP A;  4B4B A;  2TMV P;  3V91 A;  3SXM A;  3H2U A;  2LSE A;  5COG A;  2WE9 A;  3FOQ A;  2R02 A;  1GWV A;  4DRH B;  3FDQ A;  3N24 A;  2QE9 A;  1V82 A;  3S27 A;  3EE5 A;  1D1C A;  2CNW A;  1TVY A;  1YA9 A;  3JZ0 A;  3I0D A;  2OI6 A;  1J8M F;  3C62 A;  2R7R A;  5AC5 A;  4B2W A;  4CJC A;  2YC5 A;  4MW3 A;  3O3P A;  4RBN A;  4LLE A;  3O10 A;  4JUR I;  3I5Q A;  1JOG A;  3V8Z A;  2GFH A;  5E2Q A;  1Z5Z A;  2ZXR A;  2IXP A;  3HLZ A;  1LS1 A;  1ZI1 A;  3V5Z A;  5L3V A;  5T1D B;  2AP3 A;  4HOC A;  2W4M A;  3A9C A;  3W2V A;  5C1L A;  3N9W A;  3R2W A;  2AM5 A;  1OW8 A;  1SF8 A;  1UG7 A;  1CGN A;  4BPM A;  3FOP A;  3D5N A;  4FRO A;  4EEM A;  2OQM A;  1FG5 N;  2C03 A;  4AX2 A;  4IAQ A;  1S05 A;  3PDM P;  5KYX A;  3OEO A;  4NC3 A;  5E33 A;  1APC A;  2WVM A;  2YWA A;  3NMK A;  1PV3 A;  1H5T B;  5FZT A;  4YL1 A;  1U0B B;  2RJ0 A;  4HO9 A;  2HJ3 A;  2JCO A;  4HO0 A;  2VD4 A;  1GQC A;  1JV1 A;  4J30 B;  4IWB A;  1Z7Q c;  3UNG C;  3LEV A;  3AGT A;  3BEH A;  3TQO A;  5A6B D;  1OW6 A;  5TJ5 E;  1RCP A;  4B4G A;  1G23 A;  1O7O A;  1D0Z A;  1ZDF A;  3LJB A;  3CGX A;  3NDB B;  4E7Z A;  4KI2 A;  3Q7G A;  1AEP A;  2FFH A;  3RQF A;  3PHF 2;  2LK4 A;  5L0F A;  3M4C A;  2HFI A;  2RJ5 A;  4HFK B;  4XPY A;  4U5E E;  4ANJ A;  4Y64 A;  2J0B A;  2X0C A;  4NAN A;  1ZU4 A;  3FAP B;  3IQ6 A;  4XPX A;  1C02 A;  2PGV A;  1LE4 A;  3UMK A;  2ZXW C;  3T6G B;  4J18 A;  1VZT A;  4PFP A;  4Y7U A;  3O6X A;  1OCO C;  3JRM O;  3I5P A;  2W0V A;  4CJG A;  3NMI A;  4FES A;  4MW8 A;  1MP4 A;  1NSG B;  1QGQ A;  5F28 E;  4AYJ A;  1U89 A;  1YVI A;  5C1G A;  1MMA A;  3DM5 A;  3KYJ A;  4XEF A;  2ASR A;  1PCX A;  3M15 A;  2RJ9 A;  5L3Q A;  2R7X A;  3ECS A;  3CZ6 A;  1G2V A;  1YYX A;  3ABL C;  3K7D A;  1H4C A;  5E3C A;  3SXB A;  1FMV A;  4BJ6 A;  5C3A A;  1NFN A;  2WVK A;  1EA8 A;  4BMA A;  4PJM A;  1S7Z A;  3POV A;  4B2X A;  1ZVZ A;  2C04 A;  3ASN C;  2J9B A;  2OEX A;  4CS7 A;  1G9R A;  3HNJ A;  5EHH A;  3CKJ A;  3V0L A;  5JUA A;  4XWI A;  3R2P A;  3GEE A;  5L0D A;  3RVY A;  2HSB A;  4P02 A;  2PGY A;  1R82 A;  2JCL A;  4M2B A;  3V7O A;  3USQ A;  3Q7U A;  1VZU A;  2KJG A;  1PD0 A;  2DPW A;  2RJ8 A;  3B29 A;  2A0B A;  4EVW A;  3LW6 A;  3T7N A;  2HJM A;  4DVY P;  1Q0M A;  4IAO A;  2Y3G A;  4MND A;  1ZHT A;  1FNT c;  1MND A;  5L0C A;  3V0P A;  5BQI A;  5FV9 A;  4PK4 A;  4U9E A;  1V84 A;  1VIC A;  5EK0 A;  1YP2 A;  3DAF A;  1W55 A;  4GEH A;  1BZ4 A;  1SR2 A;  1D0X A;  1E85 A;  3U5S A;  1LI5 A;  2JD3 A;  2P1A A;  2MZB A;  4J32 B;  2RIX A;  2R7W A;  1H9T A;  2KYH A;  5KYX B;  3ZG1 A;  1RJ9 B;  4LDR A;  4IRQ A;  4XTK A;  2OJQ A;  4YT8 A;  1ZYR F;  3QW0 A;  2CYD A;  3LUT B;  2CU2 A;  1G97 A;  2P7V