5D91A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 115
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d91A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d91A01
5D91A 5D92A 4O6NA 4MNDA 4Q7CA 4O6MA
chains in the Genus database with same CATH superfamily
3I0EA 5DVWA 3SXYA 1FGXA 1QGSA 3CSKA 2YQCA 2A1DD 4M2AA 3RMVA 2P61A 5C4CA 1TQGA 5HSWA 4EE3A 1INIA 4EVWA 2LK4A 5DS4A 2QKXA 2Z15A 4JISA 2NUTA 4BJTA 2Q00A 3ASNC 3ZLLA 4AYJA 2PX0A 5JS5A 2IYLD 4P9TA 3USQA 1GWWA 5JSLA 1NU7D 3SX8A 1YJGA 4NALA 3I0FA 4OD4A 5E33A 2XLEA 5L6SA 2TMVP 5IY5C 4IAOA 3MYIA 2DYRC 4FQWA 3DAGA 3LEVA 1YA9A 4WGZA 4IGGA 2PNOA 5AC5A 2YHSA 2LIGA 1ZJ1A 3GM3A 4FRHA 1FMWA 5B3IA 4OIOF 4XPYA 3FOPA 2VK9A 2XL8A 1V74B 4PJNA 4G7HF 2BO4A 3D98A 1OCOC 3Q7UA 3UMKA 1QWJA 4O6MA 1NWGB 5DLJA 3I0CA 3B0UX 2R7RA 3SXGA 4U9EA 4Y6UA 3T7NA 1O87A 1LI7A 1JAFA 4BQHA 3PNNA 1H7QA 2EPMX 3K6BA 3GODA 4IRUA 3KYJA 2C03A 1H3MA 3EGXA 4P9FA 3LAYA 3U8PA 2IXNA 4H4KC 3D5NA 3EHNA 2YQHA 4IARA 3FMSA 3T6GB 1N1CA 2FFHA 4DECA 4O7GA 4MYBA 1LS1A 3U8VA 5L0DA 2VXLA 5DDTA 2X5ZA 4EUKB 4DBQA 2YEVA 3LUTB 3POVA 5CMFX 3ABMC 4XEFA 2EPLX 1CGME 5C3AA 4B3UA 1MP3A 1HW2A 5KYYB 4CJOA 3CU0A 3HNKA 1EI7A 3WAQA 4AAWA 5IFYA 5AJNA 5JLIA 2OI6A 1YYJA 3FXHA 5T1DB 3ITFA 4KXOA 4Y6NA 1LVWA 2BO6A 5CQMX 1PCXA 4BJ5C 3IEEA 4H54A 2J9VA 1MNDA 4U5GA 4PK4A 3X1OA 2A69F 4QI2A 2H7OA 1H9GA 4PJJA 4G78A 4U9DA 2J7PD 1LKXA 3SEOA 3JT1A 3MLGA 4QI0A 3VF0A 1DOVA 3WODF 1C03A 4D4NA 1G1LA 3CAXA 4XPWA 1S4OA 1FOAA 3V0PA 4ZDQA 1D0YA 4R7PA 3CGXA 3GEIA 4ECMA 3U9JA 3IHUA 1M56C 4Y63A 3T7OA 1R7XA 1WT3A 1NSGB 2R7UA 5EGYA 5CQPA 2RJ9A 5FZTA 4CSAA 3RKOF 4HO6A 4QDLA 4P02A 4ULVA 4K6RA 3ZQYA 2ETSA 2RITA 2KGOA 4D11A 2R05A 1HE9A 3EG9B 3JRMO 3UR3C 2WVOA 5CQOA 2BC5A 1LL2A 2YCMA 1D1BA 3Q80A 4YN0B 3M15A 1GQAA 4JRZA 4EEMA 3HL3A 3TQOA 3R7CA 3Q7GA 1UFBA 4OIQF 2IXOA 4I1OB 1G3LA 2JX0A 2HSQA 1U6HA 4BEJA 2R7TA 3H2VA 1HJJA 2AM3A 3QVBA 3O6XA 2AM5A 3AGUA 2RJ0A 1T9KA 1ZVZA 4UEGA 4FRBA 3S0XA 4D0TA 3V0LA 2XM4A 3ZWIA 3W8IA 2M64A 4AE4B 2IOQA 3SZRA 3Q7LA 3SXBA 1O7OA 4MIXA 3LLKA 1V82A 2OEVA 2J0XA 2OEFA 1CGOA 2RJ4A 1Z7Qc 2ICXA 1Z90A 1TFKB 3KH2A 4JVSA 3FVYA 2VSHA 2EIKC 4XPXA 3I0GA 2XXAB 4CJ8A 4I1MA 3NGWA 3UMIA 2KNHA 2E8BA 3CKVA 3CKNA 1YROB 3I0JA 1OKKD 4OINF 4I44A 5L6VA 3J06A 2Y3DA 3ZGFA 3DXJF 1A7VA 2A8WA 2CNWA 5L0CA 1R81A 1SYQA 3EZIA 1WN0A 1XZPA 3HNLA 3OGZA 4CSAC 1W77A 4XLNF 2P72A 4D4XA 1VOMA 2YESA 1ZJ0A 5C48A 3GANA 4D11C 3B9QA 3IOJA 3W4YA 3U2XA 4JZAA 2KK1A 4LW6A 4EEOA 2PX7A 4DVZA 1BR1A 2FFUA 2FAPB 3KYIA 5FTVA 1ZW3A 2YLIA 3USRA 4DRJB 4LDKA 3I5QA 4O79A 1VGZA 2RIXA 2OEGA 3JUJA 2QTVA 3PCVA 2PGVA 1JV1A 3EGDA 2JCKA 4IRQA 5C47A 2AH9A 1VICA 1LE2A 2YQJA 1ZHWA 3S27A 3RW0A 4HG6A 3AG4C 1WASA 5KYWA 4PFOA 3FOOA 1O5HA 3U3BA 2YZSA 2Q9BA 1O23B 3SXMA 2OOCA 1BZ4A 3VM6A 3RQEA 1CPRA 1H5SB 1TWCA 4NQFA 5AGFA 4JTDB 2ZXPA 1MP4A 2AWCA 2X5SA 4JIOA 2GGOA 3RVZA 1D0ZA 5GPGB 1ZI5A 2XWLA 1ZI3A 5C1GA 1H4EA 3U2MA 4Z9JA 1LIHA 3ZIBA 1HM8A 4ULWA 3NYJA 3KMIA 1FGGA 3DJUB 3AG3C 4YL3A 4EIYA 3UGPA 3U2TA 2GGQA 1Q0MA 5CQNX 3V90A 1NLXA 3ZTZA 1VLTA 1GA8A 5D91A 4CDVA 1H7GA 2J0WA 3NDBB 2P0NA 5A6KA 2Y4JA 4XWIA 2OKUA 4NANA 2YC3A 1ZW2A 2XRHA 2W9YA 2P6WA 4EEGA 4KPZA 3M4CA 1VYKA 4DVYP 3SP1A 2EIMC 4MTFA 3S9OA 2MZBA 2J7PA 2XSEA 2XLMA 1M2VB 3ATPA 4Y7TA 1SS9A 2OI7A 1LPEA 1MMAA 1AEPA 2W4MA 5C1HA 1VLSA 3BCVA 3K8DA 3T9OA 5DDVA 5CMJA 2YKZA 3M79A 3MYFA 2XL6A 3L0IA 5KYUB 2YWAA 3C7JA 2D4UA 1G0RA 3K8EA 5B3SC 3AQBA 5COMA 1OQMB 4B2XA 2VCCA 2IXMA 2HUJA 1OCZC 1TZFA 2R7VA 4KNVA 1BR4A 4F4BA 1ON8A 4CJBA 3S28A 2QY9A 1M6TA 4U5DE 4K0DA 3V0OA 2VB6A 1JYLA 1JPNA 3JRTA 1YZAA 3ASOC 4MTOA 2EPOA 2P73A 3LS1A 1QLEC 3PKPA 1RKEA 2CU2A 1HV9A 2VFZA 3EE5A 3AOUA 2X60A 1V55C 2Y39A 3V8YA 4JEAA 2RIZA 1V83A 3C62A 1OR3A 5E3AA 5EHHA 1APCA 2PGYA 3OWTA 4B5BA 2VCBA 1V84A 2RJ5A 1G5ZA 4U5FE 4ANJA 3C8GA 4ZLDA 3RQGA 4EWCA 1NU9C 3SNHA 2RJ6A 1LL0A 2DI3A 5JP7A 2G3KA 1GGQA 1H5SD 2RIYA 1ORSC 5C4DA 1A7DA 3JCUQ 2QE9A 4G7ZF 1SR2A 3UNGC 3O55A 3GEEA 1S7ZA 2VCAA 3RFYA 4N06A 2JCJA 1R7UA 2VASA 4C3DA 1I4YA 2A68F 3OEOA 2FYCB 1H6GA 5FUHA 5KYYA 3K66A 4Q5SF 3U2VA 4G0HA 4HO5A 1NFNA 1OKKA 5DS6A 2LSEA 1OW7A 1RJ9B 4BJ6A 4CS9C 2OI5A 1ZZPA 2IXPA 1PZYB 4WABA 2OG2A 4NTFA 1PD0A 3QW1A 2V0HA 1Z23A 1AVOB 1FR9A 1FO9A 2AWYA 1PZTA 5L0GA 3S90A 4EE5A 2PFDA 5F5HA 4FROA 1ZJPA 5BUOA 2LFFA 4HO4A 2NUPB 1Q0KA 5C3DA 2KC3A 3L34A 4NTAA 4YJWA 4HO0A 2YL1A 2Q4JA 5A6AA 3HNJA 4FCEA 3OH1A 1E5KA 4I3MA 2ZU8A 4RBNA 1TW1A 4B4GA 2Q9CA 2R7QA 4ER9A 2G62A 5CI8A 4CJGA 3WG7C 3S29A 1R7YA 3PHF2 5COGA 1R7TA 2QH5A 1O7QA 2L6GA 2ICWG 5DS5A 4CIHA 2R7SA 4C7OB 1FZWA 1W55A 3SXAA 1OXKA 3F1YA 3ABLC 1FAPB 5CQLX 2AGDA 1I5NA 2R7OA 2KQ9A 1NBBA 5DQZA 5CIVA 2WB7A 1BR2A 1YARO 1LZIA 5HV9A 3WHNA 3G4XA 3X2QC 4FRQA 2A6HF 3R2PA 2R7WA 2NUTB 5A6BA 1FR8A 4N6CA 1ZHYA 5C3BA 2E87A 2OEXA 2O9XA 2X51A 3GORA 3SXCA 3BRJA 4C3BA 1NG1A 2QLAA 3SXKA 3N2ZB 1JV3A 2UUIA 1QSPA 1HM0A 2CGEA 2EPKX 4KQLA 4JEBA 1Q0GA 3SXDA 4HFFB 4KC9A 2J0AA 3C8ZA 1Z3IX 3PMRA 1ZDGA 1D0XA 3L8IA 3SYNA 3LLIA 1G8OA 1E84A 3PKQA 4XWJA 1J8MF 2ZPAA 4ASYA 4MS2A 3AJMA 2NXVA 1XWJA 5T3WA 3ZTMA 2HV6A 5DQTA 5L3VA 2PP4A 1M57C 4U5CE 3HLZA 2XXAA 4E18A 1FXJA 3G50A 2WGZA 3QMKA 2VD4A 3DWWA 3Q6MA 4B2WA 1VPAA 3PDMP 4E0HA 4W8PA 4CS8A 1WWPA 4PFPA 1RCPA 4EBKA 3DM5A 2RJ1A 1OQCA 4KBLA 5C8RA 3F1CA 3OKRA 1Z6AA 2Y6PA 3EHMA 1YVIA 4Y9XA 4P6IC 2Y4KA 2I5EA 1FRWA 2FYDB 4BG0A 1JVDA 3OH2A 3IQ6A 2OJED 2WVKA 1Q0FA 4YT2A 4JTAB 2OU6A 4YS8A 4L6RA 2OCCC 2WE9A 3A11A 1KWSA 1U0BB 2FFVA 4C2SA 4DDZA 4Y7FA 2M4EA 2UUHA 3M1CB 5BQGA 3Q6NA 2XLDA 3V8ZA 4CVHA 3OC9A 4JD0A 4NAKA 2PF4E 1L7CA 2J46A 4JE9A 1ZI4A 3NMKA 4MVZA 4EEAA 5D92A 3RF3A 1OCRC 4AL1A 4YWQA 5BXCA 1YDIA 2XMHA 3FDQA 4NTBA 3ZG1A 4EBBA 2O1GA 5C36A 3AG1C 2DB4A 2YRFA 4JCHA 4LW3A 5EJ1A 1S4NA 1ZHJA 4CBEA 1PV3A 3EH2A 3KKBA 