5D91A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
b'MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AF2299 protein,Phosphatidylinositol synthase
molecule tags Membrane protein
source organism Archaeoglobus fulgidus
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
total genus 115
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d91A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d91A01
4MNDA 4O6MA 5D92A 5D91A 4O6NA 4Q7CA
chains in the Genus database with same CATH superfamily
5L0DA 1FFTC 5C4FA 1U6HA 2ICWG 1YAUO 3KMIA 2B0HA 3RQGA 3C8GD 1H7GA 1B68A 4C7OA 4MVZA 3ZDLA 4K0DA 4DDZA 1D1AA 2Q7RA 5TJ5E 2MZBA 3G4XA 3UGOA 4E7ZA 3PMRA 3ZLKA 4G78A 4GBPA 3U2VA 1CGME 3E9VA 2J46A 3LS0A 4E1KA 1ZHWA 5AJNA 1NBBA 1T5OA 1LE4A 2AWCA 2VH3A 4U5EE 2EPKX 3K8EA 1A7VA 3EHNA 3T7MA 1H7TA 3O10A 4RBNA 2P61A 3CZ6A 4ANJA 1NU7D 2RJ0A 2EPMX 5KYUA 3SXCA 3NRHA 4FRHA 3R2WA 1H4CA 3IQTA 3DMDA 3TK0A 1RKEA 2W0WA 3SXZA 1G3LA 2RJ8A 3WAQA 2PA4A 1H7FA 3LJBA 1H9GA 4HG6A 5KYXB 4QI2A 4WGYA 3E25A 1VB5A 5E3CA 3VAYA 1LL0A 3U8PA 4FRLA 2YQYA 1N1CA 1Q0FA 2YL1A 1TWHA 4DVZA 3ZTZA 3OH3A 2RIYA 5HS2A 1GM5A 3WODF 1JAFA 1R7YA 3D98A 3DE9A 3DKAA 4CBEA 1QG8A 2ASRA 1H7EA 1ORSC 4W8KA 2VC9A 3OAMA 4B4GA 2UUHA 3V7OA 2RJ1A 1ZVZA 2Y4MA 1VOMA 3T6JA 2YC3A 2GA0A 1ZCYA 1C17M 1GA8A 4IGGA 5D91A 1OW8A 1A41A 1T9KA 2RITA 2RJ5A 1JVGA 4HOCA 3SXBA 3F1YA 1A0BA 1RKEB 2J0AA 2VK9A 1CPQA 1E85A 5F5FA 2HMZA 3N9WA 1D0YA 4XTKA 1TW5A 4Z9IA 4XPWA 3UMIA 3AQBA 4BJ6C 1ZI3A 2Y4KA 4IWBA 1LZJA 4XWIA 3JSZA 3HNJA 3K8DA 3C8GA 1YP4A 1KWSA 5L0GA 5F28E 1ZJOA 4PJJA 4B6IA 2G3KA 3SX3A 2KJGA 4ARWA 3DI5A 5COFA 1VGZA 2HMQA 2V0JA 4JRZA 2Q9CA 2BE5F 1G23A 4FRAA 5KYYB 3L8IA 3SX8A 3OH2A 1EKYA 1JYKA 4AL1A 4XLNF 5IFYA 1ZW2A 4NC3A 2YWAA 4ZLCA 4YT8A 1TWGA 4M2AA 5C3BA 3B0PA 3LS1A 5C8RA 3OH1A 1I4ZA 2J9UA 2L7AA 4HFKB 5HV9A 2JCJA 2YHSA 2YZSA 3M4CA 1WATA 1ZW3A 4DBRA 3U3BA 3FAJA 1G8XA 2IYLD 1WT3A 4QDLA 1EA8A 1AVOB 4KPZA 1QQ3A 3SXMA 1OCZC 2LFFA 1Q0GA 2P1AA 4EKWA 3IQ6A 4H54A 2YLIA 3RVZA 2IXOA 1V84A 4HO0A 2PBEA 4FWVA 2R7XA 2R7QA 2KC3A 1FR8A 1ZHZA 3LUTB 1DOVA 1YP3A 1U0BB 3W2WA 2OI6A 1D1BA 4ECMA 3I0IX 1HY5A 2C0NA 2XMHA 4R32A 3EGDA 4XPYA 2FYDB 4HEAJ 2RJ6A 2D5RB 1HE9A 2RSEB 4DOZA 2VASA 3IQ5A 2QTVA 4EE3A 1ZYRF 3DM5A 3NMKA 3W4YA 3UMHA 3V0QA 1JOGA 1NSGB 3CKOA 1LIHA 3ABLC 1FO8A 3C63A 2APCA 4LLCA 1OMZA 2IXNA 1H5RA 1RXQA 3ZWIA 1XZPA 4XEVA 3K33A 4HO8A 3EHMA 2V0KA 3AG1C 3FMSA 3JTJA 3AJMA 5A6KA 2HS5A 1HV9A 3C7JA 2H7OA 1A7DA 2FFHA 4OIPF 1ZJ2A 3V91A 4J32B 3M79A 4IARA 1OKKA 2E87A 3MBGA 2D7RA 2H7BA 4U5CE 2EINC 5JLIA 4YK5A 3BRJA 2RJ4A 2ZD9A 4AK9A 1ZZPA 3LLIA 2M4EA 4J18A 2UUIA 1QKRA 3GODA 4N06A 1TW1A 2DI3A 3ASNC 2OEGA 1JRAA 4MNDA 1LVKA 4BPMA 5L3VA 4YL0A 3C8GB 4NTBA 1NQIB 4EWCA 5FCLA 2G3VA 1YP2A 1Z63A 2Q3TA 1GQCA 1W55A 1FXOA 4HO6A 2I5EA 1YDIA 1C03A 2YLGA 3E26A 4D4XA 1G97A 2VS3A 2HSBA 4UEGA 1UFBA 3I5QA 2VFZA 4HO5A 3A9CA 4MVOA 1J8MF 2AU5A 1LS1A 1IW7F 2Y7AA 2PX0A 3ECSA 2A8UA 2PNOA 4HCQA 2A0BA 4NAKA 1WT0A 4PACA 1ZJPA 3UR3C 2Y4JA 5EIYA 4XPXA 4EHPA 1YA7O 4IRQA 1SMYF 2JX0A 1RJ9A 2AE7A 4BQHA 1HM9A 4EE5A 2P6VA 1E86A 1NF5B 1V74B 1LE2A 1ZCUA 1JPJA 3RMWA 4KQLA 1BDJB 2VSHA 2Q9AA 3U2UA 3KYIA 1LS4A 3PNNA 1H9TA 4CIHA 2J8WA 3M1CB 4FRDA 4YL3A 2A0UA 2ZU9A 4CSAA 5C3DA 5AJOA 3GM2A 3H2VA 2V0IA 3S90A 2XWMA 1ZHJA 5T3TA 4AE4A 1ZI5A 2H7VC 2RJ7A 4DBQA 3W2VA 1FG5N 2OU6A 2AM4A 3CQZA 4CJ8A 1ZHYA 2DB4A 2VD4A 4P9FA 4EEOA 4FX5A 2E3DA 1VK5A 1RMVA 4B4BA 4PJLA 3RSBA 3CSKA 2HV6A 3NDBB 2Y69C 1QPUA 3ITFA 4OD5A 3W8IA 3L8JA 5GPGB 3IOHA 3Q6NA 4B4MA 5AC5A 5FU8A 4U5HA 3U0CA 5HSWA 4I44A 3ZC4A 2R7WA 4CJCA 1IIMA 3AG2C 3RYLA 1XZ6A 3V0OA 5IDSA 1C02A 1G2VA 2OKUA 4DVYP 4JVSA 2JD3A 3U2MA 1TZFA 3C62A 3N0TA 5C1GA 2CDQA 2R03A 4Y6UA 2XM4A 1M56C 1A7EA 2WZLA 2VS4A 2A8WA 3FWWA 1GGQA 4KNRA 1HJLA 4YT4A 1ON8A 1WOLA 5C38A 2V26A 4O7GA 2Q4JA 3FVYA 2P0NA 4Y7GA 5E3AA 3ZG1A 4D11A 2CCYA 1M6TA 1E2XA 2KQ9A 5DQTA 3EQLF 4KC4A 3MYFA 2OJQA 3K1IC 1H4EA 1O3UA 1Z3IX 1IINA 1MMDA 3S0XA 5B1BC 3UGPA 1APCA 1WWPA 3U3FA 4B42A 1CGOA 2V0HA 5CMIA 4ONSA 2PF4E 2A6EF 2R25A 2VB6A 2QKXA 2HKVA 4HO9A 1Z5ZA 3NKDA 5JSLA 4CJOA 3WG7C 3RW0A 3KL4A 4HO4A 2D7IA 3N2ZB 2MWQA 2J0WA 5CI8A 4KPXA 3JYHA 2YC5A 2Q4FA 2CU2A 1GS9A 2XS8A 4LDKA 5JRAA 4AE4B 3S29A 1LM3B 5L0FA 4P02A 2Z86A 1EI7A 2OJED 4Y9XA 3SP1A 1I4YA 2FAPB 4NTFA 3NG1A 5DLJA 3TJ6A 4PJMA 1R80A 3VF0A 3EFOA 2IXMA 1Q0KA 1R7UA 4KNXA 4IJJA 1UG7A 2Z15A 3N24A 1H5TA 3JYYA 2W0VA 2ZXPA 4CS9A 4JE9A 5EHHA 1OR2A 4NY3A 3W8HA 2UX8A 2XM0A 3AG3C 4U5GA 1S4PA 3UNGC 1ZI1A 1YZAA 4LACB 4JURI 4ULVA 5DS4A 2GDCA 3U9MA 3V0MA 4YL1A 5J49A 1W77A 1VYIA 4MVQA 5EJZA 2TMVP 4PFPA 4FESA 4MTGA 3KPHA 2OI5A 2E8BA 1TFKB 4KT7A 1YZCA 4KC2A 4DECA 2PP4A 4G7ZF 2HJ3A 5L0JA 1OR3A 4FRQA 5CQLX 5B1AC 3I0CA 3ZF8A 4ULWA 1VH3A 1KNYA 4Q5SF 5K0IA 1V55C 5CMFX 2ICXA 4U9EA 3JCUQ 2JCLA 2HFIA 1ZDGA 3V5ZA 2O1FA 2YQHA 2R05A 4EBJA 1JVDA 2L81A 2RIXA 3DJNB 3CKJA 4JEAA 1INIA 4KNWA 1LZ0A 4FROA 3NMIA 3U5SA 3ABMC 3TD7A 3ST8A 1OCCC 5FTVA 2O9XA 4Y6NA 2VCBA 3NYJA 2WZFA 4YT5A 4JKVA 1INJA 2XWNA 3OGZA 2L6FA 2R7VA 1FTSA 3GANA 5D92A 4FQWA 1PCXA 4BMAA 4JZAA 1H5SC 3F46A 3DZAA 2CYDA 2GGQA 3USQA 2VSIA 1QVXA 3JUJA 1R82A 4M63A 3M15A 2HUJA 3CAXA 3MX3A 3RH3A 1O23B 1TWCA 3S84A 2EPLX 4KI2A 4K1OA 4M2BA 2ZU8A 2LFDA 1O0RA 2OOCA 2EILC 3JTLO 3IPMO 3C18A 3EGDB 3JRTA 1H5TB 3TOMA 1OW7A 3QVYA 3B29A 4B3UA 3B71A 1E83A 1FOAA 3TJ5A 1VM8A 3POVA 1ZJ3A 3O3PA 1R7VA 3HJCA 1T01A 1V83A 3I4UA 3LAYA 3VM6A 3QMKA 4Y63A 3G50A 1BBHA 2B0JA 3GORA 1K05A 4M28A 2PGVA 3FOQA 3LNMB 3TQDA 1FZWA 5DVWA 3G4ZA 3S27A 1AEPA 1JYLA 2FYCB 2XSEA 4EIYA 1WN0A 2J7PD 3Q7LA 5L6SA 3Q7UA 1V4AA 4BJ1A 3SNHA 2GWWA 2R7TA 2IM8A 5C1LA 4DE7A 3L34A 5A6BD 2L6GA 4GYTA 3F1CA 3EE5A 1U89A 4FREA 1EYRA 5JP7A 2WE9A 2V0LA 1OW6A 4Y7FA 1JMWA 1EZIA 2YRFA 2NSFA 5JUAA 4U5FE 3A11A 4OIOF 3OWTA 