A;  1S4O A;  5J49 A;  1BR4 A;  3OWT A;  2P73 A;  3IQT A;  1TZF A;  1R7V A;  4K7B A;  4UEG A;  2W0W A;  1WGW A;  3JYH A;  4NQF A;  2JCJ A;  2O1G A;  3JSE O;  4OIR F;  2APC A;  4XQ1 A;  2HV7 A;  2B0H A;  5B1A C;  4C2S A;  5IDT A;  3L0I A;  3GAN A;  3RFY A;  3HL3 A;  4JTC B;  3QW1 A;  3RVZ A;  4DVZ A;  3MYI A;  2EPN A;  2OJE D;  1PZT A;  3SXK A;  3I0C A;  2RJ4 A;  4EEG A;  1EZI A;  5BXC A;  4HEA J;  4ASY A;  2EIK C;  2X60 A;  4FCE A;  3SXD A;  3CKO A;  1R5I D;  1JVG A;  2QTV A;  1ZU5 A;  2IYL D;  3ASO C;  4JIO A;  3E25 A;  4JJG A;  4PJJ A;  5C1H A;  3T7M A;  3U0X A;  3POL A;  3LLK A;  1VMA A;  3G4Z A;  1O0R A;  2LIG A;  3OKR A;  4O6Y A;  4IJJ A;  3S0X A;  1VH3 A;  1ON6 A;  4JKV A;  1ZW2 A;  2M64 A;  3R3I A;  1VYI A;  1R81 A;  1ZIZ A;  4CVH A;  2MHR A;  3ZQY A;  2BL2 A;  4MVO A;  2ZD9 A;  3QVZ A;  2I15 A;  2CDQ A;  1TQG A;  2V0H A;  1FFH A;  5CQO A;  2PX7 A;  2Q7R A;  1IW7 F;  2J0W A;  2AM4 A;  1VGT A;  2UUH A;  5JP7 A;  4KNW A;  2Z87 A;  2JPU A;  3KIA A;  1GX0 A;  2E3D A;  1JAF A;  3SX3 A;  1LL0 A;  5L6S A;  3EFO B;  1ST6 A;  2J7P D;  1O5H A;  5KYY A;  1Y6D A;  3ATP A;  3AG2 C;  3U9J A;  4ULW A;  2GA0 A;  4FWV A;  3MLG A;  1RMV A;  4XWJ A;  2HV6 A;  3LS0 A;  3ST8 A;  2WVO A;  5D92 A;  2AEC A;  2Y3B A;  2IXO A;  3NRH A;  1OMX A;  3F1C A;  3SX5 A;  2I8B A;  3FXH A;  5FU0 A;  5JS5 A;  2DYS C;  2RSE B;  2Y3H A;  1EQ1 A;  2VS5 A;  1RKC A;  1W77 A;  2YL0 A;  2Y7A A;  2QKX A;  4HO5 A;  1BDJ B;  3QVY A;  1DOV A;  1QGS A;  2PF4 E;  2Y3D A;  2VAS A;  2VC9 A;  3USR A;  5L0J A;  2ZU9 A;  1NLX A;  3TJ6 A;  4GQH A;  4EWC A;  2RJ6 A;  2OI5 A;  2QUP A;  5FYE A;  2YZS A;  3OH3 A;  4E18 A;  2RJ1 A;  3ZSU A;  4U9D A;  1LI7 A;  2EPL X;  4EE3 A;  3S90 A;  4YWQ A;  3UGO A;  4CDY A;  1EKY A;  5HS2 A;  2FAP B;  4DRJ B;  3R7C A;  2Y69 C;  1GQ9 A;  1OW7 A;  1D1A A;  5AC4 A;  4EIY A;  1KU2 A;  3F1Y A;  3JTL O;  1VYK A;  4NY3 A;  3S29 A;  4GYT A;  1LE2 A;  2IBF A;  2F22 A;  4FX5 A;  4IB4 A;  4CIP A;  2Y4M A;  5T3T A;  2VCB A;  2YLD A;  2O9X A;  3TUL A;  1ZJ1 A;  2NSG A;  2VH3 A;  4C3E A;  3U2U A;  4JCH A;  2XLE A;  1K05 A;  1Z63 A;  4CSA A;  3L1M A;  2HKV A;  5GPG B;  2EIN C;  1NZE A;  5C38 A;  5E3A A;  3T9O A;  1PZY B;  3AGU A;  2H7O A;  4IRU A;  4E1K A;  3SZR A;  1ON8 A;  2YES A;  4AYL A;  3DE8 A;  4DOZ A;  4FRA A;  4DRI B;  2YL7 A;  4P6I C;  2J9W A;  4EKW A;  2XLO A;  4BJT A;  3U0Y A;  2A68 F;  4MVQ A;  3CAX A;  2QY9 A;  3E9V A;  5DS6 A;  2G3K A;  4EBJ A;  5KYU A;  2V0J A;  1A0B A;  1H5T A;  1ORJ A;  3I0K A;  2H7B A;  2V26 A;  3KH2 A;  4AK9 A;  5JQQ A;  5F5H A;  2H8A A;  1D0Y A;  1HM8 A;  1H7I A;  1H4D A;  4MVU A;  4B42 A;  5CIV A;  2Q00 A;  4BJ5 A;  2Y4L A;  