2AVKA 1ORYA 4K1OA 3LNRA 3MBGA 1ZDFA 3I0HA 4DE7A 2H7BA 1GQ9A 2V0JA 1JPJA 1EKYA 1WTYA 2L9JA 1LS4A 3DD7A 3U0YA 3GEHA 3NYLA 3VYWA 1G9RA 2GWWA 1JOGA 2WL8A 4AK9A 2KSFA 3LJBA 4EE4A 2KJGA 1NFOA 4HEAJ 3T6JA 1H4CA 2ZXRA 1HW1A 2NG1A 2VS5A 4Z9HA 4Y62A 2WVQA 3V5XA 1O0RA 4Y7UA 3U0CA 4Z9IA 1T6IA 3HTKC 4HE8D 1QQ3A 2I7BA 3K1IA 4JTCB 3QTHA 2FYAA 3V91A 3K1HA 4C3EA 2W0VA 2Z87A 1FFHA 5BQIA 1GM5A 5L0FA 4NAIA 2B0JA 4N6HA 3W8HA 1FFTC 2L81A 4FRDA 2HZ8A 4IAQA 1AUEA 2Q7RA 2Y3BA 5KYUA 1WATA 1I4ZA 2ZU9A 3W2VA 1JVGA 3ZDLA 4BPMA 4U5EE 5C4BA 1MMNA 3FAJA 5J49A 3U9MA 2MYSA 4FCUA 3M4BA 1VZUA 2HSBA 5IDSA 2H8AA 1QVXA 2BO8A 1HM9A 4DBRA 1VZTA 1H5RA 1G4US 2DPWA 4LLEA 4CX9A 5CMHA 1LZ7A 3JTJA 3ST8A 2L6HA 2MHRA 1ZIZA 4MQ9F 2MWQA 3V5YA 2AECA 1Y6DA 1OXBA 1GX0A 2WVLA 3EFOA 1E85A 1MMDA 3CZ6A 1GQCA 2J0BA 3NG1A 3UMHA 4ONSA 5FU0A 4OIRF 1INJA 2C04A 1NKHB 4Y7GA 1A41A 2Q4FA 2BE5F 1VB5A 1WSZA 4BEMJ 4J7YA 2CW0F 3ABKC 3RSBA 3IOHA 1BBHA 4FRAA 4KT7A 4MVMA 2A8UA 2QUPA 4P00A 4M4KA 1HE1A 3I0LA 3QW0A 4KNXA 1NMMB 3E25A 1VH3A 3C18A 3I0DA 4MNDA 1XHBA 3NKEA 3CKQA 3DE9A 1Y4CA 1H7TA 2HV7A 1QZXA 1GX4A 5I1FA 3H65A 2YL7A 1VTMP 4FRMA 2GAQA 2LFDA 3U5SA 4A4AA 1WT2A 2J9UA 1H7HA 2L7AA 3EGDB 4LDQA 1NF5B 1Z63A 1TR2A 1G8XA 1ZU4A 1W57A 2JPUA 4Q4ZF 3JYHA 5AJOA 5L3QA 1R4TA 4HCQA 3SXZA 2AU5A 2DYSC 4E17A 4U5HA 2VC9A 2NPUA 3QVYA 1TKNA 5IDTA 1H7EA 3B29A 2APCA 2NUPA 4KRVA 2LQGA 1H5TB 2R7XA 3DK5A 4FAPB 2RSEB 3LW6A 5EK0A 4NC3A 5FTSA 4MVSA 1ZJ3A 5C4FA 2Y3HA 4UDVA 1G4WR 5CMGX 2R03A 2HMZA 4PACA 3FAPB 4ZLCA 1SMYF 1FXOA 3LS0A 2WZFA 2BO7A 1FWYA 1WT0A 2LCHA 3DJ4A 4XTKA 1H7FA 1LE4A 3RYLA 4NCQA 2YL0A 4M28A 4HO2A 3N9WA 3ZLKA 2XLOA 3U2WA 4B6IA 4KNWA 1YP4A 1K05A 4E7ZA 1M2OA 3DM9B 3RH3A 4IB4A 1FR0A 5K0IA 4AX2A 2HS5A 4JKVA 4HFKB 4WJ0A 1C02A 1SZIA 4YT8A 2J8WA 3K7DA 1IINA 1TFOB 1SF8A 4LACB 1T01A 4XEVA 1C17M 3AQCA 4YL1A 1JRAA 2CNWD 1QPUA 3L8JA 2NSFA 1QGQA 4MVOA 3B0PA 1G93A 4GBPA 3V5ZA 4BJ1A 2VH3A 2ZXWC 1EZIA 4Y64A 1VZXA 4HOCA 2WZLA 3V0MA 2FYBA 1V54C 3RQFA 3S84A 2Y7AA 3IQ5A 2I5KA 5KYNA 4BJ5A 2QNLA 4ARWA 3NKDA 3HJCA 3DAFA 3CKOA 4MW8A 4D0ZA 3EPVA 3GUEA 2HFIA 1HY5A 4KI2A 2YLDA 3HNIA 4RDAA 3DMDA 5C4EA 1IIMA 3GWNA 1RKEB 5C1LA 5JUAA 4GQHA 2WAWA 2ICYA 4PJLA 1WVCA 1ORJA 2G3VA 1H7LA 1H4DA 5FYEA 2J45A 3TULA 2A6EF 3DI5A 4LERA 3NYMA 2R9RB 4J30B 2FGYA 2XLVA 1MP5A 3ZSUA 1GS9A 5FCLA 3I4UA 1XZQA 3C8GB 2RJ7A 2D7RA 1ZCUA 1F1MA 4RD9A 3EG9A 1RKCA 2IM8A 4IWBA 5KYXB 3JZ0A 4B4BA 5AC4A 1HJLA 1EA8A 4FIXA 2Y3GA 1QG8A 2QGIA 4FRLA 3F47A 2XS1A 2Y4LA 2FY7A 5JRAA 4CS7A 4JURI 5FV9A 2OQMA 4E7SA 4O6YA 3TD7A 2LD6A 4J32B 1ZHTA 3O39A 1E86A 4BJ6C 1HMDA 2H7VC 1ZCVA 4KC1A 2JCOA 4LLCA 3JSZA 2ZU7A 2YL3A 1W2WA 4BMAA 4JJFA 3D8VA 5BQHA 2A0UA 3IQCA 4K7BA 4CIPA 1YLMA 2XS8A 4JW1A 2V26A 2R25A 2GDCA 5FU8A 1MQVA 2YQYA 1Q0DA 3CQZA 1XZ6A 4MVUA 1OMZA 1DOWA 3TK0A 4AE4A 2W0WA 4Q7CA 2RJ8A 256BA 2HJMA 4FESA 3SXEA 2P6VA 4M63A 2J9BA 1YYXA 3JTLO 1RXQA 2CDQA 1A0BA 5C49A 2BL2A 2YVKA 3U2LA 4CDYA 1WT1A 1JMWA 3R3IA 4HO3A 4MVQA 2EILC 3ZVRA 3OH3A 3L1MA 1YZCA 5E3CA 5A6JA 4X0RA 3EGXB 1GWVA 1YP3A 3GM1A 4FRPA 2XL4A 1VH1A 1YP2A 4G87A 3SX5A 2Z86A 1TW5A 3V0QA 2GFHA 2R02A 1LVKA 2C0NA 3DE8A 3KPHA 4IJJA 1FO8A 3SPTA 3EJNA 3BRKX 1FTSA 1VK5A 3K33A 3LESA 3Q4SA 1LI5A 2W4BA 2ZXOA 4FREA 1E83A 2Q9AA 2DGJA 3RIPA 1MMGA 2ASRA 2X0CA 4FIYA 5E2QA 2AM4A 3POLA 4NY3A 2OJQA 2PBEA 4GYTA 1G23A 1VGTA 4AC3A 2O1HA 2X65A 3N0TA 3W2WA 3U0XA 2EINC 2V3CC 5TJ5E 1BDJB 2GA0A 1VM8A 1TVYA 4XQ1A 3AGTA 1S05A 4YL0A 3NRHA 1H7IA 1LM3B 1VGUA 2XLWA 4EKWA 1IZMA 3C8GD 2WEEA 1ZHXA 3OA1A 2D0JA 3DKAA 1H5SA 1CGNA 2KW3C 4JCZA 3R2WA 3E9VA 3UGOA 1FMVA 2P1AA 1OCCC 4FX5A 4W8KA 3QVZA 1ZJ2A 1WGWA 3EQLF 1JR8A 3DJNB 3KIAA 3MX3A 2VS3A 4CS8C 3RMWA 2WVMA 1IW7F 2Y69C 5HS2A 1EQ1A 3F46A 3ZC4A 4EBJA 4Y7VA 3MFNA 2XWMA 2AESA 1QKRA 1G97A 2I15A 5L0HA 2XWNA 3JSEO 1O3UA 3T4RA 3GM2A 3QZCA 1EYRA 4E0IA 1T6UA 3IOIA 1OMXA 3V7OA 1NQIB 4ASJA 4AYLA 2V0KA 4IRPA 1T5OA 1K40A 3EH1A 1YAUO 3I5PA 3KL4A 4LDRA 2O1FA 3NMIA 2ZD9A 1M2VA 3TZTA 3HKKA 3IQTA 1ZHZA 3JYYA 4HO8A 4FWVA 1RMVA 1V4AA 3TOMA 2YLGA 3H2UA 1NHEB 4E1KA 3EZHA 2WZGA 3LEOA 1B68A 4YT4A 2PA4A 3LNMB 1MNEA 2YQSA 5C38A 5COFA 4MVRA 2CYDA 4N4WA 1PD1A 4OD5A 1R7VA 2AE7A 4KNRA 1MC3A 1H5SC 3OH4A 3N24A 4U5BE 3T7MA 1LZ0A 5F28E 2W45A 1HMOA 3AG2C 1L3PA 1ZJOA 5EIYA 3IPMO 1ON6A 1U89A 3GWLA 1FG5N 3BEHA 1LL3A 2I8BA 1G2VA 1YA7O 2VXMA 1T6QA 2V0IA 3ZF8A 4GEHA 4DOZA 2KYHA 4DRIB 4J18A 4M2BA 2XMEA 1H5TA 1WOLA 4KC4A 3TOLA 3E70C 4MW3A 2VSIA 5B1BC 5A6BD 5JQQA 1I52A 4MTGA 4B4MA 5AJPA 5L0JA 1LZJA 2HMQA 4XLPF 4AL0A 4G3SA 3U3FA 3VRCA 1NZEA 2EIJC 4R32A 2NSGA 2J9WA 3I0IX 5EJZA 3ZGGA 3U2UA 4KC2A 2E3DA 2LP4A 1D1AA 1Z5ZA 3K1IC 1JYKA 4EHPA 3G4ZA 2A0BA 3DUVA 3VAYA 4J7TA 4YT5A 1OW6A 4D48A 2JCLA 3US6A 1R5ID 1E2XA 3O3PA 2HJ3A 3TJ5A 5L0IA 3JUKA 2F22A 5T3TA 3ZQVA 5CI9A 3NMJA 1R82A 1KTMA 2AP3A 1G95A 4B42A 1RJ9A 1K04A 2RD9A 3CEXA 2XM0A 5KYWB 1R80A 4JC7A 3T6BA 3O10A 3RVYA 3TJ6A 2V0LA 1J8YF 2WVNA 1S4PA 4CS9A 1ZYRF 4CJCA 2JD3A 3B71A 4A2NB 2UX8A 2CCYA 2YC5A 4DJ9A 4CDAA 2HKVA 2PX3A 3FWWA 3A9CA 4PR9A 5F5FA 1VYIA 3OAMA 1TWGA 4HO9A 1ZCTA 1H5RB 3FOQA 3C63A 4WGYA 1D1CA 4G7OF 1OW8A 1ZCYA 2VS4A 3OH0A 1UG7A 2B0HA 1CPQA 4KPXA 3SX3A 5A69A 2EPNA 3DZAA 5CMIA 5JT4A 4JJGA 1ZU5A 4L41C 5JVEA 1TWAA 3ECSA 2P7VA 1OR2A 1VMAA 1VGWA 3EFOB 2D5RB 1KU2A 4DRHB 2Y4MA 2Q3TA 3FHDA 1ZI1A 2IBFA 2L6FA 4C7OA 3I0KA 1ST6A 1A7EA 4G3QA 2XLHA 4PJMA 4YK5A 5B1AC 2D7IA 3SX7A 3TQDA 4O6NA 4OIPF 1KNYA 3CKJA 1FNTc 3E26A 4DXWA 3V0NA 1H9TA 3B0VC 4G3PA 1K4VA 1TWHA 5KYXA 4XEKA
chains in the Genus database with same CATH topology