4AYLA 4ZDQA 1BR1A 4N6CA 1G4WR 2L6HA 2LP4A 2W4MA 2YLDA 3HTKC 2Y3GA 3GM3A 1MMGA 2QE9A 5E33A 1SYQA 4Y7UA 3RMVA 4JTAB 3SXKA 1LI5A 2BO6A 1G9RA 4XEFA 1NU9C 4B2WA 3S9OA 3SXGA 3ZQVA 3ZGGA 4N6HA 1FFHA 1OXBA 1FR0A 3LNRA 5B3SC 1G4US 5KYXA 1G95A 1ZHXA 2AVKA 2PGYA 3CU0A 1PZTA 4EBKA 4NTAA 3CKVA 2Y3BA 3IOIA 3LESA 4E0IA 2YCMA 5KYUB 1R5ID 2LCHA 1HMOA 3HL3A 2Q00A 4H4KC 1VZXA 1D0ZA 2YEVA 2DGJA 1VLSA 4O6YA 2PX3A 1GQ9A 1YA9A 3T4RA 2Y39A 3I0JA 2NXVA 2YL0A 3GM1A 3J06A 4G0HA 4X0RA 5CIVA 1MP4A 3I0GA 2NPUA 4BJ5A 5A6JA 1GQAA 2YQSA 2W9YA 1FMVA 4CS9C 1MMAA 2XWLA 4FAPB 2XXAA 1G1LA 1XHBA 2EIKC 4Y64A 2WVQA 2WVOA 3FOOA 2LQGA 5F5HA 5CMJA 3V0PA 4ER9A 3AOUA 2XL8A 2EPNA 1E5KA 2KSFA 2BO8A 2CGEA 3GEIA 1S05A 1H3MA 1G8OA 3LW6A 1O7OA 2J7PA 2QNLA 4O6MA 5DDVA 1Y4CA 2XLHA 1MP3A 3V5YA 3EZHA 4Y7TA 2MHRA 2VXMA 4FRBA 5C49A 2AM3A 1ON6A 2R9RB 4LDRA 2FYAA 4NCQA 1M2OA 1FMWA 5EJ1A 3KH2A 1HM0A 1M57C 4F4BA 3QVZA 2D0JA 4J7TA 1O5HA 3Q80A 3V8YA 3CKQA 3R7CA 3S28A 2GGOA 4GQHA 2M64A 3T7OA 1VGUA 4ASYA 4LW6A 3EH2A 1FGGA 5CI9A 2LIGA 4Z9HA 5JVEA 2J0XA 2X65A 2VCCA 1H5SD 3HLZA 4G3PA 2QGIA 1PD0A 1FRWA 1BR4A 2J0BA 1HJJA 4YWQA 4I1OB 4CX9A 5BQGA 1I5NA 2LK4A 2W45A 3U8VA 3EH1A 1JPNA 2HJMA 1VLTA 1LI7A 4Y7VA 3OKRA 4D4NA 1ZJ1A 4ASJA 4IRPA 1LVWA 2KNHA 3F47A 3SXEA 3U9JA 1MC3A 2GAQA 3H65A 2XLWA 5DDTA 3HNLA 3U0YA 4LDQA 3BRKX 4PFOA 4WJ0A 4XLPF 3MYIA 4LLEA 3DAGA 2XS1A 2OG2A 3FAPB 4U5BE 1G5ZA 1K04A 5KYNA 1HW2A 4U5DE 4FIYA 3SX5A 3IEEA 1GX0A 1H7QA 2ZXWC 2G62A 2GFHA 4JD0A 3OC9A 1NFNA 3O6XA 3V8ZA 1T6UA 2R7UA 1GX4A 2KW3C 4Q4ZF 3DJUB 5AJPA 2YQJA 5IY5C 1R81A 4UDVA 2OEFA 1VGWA 4EBBA 5CMHA 2I5KA 1H7IA 2JCKA 1KU2A 2X0CA 5CQNX 1OQMB 4CSAC 1ORYA 3X2QC 5JT4A 1TR2A 4G3QA 2P6WA 4JIOA 3KYJA 5COMA 4BJTA 1FWYA 3CKNA 3RQEA 4DRJB 1NHEB 3SEOA 3RF3A 3NYLA 1VGTA 5C3AA 1LPEA 5CQMX 3RQFA 4EEMA 1YARO 1IZMA 3ZGFA 2EIMC 3DUVA 2NUPA 3DAFA 5DS5A 4M4KA 3AG4C 4AYJA 3Q4SA 2IXPA 3I0HA 1SS9A 4MVUA 4MVMA 3QVBA 1Q0MA 3ZIBA 4BG0A 256BA 1H6GA 3ATPA 1H5SA 3LEVA 3MFNA 3PKQA 5DS6A 1QGSA 2JPUA 4D0TA 4CIPA 1QGQA 1R4TA 1TFOB 2PX7A 2FY7A 5C1HA 4JC7A 2FGYA 2XMEA 4FRPA 4FCEA 5KYYA 1Q0DA 1CPRA 1GWVA 1V82A 1S4OA 3VRCA 4KC1A 4NAIA 4AL0A 4W8PA 4DRHB 1W2WA 3EFOB 3TOLA 1RCPA 2BL2A 3RKOF 2I7BA 5BQIA 4JCZA 2OEVA 3ZQYA 3M4BA 1TWAA 2CNWA 1XZQA 1ST6A 4J7YA 2Y3DA 4NALA 1W57A 2EPOA 2A69F 1LZ7A 3EJNA 3ZSUA 2F22A 4OIQF 3E70C 4L41C 3T9OA 2FFUA 1YVIA 1FAPB 3FDQA 2P72A 1J8YF 5A69A 4U9DA 2IOQA 1QZXA 1VH1A 1ZCVA 3SXAA 2HZ8A 4JJFA 1CGNA 1OKKD 5DQZA 4JW1A 5JQQA 2PFDA 2J9BA 1NZEA 3DJ4A 2AGDA 1FNTc 3JT1A 3PHF2 3ZVRA 2YL7A 2Y4LA 1G93A 1NG1A 2ZPAA 3KIAA 2XLVA 4DXWA 4YN0B 3DK5A 2I8BA 1Y6DA 1ZI4A 2V3CC 3DD7A 2CW0F 2DYRC 4A4AA 4YS8A 1DOWA 5FYEA 2FFVA 1JV1A 4MW8A 1T6IA 2Y6PA 4P00A 1WASA 4KC9A 4KNVA 4MQ9F 1G0RA 2J9WA 4AC3A 2NUPB 4JTDB 5C36A 3R3IA 4KBLA 3JSEO 4OINF 1VPAA 1WTYA 4HE8D 3JUKA 2AM5A 3RFYA 3IOJA 4NANA 1Z90A 3IQCA 3I0FA 1KTMA 2C03A 2HSQA 4DJ9A 1V54C 2YQCA 3Q6MA 2OQMA 1JR8A 4E18A 1S4NA 5C47A 5A6BA 3Q7GA 4C3EA 5C4DA 1I52A 3AQCA 4E7SA 2QH5A 4D0ZA 2C04A 2XL4A 1OMXA 3U2WA 1VYKA 3GWNA 2YL3A 1ZHTA 4XQ1A 4HO2A 2WL8A 5KYWA 3FHDA 3ASOC 4EUKB 2O1GA 4YT2A 3C8ZA 2I15A 2EIJC 4G7OF 4MIXA 2AWYA 3SYNA 5BXCA 1NLXA 4EE4A 3JRMO 1NMMB 3U2LA 1EQ1A 2AH9A 4EEAA 3OEOA 1S7ZA 4CVHA 3EZIA 2WVLA 3TZTA 2NUTA 4MW3A 4OIRF 1FGXA 4CS7A 3EGXB 1HW1A 2ZU7A 1QWJA 3HKKA 1MNEA 4RDAA 5B3IA 5EGYA 3V0NA 2AESA 3K6BA 4WGZA 3LLKA 4G7HF 5AC4A 2AP3A 1NFOA 1Z7Qc 2R02A 2WGZA 2CNWD 4O6NA 2J9VA 3D5NA 1ZU5A 1YROB 5CQPA 3EGXA 2ICYA 4J30B 5T3WA 1YYJA 1K4VA 1TKNA 4CDVA 4ZLDA 3NKEA 3I0EA 3H2UA 3RVYA 1ZIZA 4KXOA 5FTSA 2W4BA 4L6RA 2Q9BA 1RJ9B 3T6BA 3U0XA 1M2VB 3POLA 3B0UX 1WT2A 3R2PA 5BQHA 1H4DA 3B0VC 1L7CA 3V90A 4NQFA 5L6VA 1LL3A 1H7LA 2KYHA 2IBFA 3V0LA 4LW3A 4R7PA 1OCRC 3FXHA 1ZJ0A 5L0CA 3X1OA 3USRA 1HMDA 3ZTMA 4I3MA 4AX2A 1PV3A 2WVMA 1OXKA 3NMJA 5C4BA 2O1HA 1MNDA 3B9QA 2XXAB 3DXJF 2R7SA 3U2TA 3VYWA 2OEXA 3LEOA 2XLEA 4D48A 3I5PA 1WT1A 4PK4A 2OI7A 4JTCB 2ETSA 5C48A 2H8AA 2FYBA 2RIZA 1D1CA 1SR2A 3SX7A 3SXYA 1TQGA 2RD9A 3K1IA 1LZIA 5AGFA 5BUOA 4K6RA 2JCOA 4OD4A 4MTOA 4G87A 2J45A 4AAWA 2WAWA 3RIPA 3WHNA 3L0IA 2X60A 3D8VA 5CQOA 4LERA 3EG9A 2XL6A 3U2XA 2A6HF 4MVRA 4FIXA 2AECA 1SF8A 3MLGA 2MYSA 5FU0A 4B5BA 3QZCA 4BJ6A 3K7DA 1L3PA 2QUPA 3HNKA 1FR9A 3O55A 4BEJA 4MS2A 5C4EA 2Z87A 2QY9A 3I0LA 4MVSA 4P9TA 4DRIB 1YJGA 1LL2A 2LSEA 1MP5A 2VXLA 1M2VA 1H5SB 5L0HA 3GEHA 2WVKA 3ABKC 1BR2A 3CEXA 4Y62A 1LKXA 2BO7A 1RKCA 2Y3HA 4CS8C 4IB4A 3TQOA 2R7OA 3EPVA 2YESA 2L9JA 1OCOC 3V5XA 3EG9B 2LD6A 3PKPA 4QI0A 2XRHA 2KK1A 4B2XA 4CS8A 1PZYB 1VMAA 3OH0A 4PR9A 4EVWA 1OQCA 5T1DB 4JISA 3L1MA 5CMGX 1QSPA 4HFFB 2NUTB 3JZ0A 4JJGA 1HE1A 3I0KA 1WGWA 4MTFA 1F1MA 4G3SA 2R7RA 4BEMJ 2YKZA 2A1DD 5FZTA 1FXJA 1ZDFA 2YVKA 4N4WA 5COGA 1XWJA 2X5SA 3QW1A 4E17A 3FOPA 2BC5A 1QLEC 4O79A 5JS5A 2BO4A 4EEGA 3K66A 3HNIA 5FV9A 3PCVA 2XLMA 1T6QA 2NG1A 4JEBA 2DPWA 3GUEA 1BZ4A 1E84A 3GEEA 2P7VA 2OCCC 1YYXA 1O87A 1NKHB 2X5ZA 5L3QA 4CDYA 2WZGA 1TVYA 5I1FA 4FRMA 1MMNA 2HV7A 1MQVA 1VTMP 1H5RB 2DYSC 4XWJA 1ZCTA 1GWWA 4I1MA 4Z9JA 2XLDA 1FO9A 1R7XA 4PJNA 2X51A 3BCVA 2WVNA 2VS5A 1NWGB 2XLOA 3UMKA 4IAOA 4HO3A 3NGWA 2ZXOA 4RD9A 4C3DA 3ZLLA 3O39A 3AGUA 1H7HA 2WEEA 4K7BA 3SXDA 1Z6AA 3T7NA 3T6GB 3AGTA 1K40A 5EK0A 4BJ5C 1ORJA 2ZXRA 3K1HA 3DM9B 4YJWA 3OH4A 3US6A 5FUHA 4IRUA 2D4UA 4KRVA 4C7OB 1PD1A 1D0XA 4D11C 5C4CA 3DWWA 3I0DA 3NYMA 5L0IA 2RJ9A 5A6AA 4GEHA 2A68F 4CJBA 1SZIA 3SZRA 3IHUA 4FCUA 3PDMP 1JV3A 2VCAA 5KYWB 3OA1A 4Q7CA 3TULA 4A2NB 1Z23A 1WVCA 2WB7A 1VZTA 1R7TA 3DE8A 3QTHA 4P6IC 1YLMA 4E0HA 3GWLA 1WSZA 1ZU4A 4C2SA 2NSGA 5E2QA 4IAQA 3BEHA 1VICA 3CGXA 2QLAA 3KKBA 4CDAA 2KGOA 4CJGA 3SPTA 4C3BA 4MYBA 4XEKA 4JCHA 1VZUA 3QW0A 1O7QA 4WABA 5IDTA 1AUEA 2P73A 1HM8A
chains in the Genus database with same CATH topology