4ZLD A;  4ZLC A;  3I0E A;  1H4E A;  1INJ A;  2Q3T A;  1H6G A;  3I0G A;  4WAB A;  3DZA A;  3SX8 A;  1LPE A;  3DXJ F;  3U2M A;  5FCL A;  1OR2 A;  3AQC A;  1H7G A;  4JEB A;  1QSP A;  3Q80 A;  4CS9 C;  1LZ7 A;  1LZ0 A;  2WZF A;  1VPA A;  1OXK A;  1HW1 A;  3RH3 A;  4DXW A;  2YVK A;  3GM3 A;  1I4Y A;  3IPM O;  4ECM A;  1NU7 D;  2R05 A;  1H7E A;  3VYW A;  2XLV A;  1JPJ A;  2LQG A;  3FMS A;  4E0I A;  2GAQ A;  1R7Y A;  2HMZ A;  3EGD A;  1TW5 A;  3SX7 A;  2X65 A;  3GWN A;  3CSK A;  5C4B A;  1YA7 O;  4DJ9 A;  1FR8 A;  4AE4 A;  3RQE A;  4MVR A;  4WGY A;  1O23 B;  4G0H A;  2KGO A;  3EZI A;  2WVQ A;  3OGZ A;  2HS5 A;  3SXA A;  3OA1 A;  3LEO A;  4KPZ A;  1R4T A;  1QQ3 A;  4FAP B;  1XZ6 A;  2FFV A;  4E7S A;  3WOD F;  4C3D A;  2PFD A;  1LS4 A;  2YQH A;  4P9T A;  1O3U A;  4HCQ A;  4JE9 A;  4HO2 A;  3DI5 A;  2J8W A;  3OH2 A;  1H5S D;  3CEX A;  1HJL A;  2YQY A;  4E17 A;  3V0N A;  1M2O A;  1TWH A;  2BE5 F;  2LCH A;  1JYL A;  3MFN A;  1WAT A;  1TFO B;  4M63 A;  3RW0 A;  4AL1 A;  5CI9 A;  5DDV A;  4YT2 A;  3JRT A;  3D98 A;  1L7C A;  2YC3 A;  1J8Y F;  3K66 A;  4OIO F;  4ZDQ A;  3ZLK A;  1G0R A;  4MTO A;  1WAS A;  1HW2 A;  3IQ5 A;  1M56 C;  1VGW A;  4CS8 C;  1OCR C;  2LFF A;  1FO8 A;  2XME A;  4LDQ A;  3LNR A;  4ER9 A;  5EJ1 A;  1IIN A;  1H5S C;  4XEK A;  2PBE A;  3SXE A;  1FTS A;  4I1M A;  4PJN A;  3T6J A;  3M4B A;  3I0J A;  3GEI A;  2RJ7 A;  3RSB A;  4D4X A;  3LNM B;  1RKE A;  4Y7G A;  4D0Z A;  4FRQ A;  2D4U A;  4B4M A;  2ICY A;  1H7Q A;  1H5S B;  1E86 A;  1ORY A;  4JEA A;  2RIT A;  2HUJ A;  2EIJ C;  4XLP F;  3LAY A;  3L8I A;  1M2V A;  1Q0F A;  1Z90 A;  1KWS A;  4U5B E;  3U2L A;  1ZCT A;  5CQL X;  5AJO A;  3OH0 A;  3QVB A;  3SYN A;  1NU9 C;  2WVL A;  3E26 A;  3OH1 A;  1K04 A;  3BRJ A;  3NKE A;  1L3P A;  4KT7 A;  1OXB A;  2ZPA A;  3U9M A;  1FO9 A;  3DWW A;  1CGM E;  4YT4 A;  4U5C E;  4FRH A;  1JMW A;  4FRP A;  3V8Y A;  2Y4K A;  4YN0 B;  3ZTZ A;  2OEG A;  3J06 A;  4PR9 A;  2R7Q A;  1SYQ A;  3SXG A;  1WT3 A;  2QGI A;  3TOM A;  4XEV A;  1G8O A;  2WZL A;  2NXV A;  2YL3 A;  5JSL A;  5JT4 A;  2XS8 A;  3HJC A;  2NPU A;  2RD9 A;  3VM6 A;  4O79 A;  2R03 A;  2J7P A;  3V0Q A;  3DD7 A;  1M57 C;  4G78 A;  3TD7 A;  2WB7 A;  2I5E A;  1ZJ0 A;  4PJL A;  2MWQ A;  3T7O A;  3M1C B;  4Z9I A;  1OKK A;  3ZIB A;  2EIM C;  2P0N A;  2Q9B A;  2BO6 A;  1E84 A;  2L81 A;  4Z9H A;  3D8V A;  1A7E A;  3GUE A;  1M2V B;  3U8V A;  5IY5 C;  4MTG A;  3X1O A;  4YK5 A;  1H7F A;  4MVM A;  2KK1 A;  2WEE A;  3GEH A;  1ZJO A;  3TJ5 A;  3GWL A;  1FGG A;  3QMK A;  4XLN F;  4DBR A;  2M4E A;  3U2X A;  4EEO A;  4MVZ A;  1VLS A;  1SMY F;  3L8J A;  2B0J A;  4CBE A;  1VGZ A;  4RDA A;  3F46 A;  3SXZ A;  