1ZCVA 4KC1A 3KMIA 3FDQA 3ZG1A 2JCOA 3I0EA 4LLCA 5DVWA 4EBBA 3JSZA 1FGGA 1FGXA 1QGSA 2O1GA 2ZU7A 5C36A 3DJUB 3AG3C 3AG1C 1W2WA 3CSKA 3UGPA 2GGQA 2YQCA 2A1DD 4JJFA 3D8VA 4M2AA 3RMVA 3U2TA 4NAKA 4BMAA 5C4CA 4JCHA 5HSWA 4EE3A 1INIA 4LW3A 5CQNX 3V90A 4EVWA 1S4NA 5EJ1A 1ZHJA 4K7BA 5DS4A 4JW1A 2V26A 4CBEA 2QKXA 1GA8A 2Z15A 5FU8A 5D91A 4JISA 3EH2A 2NUTA 3KKBA 4BJTA 1H7GA 2J0WA 3NDBB 3CQZA 3ASNC 1XZ6A 3ZLLA 4AYJA 2PX0A 5C3DA 1OMZA 3LNRA 2Y4JA 2IYLD 4XWIA 4AE4A 2W0WA 4NANA 4Q7CA 1ZDFA 2YC3A 3I0HA 3USQA 2H7BA 1GWWA 2RJ8A 4DE7A 1GQ9A 1NU7D 2V0JA 1JPJA 2XRHA 4NALA 3SX8A 2L9JA 4FESA 4OD4A 3I0FA 3DD7A 3SXEA 2P6VA 4M63A 2W9YA 2P6WA 3U0YA 4EEGA 5E33A 4KPZA 1VYKA 3NYLA 4DVYP 5L6SA 5IY5C 2CDQA 3VYWA 3SP1A 2EIMC 4IAOA 2DYRC 1G9RA 2MZBA 5C49A 4FQWA 3DAGA 3LEVA 2J7PA 2XSEA 1WT1A 3R3IA 4HO3A 1M2VB 2WL8A 4AK9A 2YHSA 2EILC 3LJBA 3ZVRA 1SS9A 1ZJ1A 3OH3A 4FRHA 4Y7TA 1FMWA 2OI7A 4OIOF 4EE4A 2KJGA 5E3CA 1MMAA 4HEAJ 3T6JA 1H4CA 2ZXRA 2NG1A 4X0RA 2VK9A 2VS5A 3EGXB 2W4MA 4Y62A 1GWVA 5C1HA 3BCVA 4PJNA 3K8DA 4G7HF 5DDVA 1YP3A 2WVQA 2BO4A 5CMJA 4FRPA 1O0RA 3D98A 1OCOC 3Q7UA 3UMKA 2XL4A 4O6MA 1QWJA 1VH1A 3L0IA 1YP2A 5KYUB 1NWGB 5DLJA 1G0RA 3I0CA 3B0UX 4G87A 4Y7UA 3K8EA 5B3SC 2Z86A 3SX5A 1TW5A 3AQBA 2R7RA 3V0QA 2GFHA 1OQMB 4B2XA 3HTKC 1LVKA 3SXGA 2C0NA 2IXMA 4HE8D 4IJJA 4Y6UA 1OCZC 3T7NA 1FO8A 2I7BA 3SPTA 1TZFA 1O87A 3EJNA 4KNVA 2R7VA 3BRKX 1BR4A 1FTSA 2FYAA 3V91A 4BQHA 3K1HA 1VK5A 4C3EA 4F4BA 2W0VA 3PNNA 1H7QA 1ON8A 3K33A 3LESA 3Q4SA 2Z87A 4CJBA 1FFHA 2W4BA 3S28A 3K6BA 2QY9A 2ZXOA 4NAIA 2B0JA 3GODA 3W8HA 4U5DE 4FREA 4K0DA 4IRUA 2Q9AA 2C03A 1FFTC 2DGJA 3EGXA 3RIPA 2L81A 1MMGA 1H3MA 2VB6A 3V0OA 1JYLA 4FRDA 1JPNA 3LAYA 3JRTA 2IXNA 4H4KC 3D5NA 4FIYA 3EHNA 2Y3BA 5KYUA 3ASOC 2YQHA 5E2QA 2ZU9A 2AM4A 3POLA 3W2VA 4NY3A 1JVGA 2P73A 1N1CA 4U5EE 1MMNA 2FFHA 3LS1A 4DECA 5C4BA 4O7GA 1QLEC 4GYTA 1LS1A 1G23A 2VXLA 3PKPA 3FAJA 1VGTA 4MYBA 2CU2A 4AC3A 5J49A 5DDTA 2O1HA 2X65A 3N0TA 3W2WA 3U0XA 2MYSA 1HV9A 2X5ZA 2VFZA 4FCUA 2EINC 3EE5A 1VZUA 4DBQA 2V3CC 5IDSA 1VM8A 2X60A 1TVYA 1V55C 2Y39A 3V8YA 2BO8A 2YEVA 2RIZA 1V83A 1HM9A 4DBRA 3POVA 1VZTA 3NRHA 5E3AA 5EHHA 1H5RA 2DPWA 5CMFX 3ABMC 4LLEA 2PGYA 5CMHA 3OWTA 4B5BA 1VGUA 5C3AA 4B3UA 1LZ7A 3JTJA 3ST8A 1V84A 2RJ5A 4U5FE 4ANJA 1ZIZA 1MP3A 1IZMA 4ZLDA 4MQ9F 4EWCA 2MWQA 2WEEA 5KYYB 1NU9C 3SNHA 1ZHXA 2AECA 2RJ6A 1LL0A 3OA1A 3CU0A 4AAWA 5IFYA 2D0JA 2G3KA 1H5SA 5AJNA 2KW3C 1GX0A 1H5SD 2WVLA 2RIYA 5C4DA 3EFOA 3R2WA 3JCUQ 1MMDA 3E9VA 2OI6A 3CZ6A 3UGOA 1FMVA 4G7ZF 1GQCA 1OCCC 2J0BA 5T1DB 3UNGC 3NG1A 4FX5A 3UMHA 5FU0A 3ITFA 4OIRF 4W8KA 1INJA 2C04A 1S7ZA 1NKHB 1ZJ2A 4KXOA 4Y6NA 3RFYA 4N06A 4Y7GA 2JCJA 2BE5F 1WGWA 1R7UA 3EQLF 2VASA 1LVWA 1WSZA 3DJNB 2BO6A 5CQMX 4C3DA 1PCXA 2CW0F 4BJ5C 3IEEA 2A68F 3ABKC 3KIAA 3OEOA 3RSBA 3MX3A 2VS3A 2J9VA 3IOHA 4CS8C 2FYCB 4KT7A 4FRAA 2WVMA 3RMWA 1IW7F 5FUHA 2Y69C 5HS2A 5KYYA 3K66A 4Q5SF 2A8UA 3U2VA 4P00A 4G0HA 4M4KA 3F46A 1MNDA 4U5GA 3ZC4A 4PK4A 4HO5A 3X1OA 2A69F 3I0LA 4KNXA 1OKKA 1NMMB 4Y7VA 4QI2A 3E25A 5DS6A 2H7OA 2XWMA 2LSEA 4PJJA 1VH3A 3I0DA 2AESA 1RJ9B 2J7PD 1LKXA 4MNDA 3NKEA 3SEOA 4BJ6A 4CS9C 1XHBA 2OI5A 1G97A 3CKQA 2IXPA 1PZYB 1H7TA 3JT1A 2OG2A 3MLGA 4QI0A 2HV7A 2XWNA 1QZXA 1PD0A 1GX4A 2V0HA 3WODF 5I1FA 3H65A 1Z23A 4FRMA 3T4RA 1FR9A 1G1LA 1FO9A 3QZCA 1PZTA 1EYRA 1S4OA 1FOAA 3IOIA 3V0PA 1OMXA 3V7OA 1NQIB 2J9UA 1D0YA 1WT2A 4ZDQA 4ASJA 2PFDA 4R7PA 4AYLA 5F5HA 2V0KA 3CGXA 4FROA 1ZJPA 5BUOA 1H7HA 4IRPA 4HO4A 4ECMA 1M56C 2NUPB 3EGDB 4Y63A 1NF5B 3EH1A 3L34A 1Z63A 1TR2A 1R7XA 3I5PA 1WT3A 3T7OA 4YJWA 3KL4A 4HO0A 1G8XA 2O1FA 1ZU4A 1W57A 2R7UA 5EGYA 1M2VA 4Q4ZF 3JYHA 2Q4JA 5CQPA 2RJ9A 3TZTA 4CSAA 3RKOF 4HO6A 5AJOA 4QDLA 4P02A 1ZHZA 5L3QA 4FCEA 3OH1A 1E5KA 4I3MA 4K6RA 4HO8A 2ZU8A 4RBNA 4FWVA 4HCQA 1TW1A 4JD0A 4B4GA 2DYSC 2Q9CA 2RITA 2KGOA 4D11A 2R7QA 2G62A 3EG9B 5CI8A 1NHEB 4U5HA 2WVOA 3UR3C 4E1KA 3EZHA 2WZGA 3WG7C 3S29A 1R7YA 5CQOA 3PHF2 1TKNA 5IDTA 1H7EA 1R7TA 2APCA 2QH5A 2NUPA 4YT4A 1O7QA 2PA4A 1LL2A 4KRVA 1MNEA 1H5TB 2YCMA 5DS5A 1D1BA 3Q80A 4CIHA 4YN0B 2R7SA 4C7OB 2YQSA 1FZWA 5C38A 4EEMA 2R7XA 1W55A 3DK5A 3HL3A 3SXAA 1PD1A 4OD5A 1R7VA 2AE7A 3F1YA 4KNRA 3Q7GA 1MC3A 1H5SC 3OH4A 3LW6A 3N24A 4U5BE 3ABLC 3T7MA 1LZ0A 4OIQF 2IXOA 5CQLX 2W45A 5FTSA 1ZJ3A 3AG2C 1ZJOA 4I1OB 2Y3HA 2AGDA 1G3LA 5C4FA 5EIYA 1ON6A 5CMGX 1FG5N 2R7OA 2KQ9A 1LL3A 4ZLCA 1SMYF 2I8BA 1G2VA 4BEJA 2VXMA 2R7TA 1FXOA 2V0IA 1HJJA 3ZF8A 3LS0A 4GEHA 2AM3A 2WZFA 2BO7A 5DQZA 4DOZA 1FWYA 1WT0A 2WB7A 3DJ4A 3QVBA 1BR2A 3O6XA 4XTKA 4J18A 2AM5A 4M2BA 1H7FA 2XMEA 1H5TA 3RYLA 2RJ0A 4KC4A 1LZIA 4UEGA 4FRBA 3X2QC 3E70C 4FRQA 4HO2A 4M28A 2A6HF 3S0XA 2VSIA 2R7WA 3N9WA 3ZLKA 2NUTB 4D0TA 5B1BC 1FR8A 3V0LA 1ZHYA 3U2WA 4B6IA 5C3BA 1I52A 4KNWA 2E87A 5JQQA 3W8IA 2O9XA 2X51A 4B4MA 3SXCA 1YP4A 4AE4B 5AJPA 2IOQA 3SZRA 3Q7LA 4C3BA 1NG1A 4E7ZA 1LZJA 3SXBA 1O7OA 4MIXA 3LLKA 1V82A 1M2OA 4XLPF 2J0XA 2OEFA 3DM9B 3N2ZB 1JV3A 3RH3A 2RJ4A 4G3SA 2ICXA 1HM0A 2CGEA 4AX2A 1Z90A 1NZEA 3KH2A 4KQLA 4JVSA 3FVYA 4HFKB 4WJ0A 2VSHA 2EIKC 1SZIA 4YT8A 3SXDA 4HFFB 4KC9A 3I0GA 2XXAB 2J0AA 4CJ8A 1Z3IX 3PMRA 1ZDGA 3K7DA 4I1MA 1IINA 2EIJC 3NGWA 3UMIA 2KNHA 2J9WA 2E8BA 3I0IX 5EJZA 1D0XA 3CKVA 1SF8A 4LACB 3ZGGA 3CKNA 1YROB 3I0JA 1OKKD 4OINF 3SYNA 4I44A 3LLIA 5L6VA 2Y3DA 3U2UA 3ZGFA 1G8OA 3DXJF 2A8WA 4KC2A 3AQCA 2E3DA 1D1AA 2CNWA 1Z5ZA 3K1IC 3PKQA 1R81A 2CNWD 3EZIA 4XWJA 1JYKA 2ZPAA 1J8MF 4ASYA 3OGZA 4CSAC 2NXVA 1QGQA 1W77A 5T3WA 2HV6A 4XLNF 5DQTA 2P72A 3DUVA 1VOMA 3B0PA 1G93A 2YESA 3OC9A 4GBPA 1ZJ0A 3VAYA 5C48A 4YT5A 4BJ1A 2VH3A 5L3VA 4D48A 2ZXWC 2PP4A 2JCLA 1EZIA 4Y64A 1M57C 3GANA 4U5CE 3HLZA 2XXAA 4D11C 1VZXA 4HOCA 3O3PA 1FXJA 3B9QA 2WGZA 3IOJA 2WZLA 3QMKA 3JUKA 3V0MA 2FYBA 5T3TA 3U2XA 4JZAA 2VD4A 5CI9A 1V54C 4LW6A 1R82A 4EEOA 3Q6MA 2PX7A 2Y7AA 4DVZA 2I5KA 4B2WA 5KYNA 1BR1A 4BJ5A 1G95A 1VPAA 2FFUA 4ARWA 5BXCA 4B42A 5FTVA 1RJ9A 4CS8A 3NKDA 3HJCA 4PFPA 3DAFA 5KYWB 3CKOA 1R80A 3T6BA 4D0ZA 3EPVA 3GUEA 2V0LA 3USRA 3DM5A 4KI2A 2RJ1A 