1Z90A 1ZI5A 2H7VC 2RJ7A 1FFTC 1FFHA 3I0FA 4DBQA 3W2VA 1FG5N 4CJ8A 2AM4A 3CQZA 5C4FA 1ZHYA 3KMIA 2C03A 3LNRA 2VD4A 1H7GA 1V54C 4C7OA 5B3SC 5KYXA 1G95A 1ZHXA 2YQCA 3Q6MA 2PGYA 1S4NA 4K0DA 4DDZA 5C47A 4EEOA 3Q7GA 4C3EA 3CU0A 5C4DA 1I52A 3AQCA 1D1AA 4FX5A 1PZTA 4E7SA 2QH5A 2E3DA 2MZBA 4D0ZA 1VK5A 3UGOA 2C04A 4E7ZA 4PJLA 4B4BA 3CKVA 2XL4A 2Y3BA 3RSBA 1OMXA 3ZGGA 3PMRA 3U2WA 3ZLKA 1VYKA 3IOIA 3CSKA 2HV6A 4GBPA 3U2VA 3LESA 2YCMA 3NDBB 1ZHTA 5KYUB 2Y69C 2WL8A 4HO2A 3E9VA 3ITFA 5KYWA 2J46A 3FHDA 3LS0A 4OD5A 3W8IA 1ZHWA 4E1KA 3ASOC 5AJNA 3IOHA 3Q6NA 2VH3A 3HL3A 2O1GA 4B4MA 4H4KC 4YT2A 5FU8A 4U5EE 4U5HA 1VZXA 5HSWA 1D0ZA 4I44A 2EIJC 2YEVA 3ZC4A 2DGJA 4G7OF 3K8EA 2R7WA 4CJCA 4MIXA 4O6YA 2PX3A 3EHNA 3SYNA 1IIMA 5BXCA 3AG2C 1GQ9A 3RYLA 1H7TA 3T7MA 3T4RA 2Y39A 3I0JA 4RBNA 3CZ6A 1XZ6A 3V0OA 4EE4A 2NXVA 4ANJA 1NMMB 3I0GA 4G0HA 1NU7D 4X0RA 1MP4A 2RJ0A 5IDSA 5KYUA 1G2VA 3OEOA 1S7ZA 2AH9A 3SXCA 4EEAA 4CVHA 3NRHA 3EZIA 4BJ5A 3R2WA 1H4CA 4DVYP 4FRHA 2WVLA 3TZTA 2NUTA 2YQSA 3DMDA 2W9YA 1FMVA 4JVSA 1MMAA 4CS9C 1ZHJA 2XWLA 2JD3A 2W0WA 4OIRF 2XXAA 1TZFA 1G1LA 1FGXA 4AE4A 2EIKC 4CS7A 1G3LA 1XHBA 2RJ8A 4Y64A 2WVQA 2WVOA 3N0TA 5C1GA 2CDQA 2PA4A 3EGXB 4Y6UA 1H7FA 3LJBA 2ZU7A 4HG6A 1QWJA 1MNEA 4RDAA 5F5HA 5CMJA 5EGYA 3V0NA 2AESA 3V0PA 3K6BA 1M56C 3LLKA 5KYXB 4G7HF 2WZLA 4QI2A 2VS4A 3E25A 2A8WA 5E3CA 3VAYA 3FWWA 1E5KA 2WGZA 1LL0A 2BO8A 2CNWD 4FRLA 4O6NA 2CGEA 2J9VA 1HJLA 4YT4A 4KNRA 3D5NA 1N1CA 1ZU5A 1ON8A 1YROB 1H3MA 3EGXA 2V26A 5CQPA 5C38A 4O7GA 1G8OA 3LW6A 2ICYA 4J30B 5T3WA 2Q4JA 1TWHA 2J7PA 1O7OA 4DVZA 3FVYA 4O6MA 1K4VA 5DDVA 1TKNA 4Y7GA 4ZLDA 3NKEA 5E3AA 1MP3A 3ZG1A 2RIYA 3I0EA 3OH3A 1ZIZA 5HS2A 4KXOA 3EZHA 4Y7TA 5FTSA 4D11A 2KQ9A 3WODF 2VXMA 4FRBA 2W4BA 5DQTA 5C49A 2Q9BA 1RJ9B 3EQLF 3T6BA 1ON6A 1R7YA 2AM3A 3U0XA 1M2VB 3D98A 4KC4A 3POLA 3B0UX 1WT2A 2FYAA 4CBEA 3K1IC 1H4EA 1H4DA 3B0VC 1QG8A 3V90A 1M2OA 1Z3IX 1FMWA 1H7EA 1IINA 5EJ1A 5L6VA 1MMDA 3KH2A 1LL3A 3S0XA 4W8KA 1H7LA 1M57C 1HM0A 5B1BC 3OAMA 4F4BA 2XWMA 4B4GA 3V7OA 2RJ1A 2D0JA 3UGPA 4B42A 2Y4MA 1O5HA 1VOMA 3T6JA 2YC3A 3Q80A 4LW3A 3V0LA 4R7PA 3V8YA 1ZCYA 1OCRC 3CKQA 1GA8A 1ZJ0A 3X1OA 2V0HA 3USRA 4AX2A 4I3MA 5CMIA 2PF4E 2WVMA 5D91A 3S28A 2A6EF 2VB6A 5C4BA 2O1HA 2RITA 1JVGA 2QKXA 2RJ5A 4HOCA 4HO9A 1MNDA 3SXBA 3B9QA 2XXAB 2GGOA 3DXJF 2R7SA 3F1YA 3T7OA 3U2TA 1VGUA 4ASYA 1Z5ZA 3EH2A 3NKDA 3VYWA 4LW6A 2J0AA 1FGGA 2VK9A 3WG7C 4D48A 5CI9A 3KL4A 3I5PA 4HO4A 2D7IA 5F5FA 1WT1A 4PK4A 2J0XA 3N2ZB 2X65A 1D0YA 2J0WA 2MWQA 4XTKA 1TW5A 3N9WA 2OI7A 5CI8A 4KPXA 1H5SD 3JYHA 3UMIA 3HLZA 3AQBA 2YC5A 2CU2A 2FYBA 2RIZA 4G3PA 4BJ6C 5C48A 1D1CA 1ZI3A 2QGIA 2Y4KA 3SX7A 4AE4B 1PD0A 3S29A 1FRWA 4P02A 2Z86A 4IWBA 1BR4A 1LZJA 2J0BA 1HJJA 1LZIA 3JSZA 4YWQA 4I1OB 4XWIA 3K8DA 5BUOA 3SP1A 4Y9XA 1YP4A 4K6RA 2JCOA 4CJBA 1KWSA 3NG1A 2W45A 5DLJA 4OD4A 3EH1A 4PJMA 1R80A 1JPNA 1ZJOA 4PJJA 4B6IA 4G87A 3EFOA 2IXMA 2G3KA 3SX3A 2KJGA 4ARWA 4Y7VA 1R7UA 4KNXA 2J45A 4IJJA 3OKRA 2Z15A 1VGZA 2V0JA 4AAWA 3N24A 1H5TA 1ZJ1A 2WAWA 2Q9CA 2BE5F 1G23A 4ASJA 4FRAA 3RIPA 2ZXPA 5KYYB 2W0VA 4IRPA 1LVWA 2KNHA 3F47A 4CS9A 3SX8A 3SXEA 3OH2A 5EHHA 3L0IA 1MC3A 2X60A 3D8VA 5CQOA 4NY3A 4LERA 3W8HA 3EG9A 1JYKA 2UX8A 3AG3C 3U2XA 4U5GA 4XLNF 3H65A 2A6HF 1S4PA 3UNGC 5DDTA 5IFYA 1ZI1A 4ZLCA 4YT8A 4LACB 3U0YA 4JURI 3BRKX 5DS4A 4FIXA 1TWGA 4PFOA 4WJ0A 4XLPF 2AECA 4M2AA 5C3BA 3B0PA 3LS1A 3V0MA 1SF8A 3MLGA 2MYSA 3OH1A 2J9UA 5FU0A 4B5BA 5C8RA 3QZCA 4HFKB 4BJ6A 1W77A 5J49A 3K7DA 1VYIA 4LLEA 2JCJA 1FR9A 5EJZA 2YHSA 3DAGA 4PFPA 2OG2A 4BEJA 4FESA 2YZSA 4U5BE 4DBRA 3FAJA 1G8XA 2IYLD 5C4EA 1WT3A 2OI5A 4QDLA 5KYNA 4U5DE 2E8BA 2Z87A 4KPZA 4FIYA 3SX5A 2QY9A 3IEEA 1GX0A 1H7QA 3I0LA 4KT7A 1OCZC 1LL2A 2LSEA 4KC2A 4DECA 2PP4A 2ZXWC 1MP5A 2G62A 2GFHA 2VXLA 1M2VA 4G7ZF 1H5SB 4JD0A 3OC9A 2WVKA 3ABKC 3O6XA 3V8ZA 1BR2A 2R7UA 4Y62A 1LKXA 4FRQA 5B1AC 1GX4A 2KW3C 2BO7A 3I0CA 5CQLX 2Y3HA 4Q4ZF 3DJUB 5AJPA 2YQJA 4ULWA 3ZF8A 1VH3A 4CS8C 2IXOA 5IY5C 1V84A 4HO0A 4FWVA 1R81A 4Q5SF 2OEFA 2R7OA 2R7XA 1VGWA 4EBBA 5CMHA 2R7QA 2I5KA 1FR8A 3EPVA 1V55C 2YESA 2L9JA 2JCKA 1KU2A 5CMFX 1ZHZA 1OCOC 2ICXA 5CQNX 1OQMB 3JCUQ 4CSAC 2JCLA 3EG9B 1YP3A 3PKPA 4QI0A 1ZDGA 2YQHA 2XRHA 2O1FA 4B2XA 4CS8A 3W2WA 3X2QC 1PZYB 1JVDA 2OI6A 1VMAA 1D1BA 2L81A 3OH0A 4ECMA 3I0IX 1TR2A 2RIXA 3DJNB 4G3QA 2P6WA 4BJTA 3CKJA 1FWYA 4EVWA 3CKNA 2C0NA 2XMHA 5T1DB 4JISA 3SEOA 1INIA 4KNWA 1LZ0A 1NHEB 5CMGX 3EGDA 2NUTB 4HFFB 3NYLA 4FROA 1VGTA 5C3AA 3ABMC 4JJGA 3TD7A 2FYDB 5CQMX 3ST8A 3I0KA 1OCCC 4HEAJ 2RJ6A 5FTVA 4EEMA 2O9XA 1IZMA 2D5RB 3ZGFA 4Y6NA 1WGWA 2EIMC 3DUVA 3NYJA 2WZFA 4YT5A 4DOZA 2NUPA 2VASA 3DAFA 1INJA 2XWNA 2QTVA 5DS5A 2R7VA 3OGZA 4G3SA 4M4KA 2R7RA 1FTSA 4EE3A 3AG4C 1ZYRF 2A1DD 3GANA 5D92A 3DM5A 4AYJA 3Q4SA 2IXPA 3I0HA 1SS9A 1FXJA 1ZDFA 4FQWA 3UMHA 3V0QA 1PCXA 3QVBA 4BMAA 4JZAA 1H5SC 2X5SA 3F46A 3ZIBA 3CKOA 3DZAA 3ABLC 4BG0A 1FO8A 2APCA 2GGQA 1QLEC 3USQA 4LLCA 1H5SA 4O79A 3LEVA 1OMZA 2IXNA 3K66A 1H5RA 2BO4A 4EEGA 5FV9A 2VSIA 3JUJA 2NG1A 1R82A 4M63A 3PKQA 5DS6A 3K33A 2DPWA 1QGSA 3GUEA 4NANA 4HO8A 3MX3A 3EHMA 3RH3A 4D0TA 2V0KA 1QGQA 1O23B 1TWCA 3AG1C 2P7VA 2OCCC 3JTJA 1O87A 2FY7A 2PX7A 1NKHB 2X5ZA 4KI2A 5L3QA 4M2BA 5C1HA 2FGYA 2XMEA 2ZU8A 4FRPA 4FCEA 1HV9A 1O0RA 2WZGA 1TVYA 2EILC 2H7OA 5KYYA 3EGDB 5I1FA 4FRMA 1MMNA 2HV7A 1GWVA 1S4OA 1V82A 3JRTA 1H5TB 4KC1A 4NAIA 1H5RB 2DYSC 2FFHA 4XWJA 4OIPF 1GWWA 1ZCTA 1ZJ2A 3V91A 1W2WA 4J32B 4B3UA 3EFOB 4I1MA 1FO9A 1FOAA 1OKKA 2E87A 3RKOF 1R7XA 1VM8A 3POVA 1ZJ3A 2D7RA 1R7VA 2I7BA 3O3PA 4PJNA 3HJCA 2H7BA 3I4UA 3LAYA 1V83A 2X51A 3QMKA 3BCVA 4Y63A 1TWAA 4U5CE 2EINC 2CNWA 2RJ4A 4AK9A 2B0JA 1ST6A 4NALA 2Y3DA 3LLIA 2WVNA 2M4EA 1W57A 2VS5A 1NWGB 4M28A 2A69F 4J18A 1LZ7A 3GODA 4N06A 2PGVA 3EJNA 3UMKA 4IAOA 1TW1A 3FOQA 3ZSUA 3NGWA 4HO3A 3ASNC 3TQDA 1FZWA 4OIQF 2OEGA 2ZXOA 4RD9A 4C3DA 