1TWC A;  4M28 A;  5A6A A;  1MP3 A;  3S28 A;  3WAQ A;  1K4V A;  2YCM A;  4Y6U A;  1F1M A;  4MTF A;  1LZI A;  3B9Q A;  2RIY A;  2J9U A;  4PFO A;  5CMH A;  3K1I C;  3S84 A;  2VXM A;  2NUT A;  1DOW A;  2VS4 A;  3PKP A;  1ZI4 A;  1ZHX A;  1QPU A;  5D91 A;  2ETS A;  2PX0 A;  1VM8 A;  2VCC A;  4JCZ A;  2CCY A;  2X5S A;  4BG0 A;  5DQT A;  3LLI A;  2OI7 A;  3EH1 A;  4OIQ F;  2P61 A;  1NMM B;  1MMG A;  1WSZ A;  5C3D A;  2NUT B;  2A1D D;  4NAL A;  4JVS A;  2R25 A;  2R7S A;  1WOL A;  1VOM A;  3DJU B;  2OOC A;  3DJ4 A;  5EJZ A;  1A7D A;  4Y7T A;  2C0N A;  1XZP A;  3FOO A;  1ZHJ A;  2L9J A;  1TWA A;  2DGJ A;  2DYR C;  3V5X A;  2OG2 A;  2DB4 A;  3ZQV A;  3EHN A;  1S4N A;  1Q0K A;  2V3C C;  3HNL A;  3U2W A;  1XHB A;  1NQI B;  3EJN A;  4G7H F;  3G50 A;  1H7L A;  2P6W A;  1H3M A;  2IOQ A;  4YL0 A;  2L6F A;  4JW1 A;  4C7O B;  2KSF A;  2BO8 A;  2NUP B;  2VS3 A;  1H5R A;  2BO7 A;  3SPT A;  4W8K A;  3V0O A;  1UFB A;  1D1B A;  3CKQ A;  4Y62 A;  1Q0D A;  3NYM A;  2WVN A;  4KXO A;  3EFO A;  4OD4 A;  2D0J A;  2I5K A;  3DMD A;  3X2Q C;  3BRK X;  3V90 A;  3TZT A;  2Z15 A;  3JSZ A;  1K40 A;  2CGE A;  3W8H A;  2ZU8 A;  1ZHW A;  1FFT C;  3UR3 C;  4J7Y A;  2P72 A;  2V0K A;  3HKK A;  2ICX A;  5DVW A;  1E83 A;  3EZH A;  2A0U A;  4J7T A;  3KL4 A;  3CKV A;  5B3S C;  4LDK A;  3ABK C;  4Q4Z F;  1ZJ2 A;  1V74 B;  3ZLL A;  2UX8 A;  1ZJP A;  1OCZ C;  1R80 A;  2XS1 A;  4G7Z F;  3T6B A;  3QTH A;  4MQ9 F;  5KYW B;  1LL3 A;  4O6M A;  1WWP A;  1LM3 B;  4N6H A;  2VSI A;  4G3Q A;  2XM0 A;  4FIY A;  2W9Y A;  5C4F A;  5KYW A;  4JZA A;  2ZU7 A;  1CPQ A;  3B71 A;  3I0L A;  2OEV A;  5EIY A;  4AL0 A;  4H4K C;  2A6H F;  2FYC B;  4N4W A;  1NBB A;  4BJ6 C;  4CS8 A;  1NG1 A;  4M4K A;  3C18 A;  5B1B C;  1KNY A;  1U6H A;  4EUK B;  4D48 A;  3AJM A;  5B3I A;  2BC5 A;  3FHD A;  1Q0G A;  2WGZ A;  3K1H A;  4KC9 A;  2I7B A;  2J46 A;  2QLA A;  4A2N B;  3IQC A;  5CQM X;  2YQS A;  2YKZ A;  1YLM A;  2J0A A;  4U5H A;  2R7O A;  3IOI A;  4N06 A;  1YDI A;  3TK0 A;  1NWG B;  1Z3I X;  2GWW A;  2OKU A;  1I52 A;  2ZXO A;  2YLG A;  1QWJ A;  5C4D A;  3B0P A;  5HV9 A;  1TKN A;  1LVW A;  2RIZ A;  2NSF A;  3C63 A;  3EGX B;  3HNK A;  4LLC A;  4ONS A;  2XL4 A;  1G5Z A;  1MNE A;  4HO3 A;  3C8G D;  1ZW3 A;  3AOU A;  3CU0 A;  4D11 C;  1RKE B;  2CNW D;  2VCA A;  1G1L A;  4M2A A;  4WJ0 A;  1G3L A;  4I1O B;  1RJ9 A;  1TW1 A;  4LW6 A;  4HE8 D;  1YZC A;  1TWG A;  3OC9 A;  4OIP F;  1H7T A;  4BJ1 A;  1FRW A;  4G87 A;  3DK5 A;  3B0U X;  3ITF A;  1O7Q A;  4NAK A;  3TQD A;  4HO4 A;  3ZGG A;  4OIN F;  4IAR A;  2KQ9 A;  3JYY A;  2IXN A;  1T6Q A;  2VFZ A;  1QG8 A;  4NTB A;  3MYF A;  1G95 A; 
#chains in the Genus database with same CATH homology