5C8RA 4KBLA 4RDAA 1J8YF 3I5QA 2WVNA 4O79A 1VGZA 2RIXA 2OEGA 3DMDA 3F1CA 3OKRA 5C4EA 1Z6AA 1IIMA 1S4PA 4CS9A 1ZYRF 5C1LA 2Y6PA 3EHMA 4CJCA 2JD3A 2WAWA 4P6IC 3JUJA 2ICYA 4Y9XA 2QTVA 4A2NB 2UX8A 2YC5A 4EE5A 4PJLA 1WVCA 2PGVA 2Y4KA 2G3VA 1H7LA 1H4DA 5FYEA 2I5EA 1JV1A 2J45A 5KYXA 3EGDA 2JCKA 4IRQA 1FRWA 5C47A 2PX3A 4BG0A 2AH9A 2FYDB 3FWWA 1VICA 1JVDA 2YQJA 5F5FA 1VYIA 2A6EF 1ZHWA 1TWGA 3OAMA 4LERA 3NYMA 3S27A 1ZCTA 3OH2A 4HO9A 1H5RB 4HG6A 2WVKA 4J30B 4YT2A 2FGYA 3AG4C 3FOQA 1MP5A 3ZSUA 4YS8A 2OCCC 1D1CA 2WE9A 4G7OF 5FCLA 5KYWA 4PFOA 1ZCYA 1O5HA 2VS4A 1KWSA 3OH0A 3I4UA 2FFVA 2YZSA 2Q9BA 1O23B 4KPXA 3SX3A 4C2SA 2RJ7A 2D7RA 4DDZA 3DZAA 1ZCUA 2M4EA 4Y7FA 5CMIA 4RD9A 3M1CB 3EG9A 4IWBA 5KYXB 4JJGA 4B4BA 1ZU5A 1H5SB 4L41C 1TWCA 1TWAA 3Q6NA 3ECSA 1HJLA 3V8ZA 2ZXPA 2P7VA 1MP4A 4CVHA 1VMAA 4FIXA 2Y3GA 1QG8A 3EFOB 1VGWA 2D5RB 2QGIA 1KU2A 2GGOA 2X5SA 2PF4E 2Q3TA 3FHDA 1ZI1A 2Y4MA 4FRLA 3F47A 4C7OA 1D0ZA 1ZI5A 2XWLA 2J46A 1ST6A 3I0KA 1ZI3A 5C1GA 1H4EA 2Y4LA 2FY7A 4G3QA 4CS7A 4JURI 1ZI4A 5FV9A 4E7SA 4PJMA 5B1AC 2D7IA 3SX7A 4O6YA 3TD7A 4EEAA 4J32B 3TQDA 1ZHTA 3O39A 4O6NA 5D92A 4OIPF 3CKJA 3ZIBA 3E26A 1HM8A 3V0NA 4BJ6C 1OCRC 3B0VC 4G3PA 1K4VA 1TWHA 4YWQA 4ULWA 2H7VC 2XMHA 3NYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D91 A;  5D92 A;  4O6N A;  4MND A;  4Q7C A;  4O6M A; 
#chains in the Genus database with same CATH topology
 3I0E A;  5DVW A;  3SXY A;  1FGX A;  1QGS A;  3CSK A;  2YQC A;  2A1D D;  4M2A A;  3RMV A;  2P61 A;  5C4C A;  1TQG A;  5HSW A;  4EE3 A;  1INI A;  4EVW A;  2LK4 A;  5DS4 A;  2QKX A;  2Z15 A;  4JIS A;  2NUT A;  4BJT A;  2Q00 A;  3ASN C;  3ZLL A;  4AYJ A;  2PX0 A;  5JS5 A;  2IYL D;  4P9T A;  3USQ A;  1GWW A;  5JSL A;  1NU7 D;  3SX8 A;  1YJG A;  4NAL A;  3I0F A;  4OD4 A;  5E33 A;  2XLE A;  5L6S A;  2TMV P;  5IY5 C;  4IAO A;  3MYI A;  2DYR C;  4FQW A;  3DAG A;  3LEV A;  1YA9 A;  4WGZ A;  4IGG A;  2PNO A;  5AC5 A;  2YHS A;  2LIG A;  1ZJ1 A;  3GM3 A;  4FRH A;  1FMW A;  5B3I A;  4OIO F;  4XPY A;  3FOP A;  2VK9 A;  2XL8 A;  1V74 B;  4PJN A;  4G7H F;  2BO4 A;  3D98 A;  1OCO C;  3Q7U A;  3UMK A;  1QWJ A;  4O6M A;  1NWG B;  5DLJ A;  3I0C A;  3B0U X;  2R7R A;  3SXG A;  4U9E A;  4Y6U A;  3T7N A;  1O87 A;  1LI7 A;  1JAF A;  4BQH A;  3PNN A;  1H7Q A;  2EPM X;  3K6B A;  3GOD A;  4IRU A;  3KYJ A;  2C03 A;  1H3M A;  3EGX A;  4P9F A;  3LAY A;  3U8P A;  2IXN A;  4H4K C;  3D5N A;  3EHN A;  2YQH A;  4IAR A;  3FMS A;  3T6G B;  1N1C A;  2FFH A;  4DEC A;  4O7G A;  4MYB A;  1LS1 A;  3U8V A;  5L0D A;  2VXL A;  5DDT A;  2X5Z A;  4EUK B;  4DBQ A;  2YEV A;  3LUT B;  3POV A;  5CMF X;  3ABM C;  4XEF A;  2EPL X;  1CGM E;  5C3A A;  4B3U A;  1MP3 A;  1HW2 A;  5KYY B;  4CJO A;  3CU0 A;  3HNK A;  1EI7 A;  3WAQ A;  4AAW A;  5IFY A;  5AJN A;  5JLI A;  2OI6 A;  1YYJ A;  3FXH A;  5T1D B;  3ITF A;  4KXO A;  4Y6N A;  1LVW A;  2BO6 A;  5CQM X;  1PCX A;  4BJ5 C;  3IEE A;  4H54 A;  2J9V A;  1MND A;  4U5G A;  4PK4 A;  3X1O A;  2A69 F;  4QI2 A;  2H7O A;  1H9G A;  4PJJ A;  4G78 A;  4U9D A;  2J7P D;  1LKX A;  3SEO A;  3JT1 A;  3MLG A;  4QI0 A;  3VF0 A;  1DOV A;  3WOD F;  1C03 A;  4D4N A;  1G1L A;  3CAX A;  4XPW A;  1S4O A;  1FOA A;  3V0P A;  4ZDQ A;  1D0Y A;  4R7P A;  3CGX A;  3GEI A;  4ECM A;  3U9J A;  3IHU A;  1M56 C;  4Y63 A;  3T7O A;  1R7X A;  1WT3 A;  1NSG B;  2R7U A;  5EGY A;  5CQP A;  2RJ9 A;  5FZT A;  4CSA A;  3RKO F;  4HO6 A;  4QDL A;  4P02 A;  4ULV A;  4K6R A;  3ZQY A;  2ETS A;  2RIT A;  2KGO A;  4D11 A;  2R05 A;  1HE9 A;  3EG9 B;  3JRM O;  3UR3 C;  2WVO A;  5CQO A;  2BC5 A;  1LL2 A;  2YCM A;  1D1B A;  3Q80 A;  4YN0 B;  3M15 A;  1GQA A;  4JRZ A;  4EEM A;  3HL3 A;  3TQO A;  3R7C A;  3Q7G A;  1UFB A;  4OIQ F;  2IXO A;  4I1O B;  1G3L A;  2JX0 A;  2HSQ A;  1U6H A;  4BEJ A;  2R7T A;  3H2V A;  1HJJ A;  2AM3 A;  3QVB A;  3O6X A;  2AM5 A;  3AGU A;  2RJ0 A;  1T9K A;  1ZVZ A;  4UEG A;  4FRB A;  3S0X A;  4D0T A;  3V0L A;  2XM4 A;  3ZWI A;  3W8I A;  2M64 A;  4AE4 B;  2IOQ A;  3SZR A;  3Q7L A;  3SXB A;  1O7O A;  4MIX A;  3LLK A;  1V82 A;  2OEV A;  2J0X A;  2OEF A;  1CGO A;  2RJ4 A;  1Z7Q c;  2ICX A;  1Z90 A;  1TFK B;  3KH2 A;  4JVS A;  3FVY A;  2VSH A;  2EIK C;  4XPX A;  3I0G A;  2XXA B;  4CJ8 A;  4I1M A;  3NGW A;  3UMI A;  2KNH A;  2E8B A;  3CKV A;  3CKN A;  1YRO B;  3I0J A;  1OKK D;  4OIN F;  4I44 A;  5L6V A;  3J06 A;  2Y3D A;  3ZGF A;  3DXJ F;  1A7V A;  2A8W A;  2CNW A;  5L0C A;  1R81 A;  1SYQ A;  3EZI A;  1WN0 A;  1XZP A;  3HNL A;  3OGZ A;  4CSA C;  1W77 A;  4XLN F;  2P72 A;  4D4X A;  1VOM A;  2YES A;  1ZJ0 A;  5C48 A;  3GAN A;  4D11 C;  3B9Q A;  3IOJ A;  3W4Y A;  3U2X A;  4JZA A;  2KK1 A;  4LW6 A;  4EEO A;  2PX7 A;  4DVZ A;  1BR1 A;  2FFU A;  2FAP B;  3KYI A;  5FTV A;  1ZW3 A;  2YLI A;  3USR A;  4DRJ B;  4LDK A;  3I5Q A;  4O79 A;  1VGZ A;  2RIX A;  2OEG A;  3JUJ A;  2QTV A;  3PCV A;  2PGV A;  1JV1 A;  3EGD A;  2JCK A;  4IRQ A;  5C47 A;  2AH9 A;  1VIC A;  1LE2 A;  2YQJ A;  1ZHW A;  3S27 A;  3RW0 A;  4HG6 A;  3AG4 C;  1WAS A;  5KYW A;  4PFO A;  3FOO A;  1O5H A;  3U3B A;  2YZS A;  2Q9B A;  1O23 B;  3SXM A;  2OOC A;  1BZ4 A;  3VM6 A;  3RQE A;  1CPR A;  1H5S B;  1TWC A;  4NQF A;  5AGF A;  4JTD B;  2ZXP A;  1MP4 A;  2AWC A;  2X5S A;  4JIO A;  2GGO A;  3RVZ A;  1D0Z A;  5GPG B;  1ZI5 A;  2XWL A;  1ZI3 A;  5C1G A;  1H4E A;  3U2M A;  4Z9J A;  1LIH A;  3ZIB A;  1HM8 A;  4ULW A;  3NYJ A;  3KMI A;  1FGG A;  3DJU B;  3AG3 C;  4YL3 A;  4EIY A;  3UGP A;  3U2T A;  2GGQ A;  1Q0M A;  5CQN X;  3V90 A;  1NLX A;  3ZTZ A;  1VLT A;  1GA8 A;  5D91 A;  4CDV A;  1H7G A;  2J0W A;  3NDB B;  2P0N A;  5A6K A;  2Y4J A;  4XWI A;  2OKU A;  4NAN A;  2YC3 A;  1ZW2 A;  2XRH A;  2W9Y A;  2P6W A;  4EEG A;  4KPZ A;  