3ZLLA 4MNDA 3O39A 1LVKA 5L3VA 3E70C 1H7HA 5DVWA 4L41C 2WEEA 4K7BA 3S27A 1JYLA 2FFUA 1NQIB 2FYCB 3SXDA 4EWCA 5FCLA 2G3VA 1YP2A 3FDQA 2XSEA 1Z63A 1Z6AA 2Q3TA 2P72A 1GQCA 1W55A 3T7NA 1J8YF 1FXOA 4HO6A 2I5EA 2IOQA 1QZXA 2J7PD 3Q7LA 4BJ5C 1VH1A 3Q7UA 5L6SA 1ZCVA 3E26A 2ZXRA 3K1HA 3SXAA 1G97A 2VS3A 4JJFA 4BJ1A 3DM9B 1OKKD 4YJWA 3I5QA 5DQZA 3OH4A 4IRUA 4UEGA 2VFZA 4KRVA 5FUHA 4C7OB 1PD1A 4HO5A 4JW1A 3SNHA 1D0XA 1J8MF 4D11C 2R7TA 1LS1A 2PFDA 5C1LA 1IW7F 1NZEA 5C4CA 5JQQA 3DJ4A 2AGDA 4DE7A 3L34A 2Y7AA 3I0DA 2PX0A 3ECSA 3JT1A 3NYMA 2A8UA 3PHF2 4HCQA 2RJ9A 3ZVRA 4NAKA 4GEHA 2Y4LA 4GYTA 1G93A 1NG1A 2A68F 2ZPAA 1WT0A 1SZIA 3UR3C 1ZJPA 2Y4JA 3SZRA 3KIAA 5EIYA 4FCUA 3F1CA 4YN0B 3EE5A 4FREA 4IRQA 1SMYF 1EYRA 3DK5A 1RJ9A 2I8BA 1JV3A 2AE7A 2WE9A 1ZI4A 2V3CC 5KYWB 4BQHA 3OA1A 1HM9A 4Q7CA 3DD7A 2CW0F 2V0LA 4EE5A 2P6VA 4A2NB 1NF5B 2DYRC 1Z23A 4Y7FA 1WVCA 1EZIA 2WB7A 1VZTA 4YS8A 1R7TA 5FYEA 2FFVA 1ZCUA 1JV1A 1JPJA 3RMWA 4P6IC 4U5FE 4OIOF 3OWTA 1WSZA 4AYLA 1ZU4A 2Y6PA 1BR1A 4KQLA 4P00A 2VSHA 4ZDQA 4C2SA 2Q9AA 3U2UA 5E2QA 4KC9A 2W4MA 4KNVA 3HTKC 4MQ9F 3PNNA 4CIHA 3CGXA 1G0RA 2J9WA 1VICA 4AC3A 2NUPB 3M1CB 4FRDA 2Y3GA 3KKBA 1MMGA 2KGOA 5C36A 2ZU9A 5E33A 4CSAA 3R3IA 3SPTA 4C3BA 4MYBA 4KBLA 4Y7UA 3RMVA 4JCHA 4OINF 1O7QA 1VZUA 5AJOA 5C3DA 2BO6A 5IDTA 1VPAA 1G9RA 2V0IA 1NU9C 4HE8D 3JUKA 4B2WA 3SXGA 2AM5A 5T3TA 3RFYA 3IOJA 2P73A 1HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MND A;  4O6M A;  5D92 A;  5D91 A;  4O6N A;  4Q7C A; 
#chains in the Genus database with same CATH topology
 5L0D A;  1FFT C;  5C4F A;  1U6H A;  2ICW G;  1YAU O;  3KMI A;  2B0H A;  3RQG A;  3C8G D;  1H7G A;  1B68 A;  4C7O A;  4MVZ A;  3ZDL A;  4K0D A;  4DDZ A;  1D1A A;  2Q7R A;  5TJ5 E;  2MZB A;  3G4X A;  3UGO A;  4E7Z A;  3PMR A;  3ZLK A;  4G78 A;  4GBP A;  3U2V A;  1CGM E;  3E9V A;  2J46 A;  3LS0 A;  4E1K A;  1ZHW A;  5AJN A;  1NBB A;  1T5O A;  1LE4 A;  2AWC A;  2VH3 A;  4U5E E;  2EPK X;  3K8E A;  1A7V A;  3EHN A;  3T7M A;  1H7T A;  3O10 A;  4RBN A;  2P61 A;  3CZ6 A;  4ANJ A;  1NU7 D;  2RJ0 A;  2EPM X;  5KYU A;  3SXC A;  3NRH A;  4FRH A;  3R2W A;  1H4C A;  3IQT A;  3DMD A;  3TK0 A;  1RKE A;  2W0W A;  3SXZ A;  1G3L A;  2RJ8 A;  3WAQ A;  2PA4 A;  1H7F A;  3LJB A;  1H9G A;  4HG6 A;  5KYX B;  4QI2 A;  4WGY A;  3E25 A;  1VB5 A;  5E3C A;  3VAY A;  1LL0 A;  3U8P A;  4FRL A;  2YQY A;  1N1C A;  1Q0F A;  2YL1 A;  1TWH A;  4DVZ A;  3ZTZ A;  3OH3 A;  2RIY A;  5HS2 A;  1GM5 A;  3WOD F;  1JAF A;  1R7Y A;  3D98 A;  3DE9 A;  3DKA A;  4CBE A;  1QG8 A;  2ASR A;  1H7E A;  1ORS C;  4W8K A;  2VC9 A;  3OAM A;  4B4G A;  2UUH A;  3V7O A;  2RJ1 A;  1ZVZ A;  2Y4M A;  1VOM A;  3T6J A;  2YC3 A;  2GA0 A;  1ZCY A;  1C17 M;  1GA8 A;  4IGG A;  5D91 A;  1OW8 A;  1A41 A;  1T9K A;  2RIT A;  2RJ5 A;  1JVG A;  4HOC A;  3SXB A;  3F1Y A;  1A0B A;  1RKE B;  2J0A A;  2VK9 A;  1CPQ A;  1E85 A;  5F5F A;  2HMZ A;  3N9W A;  1D0Y A;  4XTK A;  1TW5 A;  4Z9I A;  4XPW A;  3UMI A;  3AQB A;  4BJ6 C;  1ZI3 A;  2Y4K A;  4IWB A;  1LZJ A;  4XWI A;  3JSZ A;  3HNJ A;  3K8D A;  3C8G A;  1YP4 A;  1KWS A;  5L0G A;  5F28 E;  1ZJO A;  4PJJ A;  4B6I A;  2G3K A;  3SX3 A;  2KJG A;  4ARW A;  3DI5 A;  5COF A;  1VGZ A;  2HMQ A;  2V0J A;  4JRZ A;  2Q9C A;  2BE5 F;  1G23 A;  4FRA A;  5KYY B;  3L8I A;  3SX8 A;  3OH2 A;  1EKY A;  1JYK A;  4AL1 A;  4XLN F;  5IFY A;  1ZW2 A;  4NC3 A;  2YWA A;  4ZLC A;  4YT8 A;  1TWG A;  4M2A A;  5C3B A;  3B0P A;  3LS1 A;  5C8R A;  3OH1 A;  1I4Z A;  2J9U A;  2L7A A;  4HFK B;  5HV9 A;  2JCJ A;  2YHS A;  2YZS A;  3M4C A;  1WAT A;  1ZW3 A;  4DBR A;  3U3B A;  3FAJ A;  1G8X A;  2IYL D;  1WT3 A;  4QDL A;  1EA8 A;  1AVO B;  4KPZ A;  1QQ3 A;  3SXM A;  1OCZ C;  2LFF A;  1Q0G A;  2P1A A;  4EKW A;  3IQ6 A;  4H54 A;  2YLI A;  3RVZ A;  2IXO A;  1V84 A;  4HO0 A;  2PBE A;  4FWV A;  2R7X A;  2R7Q A;  2KC3 A;  1FR8 A;  1ZHZ A;  3LUT B;  1DOV A;  1YP3 A;  1U0B B;  3W2W A;  2OI6 A;  1D1B A;  4ECM A;  3I0I X;  1HY5 A;  2C0N A;  2XMH A;  4R32 A;  3EGD A;  4XPY A;  2FYD B;  4HEA J;  2RJ6 A;  2D5R B;  1HE9 A;  2RSE B;  4DOZ A;  2VAS A;  3IQ5 A;  2QTV A;  4EE3 A;  1ZYR F;  3DM5 A;  3NMK A;  3W4Y A;  3UMH A;  3V0Q A;  1JOG A;  1NSG B;  3CKO A;  1LIH A;  3ABL C;  1FO8 A;  3C63 A;  2APC A;  4LLC A;  1OMZ A;  2IXN A;  1H5R A;  1RXQ A;  3ZWI A;  1XZP A;  4XEV A;  3K33 A;  4HO8 A;  3EHM A;  2V0K A;  3AG1 C;  3FMS A;  3JTJ A;  3AJM A;  5A6K A;  2HS5 A;  1HV9 A;  3C7J A;  2H7O A;  1A7D A;  2FFH A;  4OIP F;  1ZJ2 A;  3V91 A;  4J32 B;  3M79 A;  4IAR A;  1OKK A;  2E87 A;  3MBG A;  2D7R A;  2H7B A;  4U5C E;  2EIN C;  5JLI A;  4YK5 A;  3BRJ A;  2RJ4 A;  2ZD9 A;  4AK9 A;  1ZZP A;  3LLI A;  2M4E A;  4J18 A;  2UUI A;  1QKR A;  3GOD A;  4N06 A;  1TW1 A;  2DI3 A;  3ASN C;  2OEG A;  1JRA A;  4MND A;  1LVK A;  4BPM A;  5L3V A;  4YL0 A;  3C8G B;  4NTB A;  1NQI B;  4EWC A;  5FCL A;  2G3V A;  1YP2 A;  1Z63 A;  2Q3T A;  1GQC A;  1W55 A;  1FXO A;  4HO6 A;  2I5E A;  1YDI A;  1C03 A;  2YLG A;  3E26 A;  4D4X A;  1G97 A;  2VS3 A;  2HSB A;  4UEG A;  1UFB A;  3I5Q A;  2VFZ A;  4HO5 A;  3A9C A;  4MVO A;  1J8M F;  2AU5 A;  1LS1 A;  1IW7 F;  2Y7A A;  2PX0 A;  3ECS A;  2A8U A;  2PNO A;  4HCQ A;  2A0B A;  4NAK A;  1WT0 A;  4PAC A;  1ZJP A;  3UR3 C;  2Y4J A;  5EIY A;  4XPX A;  4EHP A;  1YA7 O;  4IRQ A;  1SMY F;  2JX0 A;  1RJ9 A;  2AE7 A;  4BQH A;  1HM9 A;  4EE5 A;  2P6V A;  1E86 A;  1NF5 B;  1V74 B;  1LE2 A;  1ZCU A;  1JPJ A;  3RMW A;  4KQL A;  1BDJ B;  2VSH A;  2Q9A A;  3U2U A;  3KYI A;  1LS4 A;  3PNN A;  1H9T A;  4CIH A;  2J8W A;  3M1C B;  4FRD A;  4YL3 A;  2A0U A;  2ZU9 A;  4CSA A;  5C3D A;  5AJO A;  3GM2 A;  3H2V A;  2V0I A;  3S90 A;  2XWM A;  1ZHJ A;  5T3T A;  4AE4 A;  1ZI5 A;  2H7V C;  2RJ7 A;  4DBQ A;  3W2V