5D91A

Structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords AF2299 protein,Phosphatidylinositol synthase
publication title Structural basis for phosphatidylinositol-phosphate biosynthesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 115
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
A PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1760 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5d91A02
3.90.550.30 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5d91A01
5D91A 4MNDA 4Q7CA 4O6NA 4O6MA 5D92A
chains in the Genus database with same CATH superfamily
4N6HA 1YLMA 1H7IA 4DRIB 1J8YF 2NG1A 256BA 4EBKA 4QI2A 2Y3DA 4O6NA 3BEHA 1G0RA 1FXOA 4OD4A 4B4MA 1Z6AA 1H5RB 1SYQA 2MZBA 1IINA 4ONSA 3DJ4A 4KI2A 4YK5A 1INJA 1ZYRF 2GAQA 1HW2A 3U8VA 3PCVA 4PJMA 2R7VA 2GA0A 3L1MA 2XLDA 1YJGA 2W9YA 2WVKA 5JUAA 4Y64A 1VZXA 3W8IA 4KQLA 3TD7A 3TJ5A 1NU7D 3RIPA 3EG9A 1FWYA 2C0NA 1O5HA 1BBHA 3V90A 3TJ6A 2QKXA 5C3AA 2VB6A 1IIMA 3DE8A 1ZJ0A 1UFBA 2XLVA 2G3KA 1LZ0A 1ON6A 4ECMA 1EA8A 1INIA 4NAIA 1VPAA 2XXAB 3UMIA 2AESA 1VZUA 4M2AA 3Q7UA 1R82A 1OW8A 3BRKX 3CQZA 3EH1A 4E0IA 3HL3A 1LPEA 2PNOA 3ABMC 2FYBA 3EJNA 4CS7A 3GWNA 2P6WA 1M2VA 3RQFA 3DAGA 4K0DA 3F1YA 3FOOA 1R7XA 3QVBA 4LW6A 3WODF 2L6FA 2ZU8A 1BZ4A 2VASA 4FCUA 1ZVZA 2XS1A 4OIOF 3FHDA 1I4ZA 1O0RA 3K1IC 2O1GA 4AE4A 1W57A 1ORYA 2A68F 2Y3BA 4LDKA 1ZHXA 1XHBA 4MTGA 3DD7A 4XWIA 2V0IA 1GQ9A 1U89A 2J46A 4Q4ZF 2HMZA 1V4AA 5L0HA 2P72A 4O7GA 2C03A 4G7ZF 1TFKB 4NTFA 2OEVA 5A6BA 4HCQA 5D91A 5A6BD 2LIGA 3JZ0A 3U2UA 2PX7A 1JV1A 1O87A 1VLSA 3WAQA 3TOLA 3MX3A 3ZLKA 3SEOA 4R7PA 4D4NA 4W8KA 4NQFA 4PACA 2O9XA 2B0HA 4CDVA 4YJWA 1T9KA 4JEBA 5L0FA 4U5GA 1ZI4A 2UUHA 2V0HA 4ANJA 3BRJA 5C1HA 4EEOA 2YL0A 3TQOA 2P0NA 3FVYA 4U9EA 3H2VA 4FRQA 4GYTA 4A2NB 1RJ9B 1FR8A 3USQA 1R7VA 1A7DA 3DMDA 4J7TA 1MNDA 4MS2A 4KC1A 3SZRA 2JPUA 1CPRA 3CEXA 3PDMP 2KYHA 3T6GB 1HM9A 2Q9CA 2DPWA 3FAPB 3AG2C 3K33A 2L9JA 1HM0A 5L0GA 2WAWA 3U2WA 3M4BA 2V0JA 2AVKA 2WB7A 3K66A 5AC5A 