3M4C A;  1VYK A;  4DVY P;  3SP1 A;  2EIM C;  4MTF A;  3S9O A;  2MZB A;  2J7P A;  2XSE A;  2XLM A;  1M2V B;  3ATP A;  4Y7T A;  1SS9 A;  2OI7 A;  1LPE A;  1MMA A;  1AEP A;  2W4M A;  5C1H A;  1VLS A;  3BCV A;  3K8D A;  3T9O A;  5DDV A;  5CMJ A;  2YKZ A;  3M79 A;  3MYF A;  2XL6 A;  3L0I A;  5KYU B;  2YWA A;  3C7J A;  2D4U A;  1G0R A;  3K8E A;  5B3S C;  3AQB A;  5COM A;  1OQM B;  4B2X A;  2VCC A;  2IXM A;  2HUJ A;  1OCZ C;  1TZF A;  2R7V A;  4KNV A;  1BR4 A;  4F4B A;  1ON8 A;  4CJB A;  3S28 A;  2QY9 A;  1M6T A;  4U5D E;  4K0D A;  3V0O A;  2VB6 A;  1JYL A;  1JPN A;  3JRT A;  1YZA A;  3ASO C;  4MTO A;  2EPO A;  2P73 A;  3LS1 A;  1QLE C;  3PKP A;  1RKE A;  2CU2 A;  1HV9 A;  2VFZ A;  3EE5 A;  3AOU A;  2X60 A;  1V55 C;  2Y39 A;  3V8Y A;  4JEA A;  2RIZ A;  1V83 A;  3C62 A;  1OR3 A;  5E3A A;  5EHH A;  1APC A;  2PGY A;  3OWT A;  4B5B A;  2VCB A;  1V84 A;  2RJ5 A;  1G5Z A;  4U5F E;  4ANJ A;  3C8G A;  4ZLD A;  3RQG A;  4EWC A;  1NU9 C;  3SNH A;  2RJ6 A;  1LL0 A;  2DI3 A;  5JP7 A;  2G3K A;  1GGQ A;  1H5S D;  2RIY A;  1ORS C;  5C4D A;  1A7D A;  3JCU Q;  2QE9 A;  4G7Z F;  1SR2 A;  3UNG C;  3O55 A;  3GEE A;  1S7Z A;  2VCA A;  3RFY A;  4N06 A;  2JCJ A;  1R7U A;  2VAS A;  4C3D A;  1I4Y A;  2A68 F;  3OEO A;  2FYC B;  1H6G A;  5FUH A;  5KYY A;  3K66 A;  4Q5S F;  3U2V A;  4G0H A;  4HO5 A;  1NFN A;  1OKK A;  5DS6 A;  2LSE A;  1OW7 A;  1RJ9 B;  4BJ6 A;  4CS9 C;  2OI5 A;  1ZZP A;  2IXP A;  1PZY B;  4WAB A;  2OG2 A;  4NTF A;  1PD0 A;  3QW1 A;  2V0H A;  1Z23 A;  1AVO B;  1FR9 A;  1FO9 A;  2AWY A;  1PZT A;  5L0G A;  3S90 A;  4EE5 A;  2PFD A;  5F5H A;  4FRO A;  1ZJP A;  5BUO A;  2LFF A;  4HO4 A;  2NUP B;  1Q0K A;  5C3D A;  2KC3 A;  3L34 A;  4NTA A;  4YJW A;  4HO0 A;  2YL1 A;  2Q4J A;  5A6A A;  3HNJ A;  4FCE A;  3OH1 A;  1E5K A;  4I3M A;  2ZU8 A;  4RBN A;  1TW1 A;  4B4G A;  2Q9C A;  2R7Q A;  4ER9 A;  2G62 A;  5CI8 A;  4CJG A;  3WG7 C;  3S29 A;  1R7Y A;  3PHF 2;  5COG A;  1R7T A;  2QH5 A;  1O7Q A;  2L6G A;  2ICW G;  5DS5 A;  4CIH A;  2R7S A;  4C7O B;  1FZW A;  1W55 A;  3SXA A;  1OXK A;  3F1Y A;  3ABL C;  1FAP B;  5CQL X;  2AGD A;  1I5N A;  2R7O A;  2KQ9 A;  1NBB A;  5DQZ A;  5CIV A;  2WB7 A;  1BR2 A;  1YAR O;  1LZI A;  5HV9 A;  3WHN A;  3G4X A;  3X2Q C;  4FRQ A;  2A6H F;  3R2P A;  2R7W A;  2NUT B;  5A6B A;  1FR8 A;  4N6C A;  1ZHY A;  5C3B A;  2E87 A;  2OEX A;  2O9X A;  2X51 A;  3GOR A;  3SXC A;  3BRJ A;  4C3B A;  1NG1 A;  2QLA A;  3SXK A;  3N2Z B;  1JV3 A;  2UUI A;  1QSP A;  1HM0 A;  2CGE A;  2EPK X;  4KQL A;  4JEB A;  1Q0G A;  3SXD A;  4HFF B;  4KC9 A;  2J0A A;  3C8Z A;  1Z3I X;  3PMR A;  1ZDG A;  1D0X A;  3L8I A;  3SYN A;  3LLI A;  1G8O A;  1E84 A;  3PKQ A;  4XWJ A;  1J8M F;  2ZPA A;  4ASY A;  4MS2 A;  3AJM A;  2NXV A;  1XWJ A;  5T3W A;  3ZTM A;  2HV6 A;  5DQT A;  5L3V A;  2PP4 A;  1M57 C;  4U5C E;  3HLZ A;  2XXA A;  4E18 A;  1FXJ A;  3G50 A;  2WGZ A;  3QMK A;  2VD4 A;  3DWW A;  3Q6M A;  4B2W A;  1VPA A;  3PDM P;  4E0H A;  4W8P A;  4CS8 A;  1WWP A;  4PFP A;  1RCP A;  4EBK A;  3DM5 A;  2RJ1 A;  1OQC A;  4KBL A;  5C8R A;  3F1C A;  3OKR A;  1Z6A A;  2Y6P A;  3EHM A;  1YVI A;  4Y9X A;  4P6I C;  2Y4K A;  2I5E A;  1FRW A;  2FYD B;  4BG0 A;  1JVD A;  3OH2 A;  3IQ6 A;  2OJE D;  2WVK A;  1Q0F A;  4YT2 A;  4JTA B;  2OU6 A;  4YS8 A;  4L6R A;  2OCC C;  2WE9 A;  3A11 A;  1KWS A;  1U0B B;  2FFV A;  4C2S A;  4DDZ A;  4Y7F A;  2M4E A;  2UUH A;  3M1C B;  5BQG A;  3Q6N A;  2XLD A;  3V8Z A;  4CVH A;  3OC9 A;  4JD0 A;  4NAK A;  2PF4 E;  1L7C A;  2J46 A;  4JE9 A;  1ZI4 A;  3NMK A;  4MVZ A;  4EEA A;  5D92 A;  3RF3 A;  1OCR C;  4AL1 A;  4YWQ A;  5BXC A;  1YDI A;  2XMH A;  3FDQ A;  4NTB A;  3ZG1 A;  4EBB A;  2O1G A;  5C36 A;  3AG1 C;  2DB4 A;  2YRF A;  4JCH A;  4LW3 A;  5EJ1 A;  1S4N A;  1ZHJ A;  4CBE A;  1PV3 A;  3EH2 A;  3KKB A;  2AVK A;  1ORY A;  4K1O A;  3LNR A;  3MBG A;  1ZDF A;  3I0H A;  4DE7 A;  2H7B A;  1GQ9 A;  2V0J A;  1JPJ A;  1EKY A;  1WTY A;  2L9J A;  1LS4 A;  3DD7 A;  3U0Y A;  3GEH A;  3NYL A;  3VYW A;  1G9R A;  2GWW A;  1JOG A;  2WL8 A;  4AK9 A;  2KSF A;  3LJB A;  4EE4 A;  2KJG A;  1NFO A;  4HEA J;  3T6J A;  1H4C A;  2ZXR A;  1HW1 A;  2NG1 A;  2VS5 A;  4Z9H A;  4Y62 A;  2WVQ A;  3V5X A;  1O0R A;  4Y7U A;  3U0C A;  4Z9I A;  1T6I A;  3HTK C;  4HE8 D;  1QQ3 A;  2I7B A;  3K1I A;  4JTC B;  3QTH A;  2FYA A;  3V91 A;  3K1H A;  4C3E A;  2W0V A;  2Z87 A;  1FFH A;  5BQI A;  1GM5 A;  5L0F A;  4NAI A;  2B0J A;  4N6H A;  3W8H A;  1FFT C;  2L81 A;  4FRD A;  2HZ8 A;  4IAQ A;  1AUE A;  2Q7R A;  2Y3B A;  5KYU A;  1WAT A;  1I4Z A;  2ZU9 A;  3W2V A;  1JVG A;  3ZDL A;  4BPM A;  4U5E E;  5C4B A;  1MMN A;  3FAJ A;  5J49 A;  3U9M A;  2MYS A;  4FCU A;  3M4B A;  1VZU A;  2HSB A;  5IDS A;  2H8A A;  1QVX A;  2BO8 A;  1HM9 A;  4DBR A;  1VZT A;  1H5R A;  1G4U S;  2DPW A;  4LLE A;  4CX9 A;  5CMH A;  1LZ7 A;  3JTJ A;  3ST8 A;  2L6H A;  2MHR A;  1ZIZ A;  4MQ9 F;  2MWQ A;  3V5Y A;  2AEC A;  1Y6D A;  1OXB A;  1GX0 A;  2WVL A;  3EFO A;  1E85 A;  1MMD A;  3CZ6 A;  1GQC A;  2J0B A;  3NG1 A;  3UMH A;  4ONS A;  5FU0 A;  4OIR F;  1INJ A;  2C04 A;  1NKH B;  4Y7G A;  1A41 A;  2Q4F A;  2BE5 F;  1VB5 A;  1WSZ A;  4BEM J;  4J7Y A;  2CW0 F;  3ABK C;  3RSB A;  3IOH A;  1BBH A;  4FRA A;  4KT7 A;  4MVM A;  2A8U A;  2QUP A;  4P00 A;  4M4K A;  1HE1 A;  3I0L A;  3QW0 A;  4KNX A;  1NMM B;  3E25 A;  1VH3 A;  3C18 A;  3I0D A;  4MND A;  1XHB A;  3NKE A;  3CKQ A;  3DE9 A;  1Y4C A;  1H7T A;  2HV7 A;  1QZX A;  1GX4 A;  5I1F A;  3H65 A;  2YL7 A;  1VTM P;  4FRM A;  2GAQ A;  2LFD A;  3U5S A;  4A4A A;  1WT2 A;  2J9U A;  1H7H A;  2L7A A;  3EGD B;  4LDQ A;  1NF5 B;  1Z63 A;  1TR2 A;  1G8X A;  1ZU4 A;  1W57 A;  2JPU A;  4Q4Z F;  3JYH A;  