A;  1FG5 N;  2OU6 A;  2AM4 A;  3CQZ A;  4CJ8 A;  1ZHY A;  2DB4 A;  2VD4 A;  4P9F A;  4EEO A;  4FX5 A;  2E3D A;  1VK5 A;  1RMV A;  4B4B A;  4PJL A;  3RSB A;  3CSK A;  2HV6 A;  3NDB B;  2Y69 C;  1QPU A;  3ITF A;  4OD5 A;  3W8I A;  3L8J A;  5GPG B;  3IOH A;  3Q6N A;  4B4M A;  5AC5 A;  5FU8 A;  4U5H A;  3U0C A;  5HSW A;  4I44 A;  3ZC4 A;  2R7W A;  4CJC A;  1IIM A;  3AG2 C;  3RYL A;  1XZ6 A;  3V0O A;  5IDS A;  1C02 A;  1G2V A;  2OKU A;  4DVY P;  4JVS A;  2JD3 A;  3U2M A;  1TZF A;  3C62 A;  3N0T A;  5C1G A;  2CDQ A;  2R03 A;  4Y6U A;  2XM4 A;  1M56 C;  1A7E A;  2WZL A;  2VS4 A;  2A8W A;  3FWW A;  1GGQ A;  4KNR A;  1HJL A;  4YT4 A;  1ON8 A;  1WOL A;  5C38 A;  2V26 A;  4O7G A;  2Q4J A;  3FVY A;  2P0N A;  4Y7G A;  5E3A A;  3ZG1 A;  4D11 A;  2CCY A;  1M6T A;  1E2X A;  2KQ9 A;  5DQT A;  3EQL F;  4KC4 A;  3MYF A;  2OJQ A;  3K1I C;  1H4E A;  1O3U A;  1Z3I X;  1IIN A;  1MMD A;  3S0X A;  5B1B C;  3UGP A;  1APC A;  1WWP A;  3U3F A;  4B42 A;  1CGO A;  2V0H A;  5CMI A;  4ONS A;  2PF4 E;  2A6E F;  2R25 A;  2VB6 A;  2QKX A;  2HKV A;  4HO9 A;  1Z5Z A;  3NKD A;  5JSL A;  4CJO A;  3WG7 C;  3RW0 A;  3KL4 A;  4HO4 A;  2D7I A;  3N2Z B;  2MWQ A;  2J0W A;  5CI8 A;  4KPX A;  3JYH A;  2YC5 A;  2Q4F A;  2CU2 A;  1GS9 A;  2XS8 A;  4LDK A;  5JRA A;  4AE4 B;  3S29 A;  1LM3 B;  5L0F A;  4P02 A;  2Z86 A;  1EI7 A;  2OJE D;  4Y9X A;  3SP1 A;  1I4Y A;  2FAP B;  4NTF A;  3NG1 A;  5DLJ A;  3TJ6 A;  4PJM A;  1R80 A;  3VF0 A;  3EFO A;  2IXM A;  1Q0K A;  1R7U A;  4KNX A;  4IJJ A;  1UG7 A;  2Z15 A;  3N24 A;  1H5T A;  3JYY A;  2W0V A;  2ZXP A;  4CS9 A;  4JE9 A;  5EHH A;  1OR2 A;  4NY3 A;  3W8H A;  2UX8 A;  2XM0 A;  3AG3 C;  4U5G A;  1S4P A;  3UNG C;  1ZI1 A;  1YZA A;  4LAC B;  4JUR I;  4ULV A;  5DS4 A;  2GDC A;  3U9M A;  3V0M A;  4YL1 A;  5J49 A;  1W77 A;  1VYI A;  4MVQ A;  5EJZ A;  2TMV P;  4PFP A;  4FES A;  4MTG A;  3KPH A;  2OI5 A;  2E8B A;  1TFK B;  4KT7 A;  1YZC A;  4KC2 A;  4DEC A;  2PP4 A;  4G7Z F;  2HJ3 A;  5L0J A;  1OR3 A;  4FRQ A;  5CQL X;  5B1A C;  3I0C A;  3ZF8 A;  4ULW A;  1VH3 A;  1KNY A;  4Q5S F;  5K0I A;  1V55 C;  5CMF X;  2ICX A;  4U9E A;  3JCU Q;  2JCL A;  2HFI A;  1ZDG A;  3V5Z A;  2O1F A;  2YQH A;  2R05 A;  4EBJ A;  1JVD A;  2L81 A;  2RIX A;  3DJN B;  3CKJ A;  4JEA A;  1INI A;  4KNW A;  1LZ0 A;  4FRO A;  3NMI A;  3U5S A;  3ABM C;  3TD7 A;  3ST8 A;  1OCC C;  5FTV A;  2O9X A;  4Y6N A;  2VCB A;  3NYJ A;  2WZF A;  4YT5 A;  4JKV A;  1INJ A;  2XWN A;  3OGZ A;  2L6F A;  2R7V A;  1FTS A;  3GAN A;  5D92 A;  4FQW A;  1PCX A;  4BMA A;  4JZA A;  1H5S C;  3F46 A;  3DZA A;  2CYD A;  2GGQ A;  3USQ A;  2VSI A;  1QVX A;  3JUJ A;  1R82 A;  4M63 A;  3M15 A;  2HUJ A;  3CAX A;  3MX3 A;  3RH3 A;  1O23 B;  1TWC A;  3S84 A;  2EPL X;  4KI2 A;  4K1O A;  4M2B A;  2ZU8 A;  2LFD A;  1O0R A;  2OOC A;  2EIL C;  3JTL O;  3IPM O;  3C18 A;  3EGD B;  3JRT A;  1H5T B;  3TOM A;  1OW7 A;  3QVY A;  3B29 A;  4B3U A;  3B71 A;  1E83 A;  1FOA A;  3TJ5 A;  1VM8 A;  3POV A;  1ZJ3 A;  3O3P A;  1R7V A;  3HJC A;  1T01 A;  1V83 A;  3I4U A;  3LAY A;  3VM6 A;  3QMK A;  4Y63 A;  3G50 A;  1BBH A;  2B0J A;  3GOR A;  1K05 A;  4M28 A;  2PGV A;  3FOQ A;  3LNM B;  3TQD A;  1FZW A;  5DVW A;  3G4Z A;  3S27 A;  1AEP A;  1JYL A;  2FYC B;  2XSE A;  4EIY A;  1WN0 A;  2J7P D;  3Q7L A;  5L6S A;  3Q7U A;  1V4A A;  4BJ1 A;  3SNH A;  2GWW A;  2R7T A;  2IM8 A;  5C1L A;  4DE7 A;  3L34 A;  5A6B D;  2L6G A;  4GYT A;  3F1C A;  3EE5 A;  1U89 A;  4FRE A;  1EYR A;  5JP7 A;  2WE9 A;  2V0L A;  1OW6 A;  4Y7F A;  1JMW A;  1EZI A;  2YRF A;  2NSF A;  5JUA A;  4U5F E;  3A11 A;  4OIO F;  3OWT A;  4AYL A;  4ZDQ A;  1BR1 A;  4N6C A;  1G4W R;  2L6H A;  2LP4 A;  2W4M A;  2YLD A;  3HTK C;  2Y3G A;  3GM3 A;  1MMG A;  2QE9 A;  5E33 A;  1SYQ A;  4Y7U A;  3RMV A;  4JTA B;  3SXK A;  1LI5 A;  2BO6 A;  1G9R A;  4XEF A;  1NU9 C;  4B2W A;  3S9O A;  3SXG A;  3ZQV A;  3ZGG A;  4N6H A;  1FFH A;  1OXB A;  1FR0 A;  3LNR A;  5B3S C;  1G4U S;  5KYX A;  1G95 A;  1ZHX A;  2AVK A;  2PGY A;  3CU0 A;  1PZT A;  4EBK A;  4NTA A;  3CKV A;  2Y3B A;  3IOI A;  3LES A;  4E0I A;  2YCM A;  5KYU B;  1R5I D;  2LCH A;  1HMO A;  3HL3 A;  2Q00 A;  4H4K C;  1VZX A;  1D0Z A;  2YEV A;  2DGJ A;  1VLS A;  4O6Y A;  2PX3 A;  1GQ9 A;  1YA9 A;  3T4R A;  2Y39 A;  3I0J A;  2NXV A;  2YL0 A;  3GM1 A;  3J06 A;  4G0H A;  4X0R A;  5CIV A;  1MP4 A;  3I0G A;  2NPU A;  4BJ5 A;  5A6J A;  1GQA A;  2YQS A;  2W9Y A;  1FMV A;  4CS9 C;  1MMA A;  2XWL A;  4FAP B;  2XXA A;  1G1L A;  1XHB A;  2EIK C;  4Y64 A;  2WVQ A;  2WVO A;  3FOO A;  2LQG A;  5F5H A;  5CMJ A;  3V0P A;  4ER9 A;  3AOU A;  2XL8 A;  2EPN A;  1E5K A;  2KSF A;  2BO8 A;  2CGE A;  3GEI A;  1S05 A;  1H3M A;  1G8O A;  3LW6 A;  1O7O A;  2J7P A;  2QNL A;  4O6M A;  5DDV A;  1Y4C A;  2XLH A;  1MP3 A;  3V5Y A;  3EZH A;  4Y7T A;  2MHR A;  2VXM A;  4FRB A;  5C49 A;  2AM3 A;  1ON6 A;  2R9R B;  4LDR A;  2FYA A;  4NCQ A;  1M2O A;  1FMW A;  5EJ1 A;  3KH2 A;  1HM0 A;  1M57 C;  4F4B A;  3QVZ A;  2D0J A;  4J7T A;  1O5H A;  3Q80 A;  3V8Y A;  3CKQ A;  3R7C A;  3S28 A;  2GGO A;  4GQH A;  2M64 A;  3T7O A;  1VGU A;  4ASY A;  4LW6 A;  3EH2 A;  1FGG A;  5CI9 A;  2LIG A;  4Z9H A;  5JVE A;  2J0X A;  2X65 A;  2VCC A;  1H5S D;  3HLZ A;  4G3P A;  2QGI A;  1PD0 A;  1FRW A;  1BR4 A;  2J0B A;  1HJJ A;  4YWQ A;  4I1O B;  4CX9 A;  5BQG A;  1I5N A;  2LK4 A;  2W45 A;  3U8V A;  3EH1 A;  1JPN A;  2HJM A;  1VLT A;  1LI7 A;  4Y7V A;  3OKR A;  4D4N A;  1ZJ1 A;  4ASJ A;  4IRP A;  1LVW A;  2KNH A;  3F47 A;  3SXE A;  3U9J A;  1MC3 A;  2GAQ A;  3H65 A;  2XLW A;  5DDT A;  3HNL A;  3U0Y A;  4LDQ A;  3BRK X;  4PFO A;  4WJ0 A;  4XLP F;  3MYI A;  4LLE A;  3DAG A;  2XS1 A;  2OG2 A;  3FAP B;  4U5B E;  1G5Z A;  1K04 A;  5KYN A;  