 1ZCV A;  5DS5 A;  1PD1 A;  2CU2 A;  4K6R A;  3Q6N A;  1G97 A;  2GGO A;  1M56 C;  4Y7V A;  2P7V A;  3EHM A;  1VGW A;  3RKO F;  4CS8 C;  1S4O A;  2VSH A;  2KW3 C;  1WT2 A;  4DDZ A;  5J49 A;  1OCR C;  1BR4 A;  3OWT A;  2P73 A;  1TZF A;  3VAY A;  1FO8 A;  1R7V A;  4K7B A;  2XME A;  3LNR A;  2W0W A;  1WGW A;  3JYH A;  4UEG A;  4U5G A;  5FU8 A;  3UMH A;  1HJJ A;  3K6B A;  2YQJ A;  4MYB A;  2JCJ A;  4G3S A;  2FFU A;  2O1G A;  5EJ1 A;  1IIN A;  3ZGF A;  4I3M A;  4OIR F;  1VZX A;  2APC A;  5AJN A;  3AG1 C;  1FXO A;  1VH1 A;  2WAW A;  1H5S C;  2Y6P A;  2HV7 A;  1NKH B;  3SXE A;  1FTS A;  5B1A C;  3PNN A;  4C2S A;  1HM0 A;  2VK9 A;  4I1M A;  5IDT A;  4PJN A;  3L0I A;  3T6J A;  3DM9 B;  4GBP A;  3I0J A;  4KNX A;  2RJ7 A;  4KNV A;  1FMW A;  3EQL F;  3FVY A;  4CIH A;  2ZXP A;  3RSB A;  4HO8 A;  3GAN A;  3RFY A;  1O87 A;  1H5R B;  3HL3 A;  1YP3 A;  4Y7G A;  4D0Z A;  1ZI5 A;  1ZHY A;  4FRQ A;  1QLE C;  4B4M A;  1JVD A;  2ICY A;  1H7Q A;  1MC3 A;  2G3V A;  4DVZ A;  1BR1 A;  3OH4 A;  1PZT A;  2PX3 A;  3UMI A;  3I0C A;  1H5S A;  3EGX A;  3NG1 A;  1H5S B;  1JYK A;  1R7X A;  2RJ4 A;  1V55 C;  4Q7C A;  3RMV A;  3EPV A;  3NKD A;  1H7H A;  2D7I A;  2OEF A;  4EEG A;  3DJN B;  2A8U A;  1EZI A;  2A69 F;  2RIT A;  3JUJ A;  4HEA J;  5BXC A;  4ASY A;  2EIK C;  4P00 A;  2X60 A;  4FCE A;  2Y4J A;  2EIJ C;  4XLP F;  4FQW A;  3SXD A;  3LAY A;  2NUP A;  1OMZ A;  3CKO A;  1M2V A;  3ZVR A;  2FYB A;  4Y9X A;  1JVG A;  1Z90 A;  2QTV A;  5IDS A;  4C7O A;  1ZU5 A;  2IYL D;  3ASO C;  1KWS A;  4U5B E;  1ZCT A;  3E25 A;  5CQL X;  2WZG A;  4JJG A;  2V0I A;  3OH0 A;  3QVB A;  4PJJ A;  5AJO A;  5C1H A;  3T7M A;  3SYN A;  1E5K A;  2V0L A;  1ZCU A;  3POL A;  3U0X A;  3LLK A;  2YQC A;  4KQL A;  1WT0 A;  1VMA A;  5KYY B;  1NU9 C;  1OKK D;  2EIL C;  4QI0 A;  2A6E F;  3AG4 C;  3KMI A;  2O1F A;  1O0R A;  2WVL A;  3E26 A;  5T3W A;  3OH1 A;  1SZI A;  4AC3 A;  1FWY A;  3NKE A;  4YS8 A;  1IZM A;  3OKR A;  4NAI A;  4O6Y A;  4KT7 A;  4IJJ A;  3S0X A;  1VH3 A;  1ZCY A;  3AG3 C;  1ON6 A;  4U5F E;  2ZPA A;  1LL2 A;  4Y63 A;  1QZX A;  3EGD B;  3RMW A;  1FO9 A;  3R3I A;  3SXC A;  1VYI A;  4EEA A;  3ZC4 A;  4YT4 A;  1R81 A;  3IOJ A;  1ZIZ A;  4CVH A;  4FCU A;  5KYU B;  3GOD A;  4U5C E;  2XMH A;  4FRH A;  5CMG X;  5C49 A;  4FRP A;  2E87 A;  2Y4K A;  4YN0 B;  2OEG A;  3V8Y A;  3L34 A;  3FWW A;  2R7Q A;  4ASJ A;  2WL8 A;  3SXG A;  1WT3 A;  2QGI A;  2CDQ A;  3CQZ A;  4FRL A;  2V0H A;  3K33 A;  4CSA C;  3PMR A;  1FFH A;  3EH2 A;  3H65 A;  1G8O A;  2PX7 A;  1MP5 A;  5CQO A;  1IW7 F;  1V54 C;  2J0W A;  2WZL A;  1VGT A;  2AM4 A;  2NXV A;  2A8W A;  3HJC A;  3EG9 A;  2P6V A;  4KBL A;  4KNW