1HM8A 1H6GA 1HJJA 4FRMA 4PFPA 3MFNA 1CGOA 2VSHA 4FRHA 1KWSA 4CSAA 4LLEA 4ZLDA 2RSEB 4L41C 5DQTA 4JURI 3OH3A 4FRDA 1Q0DA 2FYDB 5CI9A 4CDAA 4EEAA 1NF5B 2DB4A 4FX5A 3T4RA 5C49A 5C4DA 4G7OF 3RFYA 1ST6A 3LEOA 2WVLA 1L7CA 3NYMA 5IY5C 4YS8A 5COFA 3EGDB 4LW3A 2YQYA 2KGOA 3KH2A 1D0YA 1SR2A 4HO4A 5C48A 1ZHWA 4YT5A 1R80A 2Z87A 4QI0A 1FZWA 4H4KC 5CIVA 2R05A 2IYLD 3T7NA 3LLKA 3J06A 4MVSA 3CGXA 4CJBA 1FR9A 3GORA 1R7YA 2OI7A 1YA7O 3VAYA 2NXVA 5DS6A 3IQTA 2XM4A 3QVYA 4N06A 5T3TA 1A41A 5E33A 1E86A 1LVKA 4DRJB 1G23A 5A6JA 4G78A 1QSPA 5T1DB 2L6GA 4ULVA 2GFHA 4CS8A 1A7EA 2YEVA 2YHSA 2Y4LA 4JIOA 2YCMA 1FGGA 5COMA 2XWNA 4HFKB 3DJUB 2OEXA 2Y7AA 1TKNA 3L34A 3HNJA 5JSLA 1YVIA 3O6XA 1GX0A 4CIPA 2J8WA 4FRPA 2WL8A 4XEKA 4Y7UA 4FROA 3I0FA 1K05A 4DDZA 4JKVA 3GEEA 4FCEA 1WT2A 2PA4A 1MMNA 1W2WA 2HFIA 1ORSC 2EPNA 2KJGA 2FGYA 2PF4E 4E7SA 5DVWA 3SXCA 3EPVA 2JCOA 5C4CA 4B3UA 2Q4FA 4FIYA 1N1CA 1WASA 1GQCA 3ASOC 3NYLA 5FU8A 3V0MA 3MBGA 1QQ3A 2VK9A 4Y7VA 2PX3A 2J0BA 1R7TA 5FTSA 3RVZA 1GWWA 3RSBA 1NBBA 4B4BA 4GQHA 2CYDA 3O3PA 4YN0B 4E7ZA 1C03A 3US6A 1EYRA 3B9QA 2Y3GA 3EH2A 1F1MA 1NG1A 4RBNA 5AJNA 4EVWA 4B4GA 4YL3A 3M4CA 1YP2A 4BQHA 2IOQA 3DE9A 4Q5SF 1OQMB 4HO5A 2L6HA 3NDBB 1V83A 2H7BA 3POLA 4HFFB 3IQCA 1H4CA 5EK0A 3KPHA 4M4KA 1HV9A 3LEVA 4P9FA 1FGXA 4P00A 3PKQA 2A8UA 2QGIA 4YWQA 1FR0A 2QTVA 2M64A 3ZQYA 3B29A 3EGXB 2RITA 4YT8A 4MVRA 3LNMB 4DBQA 1QWJA 3IOJA 3G50A 1S4NA 3VYWA 5KYXB 4YL0A 3Q7LA 2JCJA 2R25A 2XM0A 1TWHA 5CQLX 3C8GA 4JJFA 3C8GD 3LNRA 3SXGA 1NHEB 5FYEA 1JVGA 5FCLA 2Y4KA 1SF8A 1W55A 1A7VA 1GGQA 1LE2A 3SYNA 1WSZA 3K1IA 1OMXA 2W4MA 2ZXWC 2DYSC 1NKHB 4LACB 4W8PA 1AEPA 3C62A 2R7TA 5C4BA 4DJ9A 3MLGA 1ZJOA 4F4BA 4G7HF 4MIXA 4I1OB 1C17M 2V3CC 4KBLA 3UR3C 1VK5A 4XEVA 2Y4MA 2NSFA 4M2BA 4PJJA 4CBEA 1ZHJA 1K40A 4OINF 4DECA 2YKZA 4Y7TA 2RJ7A 3R2PA 1TZFA 1G97A 1OCZC 2OI6A 3I0CA 4EHPA 1B68A 5C47A 2R7WA 4ZLCA 4HO6A 4HO8A 4DRHB 2EIMC 1ZI5A 1T6IA 2NUPA 4FWVA 3M79A 2RJ5A 3GM3A 2APCA 1RKEA 3FOPA 2Q4JA 1VYIA 1DOVA 3L8JA 3JTLO 2D7IA 