1HW2 A;  4U5D E;  4FIY A;  3SX5 A;  3IEE A;  1GX0 A;  1H7Q A;  2ZXW C;  2G62 A;  2GFH A;  4JD0 A;  3OC9 A;  1NFN A;  3O6X A;  3V8Z A;  1T6U A;  2R7U A;  1GX4 A;  2KW3 C;  4Q4Z F;  3DJU B;  5AJP A;  2YQJ A;  5IY5 C;  1R81 A;  4UDV A;  2OEF A;  1VGW A;  4EBB A;  5CMH A;  2I5K A;  1H7I A;  2JCK A;  1KU2 A;  2X0C A;  5CQN X;  1OQM B;  4CSA C;  1ORY A;  3X2Q C;  5JT4 A;  1TR2 A;  4G3Q A;  2P6W A;  4JIO A;  3KYJ A;  5COM A;  4BJT A;  1FWY A;  3CKN A;  3RQE A;  4DRJ B;  1NHE B;  3SEO A;  3RF3 A;  3NYL A;  1VGT A;  5C3A A;  1LPE A;  5CQM X;  3RQF A;  4EEM A;  1YAR O;  1IZM A;  3ZGF A;  2EIM C;  3DUV A;  2NUP A;  3DAF A;  5DS5 A;  4M4K A;  3AG4 C;  4AYJ A;  3Q4S A;  2IXP A;  3I0H A;  1SS9 A;  4MVU A;  4MVM A;  3QVB A;  1Q0M A;  3ZIB A;  4BG0 A;  256B A;  1H6G A;  3ATP A;  1H5S A;  3LEV A;  3MFN A;  3PKQ A;  5DS6 A;  1QGS A;  2JPU A;  4D0T A;  4CIP A;  1QGQ A;  1R4T A;  1TFO B;  2PX7 A;  2FY7 A;  5C1H A;  4JC7 A;  2FGY A;  2XME A;  4FRP A;  4FCE A;  5KYY A;  1Q0D A;  1CPR A;  1GWV A;  1V82 A;  1S4O A;  3VRC A;  4KC1 A;  4NAI A;  4AL0 A;  4W8P A;  4DRH B;  1W2W A;  3EFO B;  3TOL A;  1RCP A;  2BL2 A;  3RKO F;  2I7B A;  5BQI A;  4JCZ A;  2OEV A;  3ZQY A;  3M4B A;  1TWA A;  2CNW A;  1XZQ A;  1ST6 A;  4J7Y A;  2Y3D A;  4NAL A;  1W57 A;  2EPO A;  2A69 F;  1LZ7 A;  3EJN A;  3ZSU A;  2F22 A;  4OIQ F;  3E70 C;  4L41 C;  3T9O A;  2FFU A;  1YVI A;  1FAP B;  3FDQ A;  2P72 A;  1J8Y F;  5A69 A;  4U9D A;  2IOQ A;  1QZX A;  1VH1 A;  1ZCV A;  3SXA A;  2HZ8 A;  4JJF A;  1CGN A;  1OKK D;  5DQZ A;  4JW1 A;  5JQQ A;  2PFD A;  2J9B A;  1NZE A;  3DJ4 A;  2AGD A;  1FNT c;  3JT1 A;  3PHF 2;  3ZVR A;  2YL7 A;  2Y4L A;  1G93 A;  1NG1 A;  2ZPA A;  3KIA A;  2XLV A;  4DXW A;  4YN0 B;  3DK5 A;  2I8B A;  1Y6D A;  1ZI4 A;  2V3C C;  3DD7 A;  2CW0 F;  2DYR C;  4A4A A;  4YS8 A;  1DOW A;  5FYE A;  2FFV A;  1JV1 A;  4MW8 A;  1T6I A;  2Y6P A;  4P00 A;  1WAS A;  4KC9 A;  4KNV A;  4MQ9 F;  1G0R A;  2J9W A;  4AC3 A;  2NUP B;  4JTD B;  5C36 A;  3R3I A;  4KBL A;  3JSE O;  4OIN F;  1VPA A;  1WTY A;  4HE8 D;  3JUK A;  2AM5 A;  3RFY A;  3IOJ A;  4NAN A;  1Z90 A;  3IQC A;  3I0F A;  1KTM A;  2C03 A;  2HSQ A;  4DJ9 A;  1V54 C;  2YQC A;  3Q6M A;  2OQM A;  1JR8 A;  4E18 A;  1S4N A;  5C47 A;  5A6B A;  3Q7G A;  4C3E A;  5C4D A;  1I52 A;  3AQC A;  4E7S A;  2QH5 A;  4D0Z A;  2C04 A;  2XL4 A;  1OMX A;  3U2W A;  1VYK A;  3GWN A;  2YL3 A;  1ZHT A;  4XQ1 A;  4HO2 A;  2WL8 A;  5KYW A;  3FHD A;  3ASO C;  4EUK B;  2O1G A;  4YT2 A;  3C8Z A;  2I15 A;  2EIJ C;  4G7O F;  4MIX A;  2AWY A;  3SYN A;  5BXC A;  1NLX A;  4EE4 A;  3JRM O;  1NMM B;  3U2L A;  1EQ1 A;  2AH9 A;  4EEA A;  3OEO A;  1S7Z A;  4CVH A;  3EZI A;  2WVL A;  3TZT A;  2NUT A;  4MW3 A;  4OIR F;  1FGX A;  4CS7 A;  3EGX B;  1HW1 A;  2ZU7 A;  1QWJ A;  3HKK A;  1MNE A;  4RDA A;  5B3I A;  5EGY A;  3V0N A;  2AES A;  3K6B A;  4WGZ A;  3LLK A;  4G7H F;  5AC4 A;  2AP3 A;  1NFO A;  1Z7Q c;  2R02 A;  2WGZ A;  2CNW D;  4O6N A;  2J9V A;  3D5N A;  1ZU5 A;  1YRO B;  5CQP A;  3EGX A;  2ICY A;  4J30 B;  5T3W A;  1YYJ A;  1K4V A;  1TKN A;  4CDV A;  4ZLD A;  3NKE A;  3I0E A;  3H2U A;  3RVY A;  1ZIZ A;  4KXO A;  5FTS A;  2W4B A;  4L6R A;  2Q9B A;  1RJ9 B;  3T6B A;  3U0X A;  1M2V B;  3POL A;  3B0U X;  1WT2 A;  3R2P A;  5BQH A;  1H4D A;  3B0V C;  1L7C A;  3V90 A;  4NQF A;  5L6V A;  1LL3 A;  1H7L A;  2KYH A;  2IBF A;  3V0L A;  4LW3 A;  4R7P A;  1OCR C;  3FXH A;  1ZJ0 A;  5L0C A;  3X1O A;  3USR A;  1HMD A;  3ZTM A;  4I3M A;  4AX2 A;  1PV3 A;  2WVM A;  1OXK A;  3NMJ A;  5C4B A;  2O1H A;  1MND A;  3B9Q A;  2XXA B;  3DXJ F;  2R7S A;  3U2T A;  3VYW A;  2OEX A;  3LEO A;  2XLE A;  4D48 A;  3I5P A;  1WT1 A;  4PK4 A;  2OI7 A;  4JTC B;  2ETS A;  5C48 A;  2H8A A;  2FYB A;  2RIZ A;  1D1C A;  1SR2 A;  3SX7 A;  3SXY A;  1TQG A;  2RD9 A;  3K1I A;  1LZI A;  5AGF A;  5BUO A;  4K6R A;  2JCO A;  4OD4 A;  4MTO A;  4G87 A;  2J45 A;  4AAW A;  2WAW A;  3RIP A;  3WHN A;  3L0I A;  2X60 A;  3D8V A;  5CQO A;  4LER A;  3EG9 A;  2XL6 A;  3U2X A;  2A6H F;  4MVR A;  4FIX A;  2AEC A;  1SF8 A;  3MLG A;  2MYS A;  5FU0 A;  4B5B A;  3QZC A;  4BJ6 A;  3K7D A;  1L3P A;  2QUP A;  3HNK A;  1FR9 A;  3O55 A;  4BEJ A;  4MS2 A;  5C4E A;  2Z87 A;  2QY9 A;  3I0L A;  4MVS A;  4P9T A;  4DRI B;  1YJG A;  1LL2 A;  2LSE A;  1MP5 A;  2VXL A;  1M2V A;  1H5S B;  5L0H A;  3GEH A;  2WVK A;  3ABK C;  1BR2 A;  3CEX A;  4Y62 A;  1LKX A;  2BO7 A;  1RKC A;  2Y3H A;  4CS8 C;  4IB4 A;  3TQO A;  2R7O A;  3EPV A;  2YES A;  2L9J A;  1OCO C;  3V5X A;  3EG9 B;  2LD6 A;  3PKP A;  4QI0 A;  2XRH A;  2KK1 A;  4B2X A;  4CS8 A;  1PZY B;  1VMA A;  3OH0 A;  4PR9 A;  4EVW A;  1OQC A;  5T1D B;  4JIS A;  3L1M A;  5CMG X;  1QSP A;  4HFF B;  2NUT B;  3JZ0 A;  4JJG A;  1HE1 A;  3I0K A;  1WGW A;  4MTF A;  1F1M A;  4G3S A;  2R7R A;  4BEM J;  2YKZ A;  2A1D D;  5FZT A;  1FXJ A;  1ZDF A;  2YVK A;  4N4W A;  5COG A;  1XWJ A;  2X5S A;  3QW1 A;  4E17 A;  3FOP A;  2BC5 A;  1QLE C;  4O79 A;  5JS5 A;  2BO4 A;  4EEG A;  3K66 A;  3HNI A;  5FV9 A;  3PCV A;  2XLM A;  1T6Q A;  2NG1 A;  4JEB A;  2DPW A;  3GUE A;  1BZ4 A;  1E84 A;  3GEE A;  2P7V A;  2OCC C;  1YYX A;  1O87 A;  1NKH B;  2X5Z A;  5L3Q A;  4CDY A;  2WZG A;  1TVY A;  5I1F A;  4FRM A;  1MMN A;  2HV7 A;  1MQV A;  1VTM P;  1H5R B;  2DYS C;  4XWJ A;  1ZCT A;  1GWW A;  4I1M A;  4Z9J A;  2XLD A;  1FO9 A;  1R7X A;  4PJN A;  2X51 A;  3BCV A;  2WVN A;  2VS5 A;  1NWG B;  2XLO A;  3UMK A;  4IAO A;  4HO3 A;  3NGW A;  2ZXO A;  4RD9 A;  4C3D A;  3ZLL A;  3O39 A;  3AGU A;  1H7H A;  2WEE A;  4K7B A;  3SXD A;  1Z6A A;  3T7N A;  3T6G B;  3AGT A;  1K40 A;  5EK0 A;  4BJ5 C;  1ORJ A;  2ZXR A;  3K1H A;  3DM9 B;  4YJW A;  3OH4 A;  3US6 A;  5FUH A;  4IRU A;  2D4U A;  4KRV A;  4C7O B;  1PD1 A;  1D0X A;  4D11 C;  5C4C A;  3DWW A;  3I0D A;  3NYM A;  5L0I A;  2RJ9 A;  5A6A A;  4GEH A;  2A68 F;  4CJB A;  1SZI A;  3SZR A;  3IHU A;  4FCU A;  3PDM P;  1JV3 A;  2VCA A;  5KYW B;  3OA1 A;  4Q7C A;  3TUL A;  4A2N B;  1Z23 A;  1WVC A;  2WB7 A;  1VZT A;  1R7T A;  3DE8 A;  3QTH A;  4P6I C;  1YLM A;  4E0H A;  3GWL A;  1WSZ A;  1ZU4 A;  4C2S A;  2NSG A;  5E2Q A;  4IAQ A;  3BEH A;  1VIC A;  3CGX A;  2QLA A;  3KKB A;  4CDA A;  2KGO A;  4CJG A;  3SPT A;  4C3B A;  4MYB A;  4XEK A;  4JCH A;  1VZU A;  3QW0 A;  1O7Q A;  4WAB A;  5IDT A;  1AUE A;  2P73 A;  1HM8 A; 