A;  2Z87 A;  4O79 A;  5CMF X;  4D11 A;  2J7P A;  3KIA A;  1GX0 A;  3V0Q A;  2E3D A;  5I1F A;  3U2V A;  3DD7 A;  1FGX A;  1M57 C;  2VB6 A;  4LW3 A;  3SX3 A;  1N1C A;  3SEO A;  3TD7 A;  2WB7 A;  4EBB A;  1LL0 A;  1S4P A;  2I5E A;  1ZJ0 A;  4O6N A;  4PJL A;  3OAM A;  2MWQ A;  4FRB A;  2Y39 A;  5L6S A;  3T7O A;  3EFO B;  1LVK A;  1MMN A;  1OKK A;  1ST6 A;  2J7P D;  3M1C B;  1O5H A;  5KYY A;  3ZIB A;  3V0M A;  2EIM C;  4G7O F;  2Q9B A;  3AG2 C;  3KKB A;  1JPN A;  2BO6 A;  4CS9 A;  2Q4J A;  1WVC A;  2L81 A;  2GGQ A;  4ULW A;  3D8V A;  4O7G A;  1GWW A;  3GUE A;  4FWV A;  1M2V B;  2YHS A;  3ABM C;  3MLG A;  4QDL A;  2O1H A;  3K8E A;  5IY5 C;  4XWJ A;  3HTK C;  2HV6 A;  1ZHZ A;  3X1O A;  4HG6 A;  3LS0 A;  4YJW A;  4I44 A;  2XRH A;  1H7F A;  1NHE B;  3ST8 A;  2WVO A;  5D92 A;  2FYA A;  2AEC A;  2WEE A;  2J9V A;  5C36 A;  2Y3B A;  1R7T A;  3I0H A;  4KC4 A;  1ZJO A;  4HFF B;  2IXO A;  3NRH A;  1OMX A;  3F1C A;  3Q4S A;  3SX5 A;  1FGG A;  4EE5 A;  1FZW A;  2I8B A;  2X5Z A;  5FU0 A;  4CJB A;  3QMK A;  2JCK A;  1G8X A;  4XLN F;  4DBR A;  3JT1 A;  2M4E A;  5DLJ A;  4L41 C;  2DYS C;  4BJ5 C;  3U2X A;  4EEO A;  2Y3H A;  1GX4 A;  1SMY F;  1SS9 A;  2VS5 A;  1OQM B;  4G3P A;  4JD0 A;  1W77 A;  4MIX A;  2B0J A;  4CBE A;  1VGZ A;  4RDA A;  1Z23 A;  2Y7A A;  3F46 A;  2QKX A;  1W57 A;  4LER A;  1TWC A;  2NG1 A;  3DUV A;  3JUK A;  4FRM A;  3EG9 B;  3I4U A;  4HO5 A;  5C8R A;  2QH5 A;  3NYL A;  4KRV A;  1W2W A;  2XSE A;  5BUO A;  5FUH A;  3W8I A;  1QGS A;  2PF4 E;  3RIP A;  2Y3D A;  1MP3 A;  3RYL A;  4KC1 A;  3S28 A;  3CKN A;  4M28 A;  4Y6N A;  1K4V A;  2YCM A;  3IOH A;  4Y6U A;  2VAS A;  4IRP A;  5CQP A;  1YP4 A;  4B4B A;  2OCC C;  3USR A;  3V91 A;  5L6V A;  2LSE A;  3FOQ A;  2WE9 A;  1IIM A;  2ZU9 A;  1GWV A;  4EWC A;  3FDQ A;  2R7V A;  1LZI A;  3B9Q A;  3N24 A;  2OI5 A;  2RIY A;  2RJ6 A;  4D0T A;  2J9U A;  4PFO A;  1V82 A;  5FYE A;  3S27 A;  5CMH A;  2YZS A;  3K1I C;  3O39 A;  3EE5 A;  1D1C A;  2RJ1 A;  2CNW A;  1TVY A;  3OH3 A;  5KYN A;  2VXM A;  4Y7F A;  2YEV A;  3ZSU A;  2NUT A;  2VS4 A;  1GA8 A;  1J8M F;  2OI6 A;  3I0D A;  1ZI4 A;  5F5F A;  3PKP A;  2R7R A;  4EE3 A;  1ZHX A;  4YWQ A;  4B2W A;  5D91 A;  4CJC A;  1BR2 A;  2YC5 A;  1V83 A;  3UGO A;  3O3P A;  2PX0 A;  3E70 C;  4RBN A;  1VM8 A;  4LLE A;  3I0F A;  5HS2 A;  2X5S A;  4JUR I;  4BG0 A;  2Y69 C;  3I5Q A;  3V8Z A;  5DQT A;  3LLI A;  2GFH A;  1GQ9 A;  5E2Q A;  3IEE A;  3PKQ A;  1D1A A;  3LES A;  1Z5Z A;  2OI7 A;  1OCC C;  3EH1 A;  2ZXR A;  1KU2 A;  4OIQ F;  3F1Y A;  1VYK A;  3HLZ A;  2IXP A;  3FAJ A;  4NY3 A;  3S29 A;  1LS1 A;  1NMM B;  1ZI1 A;  4GYT A;  1MMG A;  1WSZ A;  5C3D A;  2NUT B;  3NYJ A;  