5AJO A;  5L3Q A;  1R4T A;  4HCQ A;  3SXZ A;  2AU5 A;  2DYS C;  4E17 A;  4U5H A;  2VC9 A;  2NPU A;  3QVY A;  1TKN A;  5IDT A;  1H7E A;  3B29 A;  2APC A;  2NUP A;  4KRV A;  2LQG A;  1H5T B;  2R7X A;  3DK5 A;  4FAP B;  2RSE B;  3LW6 A;  5EK0 A;  4NC3 A;  5FTS A;  4MVS A;  1ZJ3 A;  5C4F A;  2Y3H A;  4UDV A;  1G4W R;  5CMG X;  2R03 A;  2HMZ A;  4PAC A;  3FAP B;  4ZLC A;  1SMY F;  1FXO A;  3LS0 A;  2WZF A;  2BO7 A;  1FWY A;  1WT0 A;  2LCH A;  3DJ4 A;  4XTK A;  1H7F A;  1LE4 A;  3RYL A;  4NCQ A;  2YL0 A;  4M28 A;  4HO2 A;  3N9W A;  3ZLK A;  2XLO A;  3U2W A;  4B6I A;  4KNW A;  1YP4 A;  1K05 A;  4E7Z A;  1M2O A;  3DM9 B;  3RH3 A;  4IB4 A;  1FR0 A;  5K0I A;  4AX2 A;  2HS5 A;  4JKV A;  4HFK B;  4WJ0 A;  1C02 A;  1SZI A;  4YT8 A;  2J8W A;  3K7D A;  1IIN A;  1TFO B;  1SF8 A;  4LAC B;  1T01 A;  4XEV A;  1C17 M;  3AQC A;  4YL1 A;  1JRA A;  2CNW D;  1QPU A;  3L8J A;  2NSF A;  1QGQ A;  4MVO A;  3B0P A;  1G93 A;  4GBP A;  3V5Z A;  4BJ1 A;  2VH3 A;  2ZXW C;  1EZI A;  4Y64 A;  1VZX A;  4HOC A;  2WZL A;  3V0M A;  2FYB A;  1V54 C;  3RQF A;  3S84 A;  2Y7A A;  3IQ5 A;  2I5K A;  5KYN A;  4BJ5 A;  2QNL A;  4ARW A;  3NKD A;  3HJC A;  3DAF A;  3CKO A;  4MW8 A;  4D0Z A;  3EPV A;  3GUE A;  2HFI A;  1HY5 A;  4KI2 A;  2YLD A;  3HNI A;  4RDA A;  3DMD A;  5C4E A;  1IIM A;  3GWN A;  1RKE B;  5C1L A;  5JUA A;  4GQH A;  2WAW A;  2ICY A;  4PJL A;  1WVC A;  1ORJ A;  2G3V A;  1H7L A;  1H4D A;  5FYE A;  2J45 A;  3TUL A;  2A6E F;  3DI5 A;  4LER A;  3NYM A;  2R9R B;  4J30 B;  2FGY A;  2XLV A;  1MP5 A;  3ZSU A;  1GS9 A;  5FCL A;  3I4U A;  1XZQ A;  3C8G B;  2RJ7 A;  2D7R A;  1ZCU A;  1F1M A;  4RD9 A;  3EG9 A;  1RKC A;  2IM8 A;  4IWB A;  5KYX B;  3JZ0 A;  4B4B A;  5AC4 A;  1HJL A;  1EA8 A;  4FIX A;  2Y3G A;  1QG8 A;  2QGI A;  4FRL A;  3F47 A;  2XS1 A;  2Y4L A;  2FY7 A;  5JRA A;  4CS7 A;  4JUR I;  5FV9 A;  2OQM A;  4E7S A;  4O6Y A;  3TD7 A;  2LD6 A;  4J32 B;  1ZHT A;  3O39 A;  1E86 A;  4BJ6 C;  1HMD A;  2H7V C;  1ZCV A;  4KC1 A;  2JCO A;  4LLC A;  3JSZ A;  2ZU7 A;  2YL3 A;  1W2W A;  4BMA A;  4JJF A;  3D8V A;  5BQH A;  2A0U A;  3IQC A;  4K7B A;  4CIP A;  1YLM A;  2XS8 A;  4JW1 A;  2V26 A;  2R25 A;  2GDC A;  5FU8 A;  1MQV A;  2YQY A;  1Q0D A;  3CQZ A;  1XZ6 A;  4MVU A;  1OMZ A;  1DOW A;  3TK0 A;  4AE4 A;  2W0W A;  4Q7C A;  2RJ8 A;  256B A;  2HJM A;  4FES A;  3SXE A;  2P6V A;  4M63 A;  2J9B A;  1YYX A;  3JTL O;  1RXQ A;  2CDQ A;  1A0B A;  5C49 A;  2BL2 A;  2YVK A;  3U2L A;  4CDY A;  1WT1 A;  1JMW A;  3R3I A;  4HO3 A;  4MVQ A;  2EIL C;  3ZVR A;  3OH3 A;  3L1M A;  1YZC A;  5E3C A;  5A6J A;  4X0R A;  3EGX B;  1GWV A;  1YP3 A;  3GM1 A;  4FRP A;  2XL4 A;  1VH1 A;  1YP2 A;  4G87 A;  3SX5 A;  2Z86 A;  1TW5 A;  3V0Q A;  2GFH A;  2R02 A;  1LVK A;  2C0N A;  3DE8 A;  3KPH A;  4IJJ A;  1FO8 A;  3SPT A;  3EJN A;  3BRK X;  1FTS A;  1VK5 A;  3K33 A;  3LES A;  3Q4S A;  1LI5 A;  2W4B A;  2ZXO A;  4FRE A;  1E83 A;  2Q9A A;  2DGJ A;  3RIP A;  1MMG A;  2ASR A;  2X0C A;  4FIY A;  5E2Q A;  2AM4 A;  3POL A;  4NY3 A;  2OJQ A;  2PBE A;  4GYT A;  1G23 A;  1VGT A;  4AC3 A;  2O1H A;  2X65 A;  3N0T A;  3W2W A;  3U0X A;  2EIN C;  2V3C C;  5TJ5 E;  1BDJ B;  2GA0 A;  1VM8 A;  1TVY A;  4XQ1 A;  3AGT A;  1S05 A;  4YL0 A;  3NRH A;  1H7I A;  1LM3 B;  1VGU A;  2XLW A;  4EKW A;  1IZM A;  3C8G D;  2WEE A;  1ZHX A;  3OA1 A;  2D0J A;  3DKA A;  1H5S A;  1CGN A;  2KW3 C;  4JCZ A;  3R2W A;  3E9V A;  3UGO A;  1FMV A;  2P1A A;  1OCC C;  4FX5 A;  4W8K A;  3QVZ A;  1ZJ2 A;  1WGW A;  3EQL F;  1JR8 A;  3DJN B;  3KIA A;  3MX3 A;  2VS3 A;  4CS8 C;  3RMW A;  2WVM A;  1IW7 F;  2Y69 C;  5HS2 A;  1EQ1 A;  3F46 A;  3ZC4 A;  4EBJ A;  4Y7V A;  3MFN A;  2XWM A;  2AES A;  1QKR A;  1G97 A;  2I15 A;  5L0H A;  2XWN A;  3JSE O;  1O3U A;  3T4R A;  3GM2 A;  3QZC A;  1EYR A;  4E0I A;  1T6U A;  3IOI A;  1OMX A;  3V7O A;  1NQI B;  4ASJ A;  4AYL A;  2V0K A;  4IRP A;  1T5O A;  1K40 A;  3EH1 A;  1YAU O;  3I5P A;  3KL4 A;  4LDR A;  2O1F A;  3NMI A;  2ZD9 A;  1M2V A;  3TZT A;  3HKK A;  3IQT A;  1ZHZ A;  3JYY A;  4HO8 A;  4FWV A;  1RMV A;  1V4A A;  3TOM A;  2YLG A;  3H2U A;  1NHE B;  4E1K A;  3EZH A;  2WZG A;  3LEO A;  1B68 A;  4YT4 A;  2PA4 A;  3LNM B;  1MNE A;  2YQS A;  5C38 A;  5COF A;  4MVR A;  2CYD A;  4N4W A;  1PD1 A;  4OD5 A;  1R7V A;  2AE7 A;  4KNR A;  1MC3 A;  1H5S C;  3OH4 A;  3N24 A;  4U5B E;  3T7M A;  1LZ0 A;  5F28 E;  2W45 A;  1HMO A;  3AG2 C;  1L3P A;  1ZJO A;  5EIY A;  3IPM O;  1ON6 A;  1U89 A;  3GWL A;  1FG5 N;  3BEH A;  1LL3 A;  2I8B A;  1G2V A;  1YA7 O;  2VXM A;  1T6Q A;  2V0I A;  3ZF8 A;  4GEH A;  4DOZ A;  2KYH A;  4DRI B;  4J18 A;  4M2B A;  2XME A;  1H5T A;  1WOL A;  4KC4 A;  3TOL A;  3E70 C;  4MW3 A;  2VSI A;  5B1B C;  5A6B D;  5JQQ A;  1I52 A;  4MTG A;  4B4M A;  5AJP A;  5L0J A;  1LZJ A;  2HMQ A;  4XLP F;  4AL0 A;  4G3S A;  3U3F A;  3VRC A;  1NZE A;  2EIJ C;  4R32 A;  2NSG A;  2J9W A;  3I0I X;  5EJZ A;  3ZGG A;  3U2U A;  4KC2 A;  2E3D A;  2LP4 A;  1D1A A;  1Z5Z A;  3K1I C;  1JYK A;  4EHP A;  3G4Z A;  2A0B A;  3DUV A;  3VAY A;  4J7T A;  4YT5 A;  1OW6 A;  4D48 A;  2JCL A;  3US6 A;  1R5I D;  1E2X A;  3O3P A;  2HJ3 A;  3TJ5 A;  5L0I A;  3JUK A;  2F22 A;  5T3T A;  3ZQV A;  5CI9 A;  3NMJ A;  1R82 A;  1KTM A;  2AP3 A;  1G95 A;  4B42 A;  1RJ9 A;  1K04 A;  2RD9 A;  3CEX A;  2XM0 A;  5KYW B;  1R80 A;  4JC7 A;  3T6B A;  3O10 A;  3RVY A;  3TJ6 A;  2V0L A;  1J8Y F;  2WVN A;  1S4P A;  4CS9 A;  1ZYR F;  4CJC A;  2JD3 A;  3B71 A;  4A2N B;  2UX8 A;  2CCY A;  2YC5 A;  4DJ9 A;  4CDA A;  2HKV A;  2PX3 A;  3FWW A;  3A9C A;  4PR9 A;  5F5F A;  1VYI A;  3OAM A;  1TWG A;  4HO9 A;  1ZCT A;  1H5R B;  3FOQ A;  3C63 A;  4WGY A;  1D1C A;  4G7O F;  1OW8 A;  1ZCY A;  2VS4 A;  3OH0 A;  1UG7 A;  2B0H A;  1CPQ A;  4KPX A;  3SX3 A;  5A69 A;  2EPN A;  3DZA A;  5CMI A;  5JT4 A;  4JJG A;  1ZU5 A;  4L41 C;  5JVE A;  1TWA A;  3ECS A;  2P7V A;  1OR2 A;  1VMA A;  1VGW A;  3EFO B;  2D5R B;  1KU2 A;  4DRH B;  2Y4M A;  2Q3T A;  3FHD A;  1ZI1 A;  2IBF A;  2L6F A;  4C7O A;  3I0K A;  1ST6 A;  1A7E A;  4G3Q A;  2XLH A;  4PJM A;  4YK5 A;  5B1A C;  2D7I A;  3SX7 A;  3TQD A;  4O6N A;  4OIP F;  1KNY A;  3CKJ A;  1FNT c;  3E26 A;  4DXW A;  3V0N A;  1H9T A;  3B0V C;  4G3P A;  1K4V A;  1TWH A;  5KYX A;  4XEK A; 