#chains in the Genus database with same CATH homology
 1Z90 A;  1ZI5 A;  2H7V C;  2RJ7 A;  1FFT C;  1FFH A;  3I0F A;  4DBQ A;  3W2V A;  1FG5 N;  4CJ8 A;  2AM4 A;  3CQZ A;  5C4F A;  1ZHY A;  3KMI A;  2C03 A;  3LNR A;  2VD4 A;  1H7G A;  1V54 C;  4C7O A;  5B3S C;  5KYX A;  1G95 A;  1ZHX A;  2YQC A;  3Q6M A;  2PGY A;  1S4N A;  4K0D A;  4DDZ A;  5C47 A;  4EEO A;  3Q7G A;  4C3E A;  3CU0 A;  5C4D A;  1I52 A;  3AQC A;  1D1A A;  4FX5 A;  1PZT A;  4E7S A;  2QH5 A;  2E3D A;  2MZB A;  4D0Z A;  1VK5 A;  3UGO A;  2C04 A;  4E7Z A;  4PJL A;  4B4B A;  3CKV A;  2XL4 A;  2Y3B A;  3RSB A;  1OMX A;  3ZGG A;  3PMR A;  3U2W A;  3ZLK A;  1VYK A;  3IOI A;  3CSK A;  2HV6 A;  4GBP A;  3U2V A;  3LES A;  2YCM A;  3NDB B;  1ZHT A;  5KYU B;  2Y69 C;  2WL8 A;  4HO2 A;  3E9V A;  3ITF A;  5KYW A;  2J46 A;  3FHD A;  3LS0 A;  4OD5 A;  3W8I A;  1ZHW A;  4E1K A;  3ASO C;  5AJN A;  3IOH A;  3Q6N A;  2VH3 A;  3HL3 A;  2O1G A;  4B4M A;  4H4K C;  4YT2 A;  5FU8 A;  4U5E E;  4U5H A;  1VZX A;  5HSW A;  1D0Z A;  4I44 A;  2EIJ C;  2YEV A;  3ZC4 A;  2DGJ A;  4G7O F;  3K8E A;  2R7W A;  4CJC A;  4MIX A;  4O6Y A;  2PX3 A;  3EHN A;  3SYN A;  1IIM A;  5BXC A;  3AG2 C;  1GQ9 A;  3RYL A;  1H7T A;  3T7M A;  3T4R A;  2Y39 A;  3I0J A;  4RBN A;  3CZ6 A;  1XZ6 A;  3V0O A;  4EE4 A;  2NXV A;  4ANJ A;  1NMM B;  3I0G A;  4G0H A;  1NU7 D;  4X0R A;  1MP4 A;  2RJ0 A;  5IDS A;  5KYU A;  1G2V A;  3OEO A;  1S7Z A;  2AH9 A;  3SXC A;  4EEA A;  4CVH A;  3NRH A;  3EZI A;  4BJ5 A;  3R2W A;  1H4C A;  4DVY P;  4FRH A;  2WVL A;  3TZT A;  2NUT A;  2YQS A;  3DMD A;  2W9Y A;  1FMV A;  4JVS A;  1MMA A;  4CS9 C;  1ZHJ A;  2XWL A;  2JD3 A;  2W0W A;  4OIR F;  2XXA A;  1TZF A;  1G1L A;  1FGX A;  4AE4 A;  2EIK C;  4CS7 A;  1G3L A;  1XHB A;  2RJ8 A;  4Y64 A;  2WVQ A;  2WVO A;  3N0T A;  5C1G A;  2CDQ A;  2PA4 A;  3EGX B;  4Y6U A;  1H7F A;  3LJB A;  2ZU7 A;  4HG6 A;  1QWJ A;  1MNE A;  4RDA A;  5F5H A;  5CMJ A;  5EGY A;  3V0N A;  2AES A;  3V0P A;  3K6B A;  1M56 C;  3LLK A;  5KYX B;  4G7H F;  2WZL A;  4QI2 A;  2VS4 A;  3E25 A;  2A8W A;  5E3C A;  3VAY A;  3FWW A;  1E5K A;  2WGZ A;  1LL0 A;  2BO8 A;  2CNW D;  4FRL A;  4O6N A;  2CGE A;  2J9V A;  1HJL A;  4YT4 A;  4KNR A;  3D5N A;  1N1C A;  1ZU5 A;  1ON8 A;  1YRO B;  1H3M A;  3EGX A;  2V26 A;  5CQP A;  5C38 A;  4O7G A;  1G8O A;  3LW6 A;  2ICY A;  4J30 B;  5T3W A;  2Q4J A;  1TWH A;  2J7P A;  1O7O A;  4DVZ A;  3FVY A;  4O6M A;  1K4V A;  5DDV A;  1TKN A;  4Y7G A;  4ZLD A;  3NKE A;  5E3A A;  1MP3 A;  3ZG1 A;  2RIY A;  3I0E A;  3OH3 A;  1ZIZ A;  5HS2 A;  4KXO A;  3EZH A;  4Y7T A;  5FTS A;  4D11 A;  2KQ9 A;  3WOD F;  2VXM A;  4FRB A;  2W4B A;  5DQT A;  5C49 A;  2Q9B A;  1RJ9 B;  3EQL F;  3T6B A;  1ON6 A;  1R7Y A;  2AM3 A;  3U0X A;  1M2V B;  3D98 A;  4KC4 A;  3POL A;  3B0U X;  1WT2 A;  2FYA A;  4CBE A;  3K1I C;  1H4E A;  1H4D A;  3B0V C;  1QG8 A;  3V90 A;  1M2O A;  1Z3I X;  1FMW A;  1H7E A;  1IIN A;  5EJ1 A;  5L6V A;  1MMD A;  3KH2 A;  1LL3 A;  3S0X A;  4W8K A;  1H7L A;  1M57 C;  1HM0 A;  5B1B C;  3OAM A;  4F4B A;  2XWM A;  4B4G A;  3V7O A;  2RJ1 A;  2D0J A;  3UGP A;  4B42 A;  2Y4M A;  1O5H A;  1VOM A;  3T6J A;  2YC3 A;  3Q80 A;  4LW3 A;  3V0L A;  4R7P A;  3V8Y A;  1ZCY A;  1OCR C;  3CKQ A;  1GA8 A;  1ZJ0 A;  3X1O A;  2V0H A;  3USR A;  4AX2 A;  4I3M A;  5CMI A;  2PF4 E;  2WVM A;  5D91 A;  3S28 A;  2A6E F;  2VB6 A;  5C4B A;  2O1H A;  2RIT A;  1JVG A;  2QKX A;  2RJ5 A;  4HOC A;  4HO9 A;  1MND A;  3SXB A;  3B9Q A;  2XXA B;  2GGO A;  3DXJ F;  2R7S A;  3F1Y A;  3T7O A;  3U2T A;  1VGU A;  4ASY A;  1Z5Z A;  3EH2 A;  3NKD A;  3VYW A;  4LW6 A;  2J0A A;  1FGG A;  2VK9 A;  3WG7 C;  4D48 A;  5CI9 A;  3KL4 A;  3I5P A;  4HO4 A;  2D7I A;  5F5F A;  1WT1 A;  4PK4 A;  2J0X A;  3N2Z B;  2X65 A;  1D0Y A;  2J0W A;  2MWQ A;  4XTK A;  1TW5 A;  3N9W A;  2OI7 A;  5CI8 A;  4KPX A;  1H5S D;  3JYH A;  3UMI A;  3HLZ A;  3AQB A;  2YC5 A;  2CU2 A;  2FYB A;  2RIZ A;  4G3P A;  4BJ6 C;  5C48 A;  1D1C A;  1ZI3 A;  2QGI A;  2Y4K A;  3SX7 A;  4AE4 B;  1PD0 A;  3S29 A;  1FRW A;  4P02 A;  2Z86 A;  4IWB A;  1BR4 A;  1LZJ A;  2J0B A;  1HJJ A;  1LZI A;  3JSZ A;  4YWQ A;  4I1O B;  4XWI A;  3K8D A;  5BUO A;  3SP1 A;  4Y9X A;  1YP4 A;  4K6R A;  2JCO A;  4CJB A;  1KWS A;  3NG1 A;  2W45 A;  5DLJ A;  4OD4 A;  3EH1 A;  4PJM A;  1R80 A;  1JPN A;  1ZJO A;  4PJJ A;  4B6I A;  4G87 A;  3EFO A;  2IXM A;  2G3K A;  3SX3 A;  2KJG A;  4ARW A;  4Y7V A;  1R7U A;  4KNX A;  2J45 A;  4IJJ A;  3OKR A;  2Z15 A;  1VGZ A;  2V0J A;  4AAW A;  3N24 A;  1H5T A;  1ZJ1 A;  2WAW A;  2Q9C A;  2BE5 F;  1G23 A;  4ASJ A;  4FRA A;  3RIP A;  2ZXP A;  5KYY B;  2W0V A;  4IRP A;  1LVW A;  2KNH A;  3F47 A;  4CS9 A;  3SX8 A;  3SXE A;  3OH2 A;  5EHH A;  3L0I A;  1MC3 A;  2X60 A;  3D8V A;  5CQO A;  4NY3 A;  4LER A;  3W8H A;  3EG9 A;  1JYK A;  2UX8 A;  3AG3 C;  3U2X A;  4U5G A;  4XLN F;  3H65 A;  2A6H F;  1S4P A;  3UNG C;  5DDT A;  5IFY A;  1ZI1 A;  4ZLC A;  4YT8 A;  4LAC B;  3U0Y A;  4JUR I;  3BRK X;  5DS4 A;  4FIX A;  1TWG A;  4PFO A;  4WJ0 A;  4XLP F;  2AEC A;  4M2A A;  5C3B A;  3B0P A;  3LS1 A;  3V0M A;  1SF8 A;  3MLG A;  