5T1D B;  4FX5 A;  5L3V A;  4HOC A;  2W4M A;  4Q5S F;  1LKX A;  2A1D D;  4JVS A;  3W2V A;  4NAL A;  3N9W A;  5C1L A;  2Y4M A;  3R2W A;  3DAG A;  5T3T A;  2R7S A;  2AM5 A;  4FIX A;  1SF8 A;  1VOM A;  3DJU B;  2O9X A;  3LS1 A;  3DJ4 A;  5EJZ A;  1ZJ1 A;  3D5N A;  4KNR A;  4Y7T A;  2AM3 A;  2C0N A;  1ZHJ A;  2VH3 A;  4C3E A;  3U2U A;  4FRO A;  4JCH A;  2L9J A;  2BO4 A;  1TWA A;  4EEM A;  2D7R A;  3NGW A;  5CMI A;  2VXL A;  1FG5 N;  2C03 A;  4AX2 A;  2DGJ A;  2DYR C;  3UGP A;  5CQN X;  3N2Z B;  5KYX A;  1HV9 A;  3OEO A;  5E33 A;  1Z63 A;  2AH9 A;  2WVM A;  2OG2 A;  4CSA A;  4YT5 A;  1H5T B;  3QZC A;  2W45 A;  2EIN C;  3EHN A;  1NZE A;  2J0X A;  1S4N A;  1FOA A;  2Z86 A;  5C38 A;  5E3A A;  2RJ0 A;  4HO9 A;  2V3C C;  3U2W A;  2JCO A;  1PZY B;  3K8D A;  1XHB A;  4HO0 A;  2H7O A;  3SNH A;  1NQI B;  3EJN A;  1Z6A A;  5CI8 A;  4G7H F;  1GQC A;  1JV1 A;  2VD4 A;  1HM9 A;  3U2T A;  4CJ8 A;  4IRU A;  4E1K A;  4J30 B;  3SZR A;  1ON8 A;  4KPX A;  2YES A;  4IWB A;  1H7L A;  4AYL A;  1G93 A;  2P6W A;  1H3M A;  2KNH A;  4DOZ A;  2IOQ A;  4FRA A;  3UNG C;  3N0T A;  4C7O B;  4JW1 A;  4QI2 A;  5FTS A;  2BO8 A;  4F4B A;  3LEV A;  2NUP B;  2VS3 A;  1H5R A;  4B4G A;  1G23 A;  2BO7 A;  4P6I C;  4C3B A;  2J9W A;  4OD5 A;  3SPT A;  4W8K A;  1O7O A;  1D0Z A;  1ZDF A;  3V0O A;  1D1B A;  2G62 A;  3LJB A;  3CGX A;  3CKQ A;  4Y62 A;  3NYM A;  5HSW A;  3U0Y A;  4BJT A;  2WVN A;  4FRD A;  3NDB B;  2A68 F;  3EFO A;  4E7Z A;  4KXO A;  4OD4 A;  5DDT A;  2QY9 A;  3E9V A;  5DS6 A;  2G3K A;  4KI2 A;  2D0J A;  3Q7G A;  2I5K A;  2FFH A;  5KYU A;  3DMD A;  3X2Q C;  3PHF 2;  2V0J A;  3BRK X;  3V90 A;  1H5T A;  3TZT A;  2Z15 A;  3JSZ A;  2RJ5 A;  3F47 A;  2W4B A;  4DEC A;  2CGE A;  4HFK B;  3W8H A;  2ZU8 A;  1ZHW A;  2R7U A;  3BCV A;  1FFT C;  2H7V C;  3UR3 C;  3I0K A;  4U5E E;  4ANJ A;  2FYD B;  2P72 A;  5DQZ A;  4Y64 A;  2H7B A;  2V26 A;  2J0B A;  3KH2 A;  2V0K A;  1ZU4 A;  4NAN A;  4JIS A;  4U5D E;  3W2W A;  2ICX A;  5DVW A;  5C3B A;  4AK9 A;  1INI A;  2PGV A;  5JQQ A;  2IXM A;  5F5H A;  3UMK A;  4BEJ A;  2ZXW C;  4LAC B;  5EGY A;  1D0Y A;  1HM8 A;  1H4D A;  3I0I X;  4J18 A;  1VZT A;  3EZH A;  3JCU Q;  4B42 A;  4PFP A;  4Y7U A;  3O6X A;  3KL4 A;  4BJ5 A;  2XWL A;  1OCO C;  3I5P A;  2W0V A;  2Y4L A;  4ZLD A;  4ZLC A;  2AES A;  3T4R A;  2D5R B;  5B3S C;  4FES A;  1INJ A;  1H4E A;  1MP4 A;  3ABK C;  3MX3 A;  3CKV A;  1QGQ A;  4JJF A;  5C48 A;  4Q4Z F;  2CW0 F;  2Q3T A;  4AYJ A;  1TR2 A;  1ZJ2 A;  3I0G A;  1FR9 A;  3ZLL A;  3DZA A;  2UX8 A;  4AAW A;  1ZJP A;  1OCZ C;  1EYR A;  5C1G A;  1R80 A;  3SX8 A;  4G7Z F;  1MMA A;  3T6B A;  2PA4 A;  3DM5 A;  4MQ9 F;  3JTJ A;  3DXJ F;  