#chains in the Genus database with same CATH homology
 1ZCV A;  4KC1 A;  3KMI A;  3FDQ A;  3ZG1 A;  2JCO A;  3I0E A;  4LLC A;  5DVW A;  4EBB A;  3JSZ A;  1FGG A;  1FGX A;  1QGS A;  2O1G A;  2ZU7 A;  5C36 A;  3DJU B;  3AG3 C;  3AG1 C;  1W2W A;  3CSK A;  3UGP A;  2GGQ A;  2YQC A;  2A1D D;  4JJF A;  3D8V A;  4M2A A;  3RMV A;  3U2T A;  4NAK A;  4BMA A;  5C4C A;  4JCH A;  5HSW A;  4EE3 A;  1INI A;  4LW3 A;  5CQN X;  3V90 A;  4EVW A;  1S4N A;  5EJ1 A;  1ZHJ A;  4K7B A;  5DS4 A;  4JW1 A;  2V26 A;  4CBE A;  2QKX A;  1GA8 A;  2Z15 A;  5FU8 A;  5D91 A;  4JIS A;  3EH2 A;  2NUT A;  3KKB A;  4BJT A;  1H7G A;  2J0W A;  3NDB B;  3CQZ A;  3ASN C;  1XZ6 A;  3ZLL A;  4AYJ A;  2PX0 A;  5C3D A;  1OMZ A;  3LNR A;  2Y4J A;  2IYL D;  4XWI A;  4AE4 A;  2W0W A;  4NAN A;  4Q7C A;  1ZDF A;  2YC3 A;  3I0H A;  3USQ A;  2H7B A;  1GWW A;  2RJ8 A;  4DE7 A;  1GQ9 A;  1NU7 D;  2V0J A;  1JPJ A;  2XRH A;  4NAL A;  3SX8 A;  2L9J A;  4FES A;  4OD4 A;  3I0F A;  3DD7 A;  3SXE A;  2P6V A;  4M63 A;  2W9Y A;  2P6W A;  3U0Y A;  4EEG A;  5E33 A;  4KPZ A;  1VYK A;  3NYL A;  4DVY P;  5L6S A;  5IY5 C;  2CDQ A;  3VYW A;  3SP1 A;  2EIM C;  4IAO A;  2DYR C;  1G9R A;  2MZB A;  5C49 A;  4FQW A;  3DAG A;  3LEV A;  2J7P A;  2XSE A;  1WT1 A;  3R3I A;  4HO3 A;  1M2V B;  2WL8 A;  4AK9 A;  2YHS A;  2EIL C;  3LJB A;  3ZVR A;  1SS9 A;  1ZJ1 A;  3OH3 A;  4FRH A;  4Y7T A;  1FMW A;  2OI7 A;  4OIO F;  4EE4 A;  2KJG A;  5E3C A;  1MMA A;  4HEA J;  3T6J A;  1H4C A;  2ZXR A;  2NG1 A;  4X0R A;  2VK9 A;  2VS5 A;  3EGX B;  2W4M A;  4Y62 A;  1GWV A;  5C1H A;  3BCV A;  4PJN A;  3K8D A;  4G7H F;  5DDV A;  1YP3 A;  2WVQ A;  2BO4 A;  5CMJ A;  4FRP A;  1O0R A;  3D98 A;  1OCO C;  3Q7U A;  3UMK A;  2XL4 A;  4O6M A;  1QWJ A;  1VH1 A;  3L0I A;  1YP2 A;  5KYU B;  1NWG B;  5DLJ A;  1G0R A;  3I0C A;  3B0U X;  4G87 A;  4Y7U A;  3K8E A;  5B3S C;  2Z86 A;  3SX5 A;  1TW5 A;  3AQB A;  2R7R A;  3V0Q A;  2GFH A;  1OQM B;  4B2X A;  3HTK C;  1LVK A;  3SXG A;  2C0N A;  2IXM A;  4HE8 D;  4IJJ A;  4Y6U A;  1OCZ C;  3T7N A;  1FO8 A;  2I7B A;  3SPT A;  1TZF A;  1O87 A;  3EJN A;  4KNV A;  2R7V A;  3BRK X;  1BR4 A;  1FTS A;  2FYA A;  3V91 A;  4BQH A;  3K1H A;  1VK5 A;  4C3E A;  4F4B A;  2W0V A;  3PNN A;  1H7Q A;  1ON8 A;  3K33 A;  3LES A;  3Q4S A;  2Z87 A;  4CJB A;  1FFH A;  2W4B A;  3S28 A;  3K6B A;  2QY9 A;  2ZXO A;  4NAI A;  2B0J A;  3GOD A;  3W8H A;  4U5D E;  4FRE A;  4K0D A;  4IRU A;  2Q9A A;  2C03 A;  1FFT C;  2DGJ A;  3EGX A;  3RIP A;  2L81 A;  1MMG A;  1H3M A;  2VB6 A;  3V0O A;  1JYL A;  4FRD A;  1JPN A;  3LAY A;  3JRT A;  2IXN A;  4H4K C;  3D5N A;  4FIY A;  3EHN A;  2Y3B A;  5KYU A;  3ASO C;  2YQH A;  5E2Q A;  2ZU9 A;  2AM4 A;  3POL A;  3W2V A;  4NY3 A;  1JVG A;  2P73 A;  1N1C A;  4U5E E;  1MMN A;  2FFH A;  3LS1 A;  4DEC A;  5C4B A;  4O7G A;  1QLE C;  4GYT A;  1LS1 A;  1G23 A;  2VXL A;  3PKP A;  3FAJ A;  1VGT A;  4MYB A;  2CU2 A;  4AC3 A;  5J49 A;  5DDT A;  2O1H A;  2X65 A;  3N0T A;  3W2W A;  3U0X A;  2MYS A;  1HV9 A;  2X5Z A;  2VFZ A;  4FCU A;  2EIN C;  3EE5 A;  1VZU A;  4DBQ A;  2V3C C;  5IDS A;  1VM8 A;  2X60 A;  1TVY A;  1V55 C;  2Y39 A;  3V8Y A;  2BO8 A;  2YEV A;  2RIZ A;  1V83 A;  1HM9 A;  4DBR A;  3POV A;  1VZT A;  3NRH A;  5E3A A;  5EHH A;  1H5R A;  2DPW A;  5CMF X;  3ABM C;  4LLE A;  2PGY A;  5CMH A;  3OWT A;  4B5B A;  1VGU A;  5C3A A;  4B3U A;  1LZ7 A;  3JTJ A;  3ST8 A;  1V84 A;  2RJ5 A;  4U5F E;  4ANJ A;  1ZIZ A;  1MP3 A;  1IZM A;  4ZLD A;  4MQ9 F;  4EWC A;  2MWQ A;  2WEE A;  5KYY B;  1NU9 C;  3SNH A;  1ZHX A;  2AEC A;  2RJ6 A;  1LL0 A;  3OA1 A;  3CU0 A;  4AAW A;  5IFY A;  2D0J A;  2G3K A;  1H5S A;  5AJN A;  2KW3 C;  1GX0 A;  1H5S D;  2WVL A;  2RIY A;  5C4D A;  3EFO A;  3R2W A;  3JCU Q;  1MMD A;  3E9V A;  2OI6 A;  3CZ6 A;  3UGO A;  1FMV A;  4G7Z F;  1GQC A;  1OCC C;  2J0B A;  5T1D B;  3UNG C;  3NG1 A;  4FX5 A;  3UMH A;  5FU0 A;  3ITF A;  4OIR F;  4W8K A;  1INJ A;  2C04 A;  1S7Z A;  1NKH B;  1ZJ2 A;  4KXO A;  4Y6N A;  3RFY A;  4N06 A;  4Y7G A;  2JCJ A;  2BE5 F;  1WGW A;  1R7U A;  3EQL F;  2VAS A;  1LVW A;  1WSZ A;  3DJN B;  2BO6 A;  5CQM X;  4C3D A;  1PCX A;  2CW0 F;  4BJ5 C;  3IEE A;  2A68 F;  3ABK C;  3KIA A;  3OEO A;  3RSB A;  3MX3 A;  2VS3 A;  2J9V A;  3IOH A;  4CS8 C;  2FYC B;  4KT7 A;  4FRA A;  2WVM A;  3RMW A;  1IW7 F;  5FUH A;  2Y69 C;  5HS2 A;  5KYY A;  3K66 A;  4Q5S F;  2A8U A;  3U2V A;  4P00 A;  4G0H A;  4M4K A;  3F46 A;  1MND A;  4U5G A;  3ZC4 A;  4PK4 A;  4HO5 A;  3X1O A;  2A69 F;  3I0L A;  4KNX A;  1OKK A;  1NMM B;  4Y7V A;  4QI2 A;  3E25 A;  5DS6 A;  2H7O A;  2XWM A;  2LSE A;  4PJJ A;  1VH3 A;  3I0D A;  2AES A;  1RJ9 B;  2J7P D;  1LKX A;  4MND A;  3NKE A;  3SEO A;  4BJ6 A;  4CS9 C;  1XHB A;  2OI5 A;  1G97 A;  3CKQ A;  2IXP A;  1PZY B;  1H7T A;  3JT1 A;  2OG2 A;  3MLG A;  4QI0 A;  2HV7 A;  2XWN A;  1QZX A;  1PD0 A;  1GX4 A;  2V0H A;  3WOD F;  5I1F A;  3H65 A;  1Z23 A;  4FRM A;  3T4R A;  1FR9 A;  1G1L A;  1FO9 A;  3QZC A;  1PZT A;  1EYR A;  1S4O A;  1FOA A;  3IOI A;  3V0P A;  1OMX A;  3V7O A;  1NQI B;  2J9U A;  1D0Y A;  1WT2 A;  4ZDQ A;  4ASJ A;  2PFD A;  4R7P A;  4AYL A;  5F5H A;  2V0K