2MYS A;  3OH1 A;  2J9U A;  5FU0 A;  4B5B A;  5C8R A;  3QZC A;  4HFK B;  4BJ6 A;  1W77 A;  5J49 A;  3K7D A;  1VYI A;  4LLE A;  2JCJ A;  1FR9 A;  5EJZ A;  2YHS A;  3DAG A;  4PFP A;  2OG2 A;  4BEJ A;  4FES A;  2YZS A;  4U5B E;  4DBR A;  3FAJ A;  1G8X A;  2IYL D;  5C4E A;  1WT3 A;  2OI5 A;  4QDL A;  5KYN A;  4U5D E;  2E8B A;  2Z87 A;  4KPZ A;  4FIY A;  3SX5 A;  2QY9 A;  3IEE A;  1GX0 A;  1H7Q A;  3I0L A;  4KT7 A;  1OCZ C;  1LL2 A;  2LSE A;  4KC2 A;  4DEC A;  2PP4 A;  2ZXW C;  1MP5 A;  2G62 A;  2GFH A;  2VXL A;  1M2V A;  4G7Z F;  1H5S B;  4JD0 A;  3OC9 A;  2WVK A;  3ABK C;  3O6X A;  3V8Z A;  1BR2 A;  2R7U A;  4Y62 A;  1LKX A;  4FRQ A;  5B1A C;  1GX4 A;  2KW3 C;  2BO7 A;  3I0C A;  5CQL X;  2Y3H A;  4Q4Z F;  3DJU B;  5AJP A;  2YQJ A;  4ULW A;  3ZF8 A;  1VH3 A;  4CS8 C;  2IXO A;  5IY5 C;  1V84 A;  4HO0 A;  4FWV A;  1R81 A;  4Q5S F;  2OEF A;  2R7O A;  2R7X A;  1VGW A;  4EBB A;  5CMH A;  2R7Q A;  2I5K A;  1FR8 A;  3EPV A;  1V55 C;  2YES A;  2L9J A;  2JCK A;  1KU2 A;  5CMF X;  1ZHZ A;  1OCO C;  2ICX A;  5CQN X;  1OQM B;  3JCU Q;  4CSA C;  2JCL A;  3EG9 B;  1YP3 A;  3PKP A;  4QI0 A;  1ZDG A;  2YQH A;  2XRH A;  2O1F A;  4B2X A;  4CS8 A;  3W2W A;  3X2Q C;  1PZY B;  1JVD A;  2OI6 A;  1VMA A;  1D1B A;  2L81 A;  3OH0 A;  4ECM A;  3I0I X;  1TR2 A;  2RIX A;  3DJN B;  4G3Q A;  2P6W A;  4BJT A;  3CKJ A;  1FWY A;  4EVW A;  3CKN A;  2C0N A;  2XMH A;  5T1D B;  4JIS A;  3SEO A;  1INI A;  4KNW A;  1LZ0 A;  1NHE B;  5CMG X;  3EGD A;  2NUT B;  4HFF B;  3NYL A;  4FRO A;  1VGT A;  5C3A A;  3ABM C;  4JJG A;  3TD7 A;  2FYD B;  5CQM X;  3ST8 A;  3I0K A;  1OCC C;  4HEA J;  2RJ6 A;  5FTV A;  4EEM A;  2O9X A;  1IZM A;  2D5R B;  3ZGF A;  4Y6N A;  1WGW A;  2EIM C;  3DUV A;  3NYJ A;  2WZF A;  4YT5 A;  4DOZ A;  2NUP A;  2VAS A;  3DAF A;  1INJ A;  2XWN A;  2QTV A;  5DS5 A;  2R7V A;  3OGZ A;  4G3S A;  4M4K A;  2R7R A;  1FTS A;  4EE3 A;  3AG4 C;  1ZYR F;  2A1D D;  3GAN A;  5D92 A;  3DM5 A;  4AYJ A;  3Q4S A;  2IXP A;  3I0H A;  1SS9 A;  1FXJ A;  1ZDF A;  4FQW A;  3UMH A;  3V0Q A;  1PCX A;  3QVB A;  4BMA A;  4JZA A;  1H5S C;  2X5S A;  3F46 A;  3ZIB A;  3CKO A;  3DZA A;  3ABL C;  4BG0 A;  1FO8 A;  2APC A;  2GGQ A;  1QLE C;  3USQ A;  4LLC A;  1H5S A;  4O79 A;  3LEV A;  1OMZ A;  2IXN A;  3K66 A;  1H5R A;  2BO4 A;  4EEG A;  5FV9 A;  2VSI A;  3JUJ A;  2NG1 A;  1R82 A;  4M63 A;  3PKQ A;  5DS6 A;  3K33 A;  2DPW A;  1QGS A;  3GUE A;  4NAN A;  4HO8 A;  3MX3 A;  3EHM A;  3RH3 A;  4D0T A;  2V0K A;  1QGQ A;  1O23 B;  1TWC A;  3AG1 C;  2P7V A;  2OCC C;  3JTJ A;  1O87 A;  2FY7 A;  2PX7 A;  1NKH B;  2X5Z A;  4KI2 A;  5L3Q A;  4M2B A;  5C1H A;  2FGY A;  2XME A;  2ZU8 A;  4FRP A;  4FCE A;  1HV9 A;  1O0R A;  2WZG A;  1TVY A;  2EIL C;  2H7O A;  5KYY A;  3EGD B;  5I1F A;  4FRM A;  1MMN A;  2HV7 A;  1GWV A;  1S4O A;  1V82 A;  3JRT A;  1H5T B;  4KC1 A;  4NAI A;  1H5R B;  2DYS C;  2FFH A;  4XWJ A;  4OIP F;  1GWW A;  1ZCT A;  1ZJ2 A;  3V91 A;  1W2W A;  4J32 B;  4B3U A;  3EFO B;  4I1M A;  1FO9 A;  1FOA A;  1OKK A;  2E87 A;  3RKO F;  1R7X A;  1VM8 A;  3POV A;  1ZJ3 A;  2D7R A;  1R7V A;  2I7B A;  3O3P A;  4PJN A;  3HJC A;  2H7B A;  3I4U A;  3LAY A;  1V83 A;  2X51 A;  3QMK A;  3BCV A;  4Y63 A;  1TWA A;  4U5C E;  2EIN C;  2CNW A;  2RJ4 A;  4AK9 A;  2B0J A;  1ST6 A;  4NAL A;  2Y3D A;  3LLI A;  2WVN A;  2M4E A;  1W57 A;  2VS5 A;  1NWG B;  4M28 A;  2A69 F;  4J18 A;  1LZ7 A;  3GOD A;  4N06 A;  2PGV A;  3EJN A;  3UMK A;  4IAO A;  1TW1 A;  3FOQ A;  3ZSU A;  3NGW A;  4HO3 A;  3ASN C;  3TQD A;  1FZW A;  4OIQ F;  2OEG A;  2ZXO A;  4RD9 A;  4C3D A;  3ZLL A;  4MND A;  3O39 A;  1LVK A;  5L3V A;  3E70 C;  1H7H A;  5DVW A;  4L41 C;  2WEE A;  4K7B A;  3S27 A;  1JYL A;  2FFU A;  1NQI B;  2FYC B;  3SXD A;  4EWC A;  5FCL A;  2G3V A;  1YP2 A;  3FDQ A;  2XSE A;  1Z63 A;  1Z6A A;  2Q3T A;  2P72 A;  1GQC A;  1W55 A;  3T7N A;  1J8Y F;  1FXO A;  4HO6 A;  2I5E A;  2IOQ A;  1QZX A;  2J7P D;  3Q7L A;  4BJ5 C;  1VH1 A;  3Q7U A;  5L6S A;  1ZCV A;  3E26 A;  2ZXR A;  3K1H A;  3SXA A;  1G97 A;  2VS3 A;  4JJF A;  4BJ1 A;  3DM9 B;  1OKK D;  4YJW A;  3I5Q A;  5DQZ A;  3OH4 A;  4IRU A;  4UEG A;  2VFZ A;  4KRV A;  5FUH A;  4C7O B;  1PD1 A;  4HO5 A;  4JW1 A;  3SNH A;  1D0X A;  1J8M F;  4D11 C;  2R7T A;  1LS1 A;  2PFD A;  5C1L A;  1IW7 F;  1NZE A;  5C4C A;  5JQQ A;  3DJ4 A;  2AGD A;  4DE7 A;  3L34 A;  2Y7A A;  3I0D A;  2PX0 A;  3ECS A;  3JT1 A;  3NYM A;  2A8U A;  3PHF 2;  4HCQ A;  2RJ9 A;  3ZVR A;  4NAK A;  4GEH A;  2Y4L A;  4GYT A;  1G93 A;  1NG1 A;  2A68 F;  2ZPA A;  1WT0 A;  1SZI A;  3UR3 C;  1ZJP A;  2Y4J A;  3SZR A;  3KIA A;  5EIY A;  4FCU A;  3F1C A;  4YN0 B;  3EE5 A;  4FRE A;  4IRQ A;  1SMY F;  1EYR A;  3DK5 A;  1RJ9 A;  2I8B A;  1JV3 A;  2AE7 A;  2WE9 A;  1ZI4 A;  2V3C C;  5KYW B;  4BQH A;  3OA1 A;  1HM9 A;  4Q7C A;  3DD7 A;  2CW0 F;  2V0L A;  4EE5 A;  2P6V A;  4A2N B;  1NF5 B;  2DYR C;  1Z23 A;  4Y7F A;  1WVC A;  1EZI A;  2WB7 A;  1VZT A;  4YS8 A;  1R7T A;  5FYE A;  2FFV A;  1ZCU A;  1JV1 A;  1JPJ A;  3RMW A;  4P6I C;  4U5F E;  4OIO F;  3OWT A;  1WSZ A;  4AYL A;  1ZU4 A;  2Y6P A;  1BR1 A;  4KQL A;  4P00 A;  2VSH A;  4ZDQ A;  4C2S A;  2Q9A A;  3U2U A;  5E2Q A;  4KC9 A;  2W4M A;  4KNV A;  3HTK C;  4MQ9 F;  3PNN A;  4CIH A;  3CGX A;  1G0R A;  2J9W A;  1VIC A;  4AC3 A;  2NUP B;  3M1C B;  4FRD A;  2Y3G A;  3KKB A;  1MMG A;  2KGO A;  5C36 A;  2ZU9 A;  5E33 A;  4CSA A;  3R3I A;  3SPT A;  4C3B A;  4MYB A;  4KBL A;  4Y7U A;  3RMV A;  4JCH A;  4OIN F;  1O7Q A;  1VZU A;  5AJO A;  5C3D A;  2BO6 A;  5IDT A;  1VPA A;  1G9R A;  2V0I A;  1NU9 C;  4HE8 D;  3JUK A;  4B2W A;  3SXG A;  2AM5 A;  5T3T A;  3RFY A;  3IOJ A;  2P73 A;  1HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...