5KYW B;  1LL3 A;  4O6M A;  1PCX A;  5FCL A;  2XWM A;  4R7P A;  2RJ9 A;  2VSI A;  5L3Q A;  3B0V C;  2MYS A;  2FGY A;  4FRE A;  4G3Q A;  3AQC A;  1H7G A;  4AE4 B;  1ZI3 A;  3WG7 C;  2W9Y A;  4FIY A;  2R7X A;  3ECS A;  3CZ6 A;  1G2V A;  3Q80 A;  5C4F A;  2J45 A;  3ABL C;  3K7D A;  4K0D A;  4CS9 C;  1H4C A;  2WZF A;  1LZ7 A;  1LZ0 A;  1VPA A;  5CMJ A;  5E3C A;  3RH3 A;  4JZA A;  5KYW A;  2ZU7 A;  3SXB A;  1FMV A;  4BJ6 A;  5C3A A;  2Q9C A;  3I0L A;  4ECM A;  2WVK A;  4KC2 A;  4BMA A;  1NU7 D;  1H7E A;  3VYW A;  5EIY A;  4PJM A;  1S7Z A;  4EE4 A;  4H4K C;  2A6H F;  2FYC B;  1JPJ A;  2X51 A;  4DBQ A;  4BJ6 C;  3POV A;  4B2X A;  4HO6 A;  4CS8 A;  1NG1 A;  2C04 A;  1R7Y A;  3EGD A;  3ASN C;  1NF5 B;  1TW5 A;  3SX7 A;  2X65 A;  4M4K A;  4CS7 A;  1G9R A;  5B1B C;  3CSK A;  5EHH A;  4D48 A;  3CKJ A;  3V0L A;  4XWI A;  3FHD A;  5C4B A;  2WGZ A;  3K1H A;  4KC9 A;  2I7B A;  2J46 A;  1FXJ A;  1FR8 A;  2R7T A;  4A2N B;  4AE4 A;  5CQM X;  2YQS A;  2J0A A;  4P02 A;  5DS4 A;  1O23 B;  4U5H A;  2R7O A;  4RD9 A;  3IOI A;  4G0H A;  2KGO A;  2PGY A;  3ZF8 A;  5C4E A;  3EZI A;  2WVQ A;  4N06 A;  1R82 A;  2JCL A;  4M2B A;  5C47 A;  2AE7 A;  3V7O A;  3OGZ A;  1WT1 A;  3USQ A;  1NWG B;  3Q7U A;  3SXA A;  1VZU A;  1Z3I X;  2KJG A;  1PD0 A;  3AQB A;  2DPW A;  1I52 A;  1ZDG A;  3OA1 A;  2ZXO A;  1QWJ A;  2RJ8 A;  5C4D A;  4KPZ A;  2E8B A;  1XZ6 A;  2FFV A;  2FY7 A;  3B0P A;  1VGU A;  4EVW A;  4X0R A;  4E7S A;  3I0E A;  1TKN A;  3WOD F;  1LVW A;  2RIZ A;  5IFY A;  4C3D A;  2XXA B;  2PFD A;  2XXA A;  3LW6 A;  3Q7L A;  2AGD A;  3EGX B;  3T7N A;  4LLC A;  2XL4 A;  1MNE A;  2YQH A;  1R7U A;  4HO3 A;  2PP4 A;  4HCQ A;  4DVY P;  4DE7 A;  3CU0 A;  4HO2 A;  4IAO A;  3OH2 A;  4B3U A;  2Y3G A;  4D11 C;  1H5S D;  2CNW D;  1G1L A;  4MND A;  4M2A A;  4WJ0 A;  1HJL A;  1ZHT A;  1G3L A;  4I1O B;  1RJ9 A;  1TW1 A;  1MND A;  4LW6 A;  2XWN A;  4HE8 D;  3V0N A;  1M2O A;  3Q6M A;  1TWG A;  3V0P A;  1JV3 A;  1TWH A;  4B5B A;  3OC9 A;  2BE5 F;  5FV9 A;  4PK4 A;  1VIC A;  1V84 A;  1MMD A;  4OIP F;  1JYL A;  1H7T A;  1YP2 A;  3DAF A;  1W55 A;  4GEH A;  4BJ1 A;  4M63 A;  3SP1 A;  3ZLK A;  1VK5 A;  1D0X A;  1FRW A;  5CI9 A;  4G87 A;  3DK5 A;  3B0U X;  3ITF A;  1O7Q A;  2JD3 A;  4NAK A;  5DDV A;  3TQD A;  2MZB A;  4J32 B;  2RIX A;  2R7W A;  4YT2 A;  5KYX B;  3JRT A;  3ZG1 A;  4HO4 A;  1RJ9 B;  3D98 A;  3ZGG A;  5C4C A;  4OIN F;  1LZJ A;  4ARW A;  1ZJ3 A;  2KQ9 A;  4XTK A;  4IRQ A;  2IXN A;  1YRO B;  4B6I A;  2YC3 A;  2Q9A A;  4YT8 A;  2VFZ A;  5AJP A;  1J8Y F;  3K66 A;  1QG8 A;  4OIO F;  4BQH A;  1ZYR F;  4ZDQ A;  1G95 A;  5FTV A;  1G0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...