A;  3CGX A;  4FRO A;  1ZJP A;  5BUO A;  1H7H A;  4IRP A;  4HO4 A;  4ECM A;  1M56 C;  2NUP B;  3EGD B;  4Y63 A;  1NF5 B;  3EH1 A;  3L34 A;  1Z63 A;  1TR2 A;  1R7X A;  3I5P A;  1WT3 A;  3T7O A;  4YJW A;  3KL4 A;  4HO0 A;  1G8X A;  2O1F A;  1ZU4 A;  1W57 A;  2R7U A;  5EGY A;  1M2V A;  4Q4Z F;  3JYH A;  2Q4J A;  5CQP A;  2RJ9 A;  3TZT A;  4CSA A;  3RKO F;  4HO6 A;  5AJO A;  4QDL A;  4P02 A;  1ZHZ A;  5L3Q A;  4FCE A;  3OH1 A;  1E5K A;  4I3M A;  4K6R A;  4HO8 A;  2ZU8 A;  4RBN A;  4FWV A;  4HCQ A;  1TW1 A;  4JD0 A;  4B4G A;  2DYS C;  2Q9C A;  2RIT A;  2KGO A;  4D11 A;  2R7Q A;  2G62 A;  3EG9 B;  5CI8 A;  1NHE B;  4U5H A;  2WVO A;  3UR3 C;  4E1K A;  3EZH A;  2WZG A;  3WG7 C;  3S29 A;  1R7Y A;  5CQO A;  3PHF 2;  1TKN A;  5IDT A;  1H7E A;  1R7T A;  2APC A;  2QH5 A;  2NUP A;  4YT4 A;  1O7Q A;  2PA4 A;  1LL2 A;  4KRV A;  1MNE A;  1H5T B;  2YCM A;  5DS5 A;  1D1B A;  3Q80 A;  4CIH A;  4YN0 B;  2R7S A;  4C7O B;  2YQS A;  1FZW A;  5C38 A;  4EEM A;  2R7X A;  1W55 A;  3DK5 A;  3HL3 A;  3SXA A;  1PD1 A;  4OD5 A;  1R7V A;  2AE7 A;  3F1Y A;  4KNR A;  3Q7G A;  1MC3 A;  1H5S C;  3OH4 A;  3LW6 A;  3N24 A;  4U5B E;  3ABL C;  3T7M A;  1LZ0 A;  4OIQ F;  2IXO A;  5CQL X;  2W45 A;  5FTS A;  1ZJ3 A;  3AG2 C;  1ZJO A;  4I1O B;  2Y3H A;  2AGD A;  1G3L A;  5C4F A;  5EIY A;  1ON6 A;  5CMG X;  1FG5 N;  2R7O A;  2KQ9 A;  1LL3 A;  4ZLC A;  1SMY F;  2I8B A;  1G2V A;  4BEJ A;  2VXM A;  2R7T A;  1FXO A;  2V0I A;  1HJJ A;  3ZF8 A;  3LS0 A;  4GEH A;  2AM3 A;  2WZF A;  2BO7 A;  5DQZ A;  4DOZ A;  1FWY A;  1WT0 A;  2WB7 A;  3DJ4 A;  3QVB A;  1BR2 A;  3O6X A;  4XTK A;  4J18 A;  2AM5 A;  4M2B A;  1H7F A;  2XME A;  1H5T A;  3RYL A;  2RJ0 A;  4KC4 A;  1LZI A;  4UEG A;  4FRB A;  3X2Q C;  3E70 C;  4FRQ A;  4HO2 A;  4M28 A;  2A6H F;  3S0X A;  2VSI A;  2R7W A;  3N9W A;  3ZLK A;  2NUT B;  4D0T A;  5B1B C;  1FR8 A;  3V0L A;  1ZHY A;  3U2W A;  4B6I A;  5C3B A;  1I52 A;  4KNW A;  2E87 A;  5JQQ A;  3W8I A;  2O9X A;  2X51 A;  4B4M A;  3SXC A;  1YP4 A;  4AE4 B;  5AJP A;  2IOQ A;  3SZR A;  3Q7L A;  4C3B A;  1NG1 A;  4E7Z A;  1LZJ A;  3SXB A;  1O7O A;  4MIX A;  3LLK A;  1V82 A;  1M2O A;  4XLP F;  2J0X A;  2OEF A;  3DM9 B;  3N2Z B;  1JV3 A;  3RH3 A;  2RJ4 A;  4G3S A;  2ICX A;  1HM0 A;  2CGE A;  4AX2 A;  1Z90 A;  1NZE A;  3KH2 A;  4KQL A;  4JVS A;  3FVY A;  4HFK B;  4WJ0 A;  2VSH A;  2EIK C;  1SZI A;  4YT8 A;  3SXD A;  4HFF B;  4KC9 A;  3I0G A;  2XXA B;  2J0A A;  4CJ8 A;  1Z3I X;  3PMR A;  1ZDG A;  3K7D A;  4I1M A;  1IIN A;  2EIJ C;  3NGW A;  3UMI A;  2KNH A;  2J9W A;  2E8B A;  3I0I X;  5EJZ A;  1D0X A;  3CKV A;  1SF8 A;  4LAC B;  3ZGG A;  3CKN A;  1YRO B;  3I0J A;  1OKK D;  4OIN F;  3SYN A;  4I44 A;  3LLI A;  5L6V A;  2Y3D A;  3U2U A;  3ZGF A;  1G8O A;  3DXJ F;  2A8W A;  4KC2 A;  3AQC A;  2E3D A;  1D1A A;  2CNW A;  1Z5Z A;  3K1I C;  3PKQ A;  1R81 A;  2CNW D;  3EZI A;  4XWJ A;  1JYK A;  2ZPA A;  1J8M F;  4ASY A;  3OGZ A;  4CSA C;  2NXV A;  1QGQ A;  1W77 A;  5T3W A;  2HV6 A;  4XLN F;  5DQT A;  2P72 A;  3DUV A;  1VOM A;  3B0P A;  1G93 A;  2YES A;  3OC9 A;  4GBP A;  1ZJ0 A;  3VAY A;  5C48 A;  4YT5 A;  4BJ1 A;  2VH3 A;  5L3V A;  4D48 A;  2ZXW C;  2PP4 A;  2JCL A;  1EZI A;  4Y64 A;  1M57 C;  3GAN A;  4U5C E;  3HLZ A;  2XXA A;  4D11 C;  1VZX A;  4HOC A;  3O3P A;  1FXJ A;  3B9Q A;  2WGZ A;  3IOJ A;  2WZL A;  3QMK A;  3JUK A;  3V0M A;  2FYB A;  5T3T A;  3U2X A;  4JZA A;  2VD4 A;  5CI9 A;  1V54 C;  4LW6 A;  1R82 A;  4EEO A;  3Q6M A;  2PX7 A;  2Y7A A;  4DVZ A;  2I5K A;  4B2W A;  5KYN A;  1BR1 A;  4BJ5 A;  1G95 A;  1VPA A;  2FFU A;  4ARW A;  5BXC A;  4B42 A;  5FTV A;  1RJ9 A;  4CS8 A;  3NKD A;  3HJC A;  4PFP A;  3DAF A;  5KYW B;  3CKO A;  1R80 A;  3T6B A;  4D0Z A;  3EPV A;  3GUE A;  2V0L A;  3USR A;  3DM5 A;  4KI2 A;  2RJ1 A;  5C8R A;  4KBL A;  4RDA A;  1J8Y F;  3I5Q A;  2WVN A;  4O79 A;  1VGZ A;  2RIX A;  2OEG A;  3DMD A;  3F1C A;  3OKR A;  5C4E A;  1Z6A A;  1IIM A;  1S4P A;  4CS9 A;  1ZYR F;  5C1L A;  2Y6P A;  3EHM A;  4CJC A;  2JD3 A;  2WAW A;  4P6I C;  3JUJ A;  2ICY A;  4Y9X A;  2QTV A;  4A2N B;  2UX8 A;  2YC5 A;  4EE5 A;  4PJL A;  1WVC A;  2PGV A;  2Y4K A;  2G3V A;  1H7L A;  1H4D A;  5FYE A;  2I5E A;  1JV1 A;  2J45 A;  5KYX A;  3EGD A;  2JCK A;  4IRQ A;  1FRW A;  5C47 A;  2PX3 A;  4BG0 A;  2AH9 A;  2FYD B;  3FWW A;  1VIC A;  1JVD A;  2YQJ A;  5F5F A;  1VYI A;  2A6E F;  1ZHW A;  1TWG A;  3OAM A;  4LER A;  3NYM A;  3S27 A;  1ZCT A;  3OH2 A;  4HO9 A;  1H5R B;  4HG6 A;  2WVK A;  4J30 B;  4YT2 A;  2FGY A;  3AG4 C;  3FOQ A;  1MP5 A;  3ZSU A;  4YS8 A;  2OCC C;  1D1C A;  2WE9 A;  4G7O F;  5FCL A;  5KYW A;  4PFO A;  1ZCY A;  1O5H A;  2VS4 A;  1KWS A;  3OH0 A;  3I4U A;  2FFV A;  2YZS A;  2Q9B A;  1O23 B;  4KPX A;  3SX3 A;  4C2S A;  2RJ7 A;  2D7R A;  4DDZ A;  3DZA A;  1ZCU A;  2M4E A;  4Y7F A;  5CMI A;  4RD9 A;  3M1C B;  3EG9 A;  4IWB A;  5KYX B;  4JJG A;  4B4B A;  1ZU5 A;  1H5S B;  4L41 C;  1TWC A;  1TWA A;  3Q6N A;  3ECS A;  1HJL A;  3V8Z A;  2ZXP A;  2P7V A;  1MP4 A;  4CVH A;  1VMA A;  4FIX A;  2Y3G A;  1QG8 A;  3EFO B;  1VGW A;  2D5R B;  2QGI A;  1KU2 A;  2GGO A;  2X5S A;  2PF4 E;  2Q3T A;  3FHD A;  1ZI1 A;  2Y4M A;  4FRL A;  3F47 A;  4C7O A;  1D0Z A;  1ZI5 A;  2XWL A;  2J46 A;  1ST6 A;  3I0K A;  1ZI3 A;  5C1G A;  1H4E A;  2Y4L A;  2FY7 A;  4G3Q A;  4CS7 A;  4JUR I;  1ZI4 A;  5FV9 A;  4E7S A;  4PJM A;  5B1A C;  2D7I A;  3SX7 A;  4O6Y A;  3TD7 A;  4EEA A;  4J32 B;  3TQD A;  1ZHT A;  3O39 A;  4O6N A;  5D92 A;  4OIP F;  3CKJ A;  3ZIB A;  3E26 A;  1HM8 A;  3V0N A;  4BJ6 C;  1OCR C;  3B0V C;  4G3P A;  1K4V A;  1TWH A;  4YWQ A;  4ULW A;  2H7V C;  2XMH A;  3NYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...