3U2MA 4D48A 3DM9B 2AH9A 3ZDLA 4KPZA 5B3IA 3O39A 1Y6DA 1E5KA 2YLGA 3WG7C 5C3BA 2EPLX 3ABKC 3AJMA 3Q80A 1JYKA 2OQMA 5DQZA 2BO8A 2H8AA 3I0EA 4EEMA 3LAYA 1G8XA 3I5PA 2Q9AA 3OH2A 3B71A 4B42A 2YL1A 4U5CE 4FAPB 3VF0A 3V0LA 4B2XA 5L3QA 2XMHA 3JYHA 4XPYA 2YVKA 1FG5N 4Z9HA 2I15A 2I5EA 1OCRC 3OH1A 3JCUQ 3JYYA 3M1CB 2IM8A 4CX9A 3U2LA 1ON8A 3AG3C 1G4US 2OOCA 1HE9A 1M2VB 3HNIA 3E70C 1PCXA 4FIXA 4R32A 1TWAA 5CI8A 5FZTA 2I8BA 1H5SC 1ZHTA 3S84A 1O7QA 2CCYA 4AYLA 5L0JA 2V26A 2RIXA 1TQGA 2CU2A 1Z3IX 1WTYA 4H54A 3W2WA 2NPUA 1ZJ3A 4I1MA 4Z9IA 2CGEA 5C4FA 2LSEA 4AE4B 4BJ6A 3OWTA 3RMVA 1OCOC 3TK0A 3U2TA 5C4EA 3I0LA 4A4AA 2VFZA 4PK4A 1E84A 4Y6UA 3U2XA 1EQ1A 1H7TA 4JC7A 4Y9XA 3DZAA 2LFFA 4UEGA 4HO9A 4FESA 3NKEA 3N0TA 1LE4A 3BCVA 2Y39A 1JPJA 4YT2A 1Q0GA 2LQGA 2XLHA 1VLTA 1ZW2A 1HJLA 5EJZA 3DKAA 3K8EA 3B0VC 4PR9A 3U9MA 1OCCC 1U0BB 3V91A 3ZF8A 3LS1A 4MNDA 1G5ZA 4CJCA 1HY5A 1TVYA 2NUTA 2KSFA 2YQSA 5DDTA 4Y7GA 3SXAA 1R4TA 1OKKA 3L8IA 1WT3A 4U5EE 2R7OA 1LI7A 3T7MA 4KC9A 3KYIA 4MW3A 3T6JA 3ATPA 4BJ5C 4B2WA 5F28E 3NRHA 1G9RA 2W0VA 4G0HA 1XWJA 3EFOA 2OJQA 3FMSA 4JZAA 1QKRA 2FAPB 2A6HF 4D11C 1C02A 2IXOA 2J0AA 4IRUA 4RD9A 4CIHA 2YQJA 1VICA 4CJOA 2BO7A 4FQWA 1SS9A 1YZCA 3AQBA 4JD0A 2G3VA 4FRLA 1LL0A 1T01A 2JD3A 4C7OA 4MVQA 4FRAA 4Q7CA 5C1GA 1VH3A 5B1BC 2R7UA 4I3MA 5DLJA 3X2QC 3SX3A 2OCCC 4P9TA 1YAUO 1APCA 4J30B 4D4XA 2RJ1A 4JRZA 2XRHA 3IQ6A 3I0GA 4N6CA 1LL3A 4IJJA 2RJ0A 1PZYB 2EIKC 2GDCA 1ZU4A 2YL7A 1Z63A 4U5DE 2F22A 1OMZA 3L0IA 2QUPA 3I0IX 2ZU7A 1H7HA 1KU2A 1LZ7A 5KYWA 5C3DA 1OXKA 1ZCTA 3LW6A 3D98A 4JE9A 3UMHA 2HS5A 3E9VA 3NMIA 3SXYA 4OD5A 2WVOA 5C38A 3PHF2 1YA9A 2R02A 4AK9A 5CQMX 2E3DA 1HW1A 1K04A 2EIJC 4AX2A 2A0BA 5DS5A 1M56C 3RF3A 4HOCA 2KK1A 3W4YA 4HEAJ 2ICXA 1T6UA 1FO9A 1MNEA 2OKUA 1CGNA 1J8MF 3Q7GA 3ZIBA 2L7AA 2VS3A 1FXJA 3SXKA 3ASNC 1MC3A 3PNNA 4U5FE 1R7UA 4C3EA 2OEFA 1EI7A 4PJNA 3DI5A 5JVEA 1FRWA 3W2VA 3NMKA 2ZPAA 3IPMO 4EWCA 3CKNA 3NMJA 1OQCA 2WVNA 3V8YA 1LM3B 1UG7A 3E25A 4AL0A 4KNRA 3SX5A 1NMMB 3I0HA 5CMGX 1YP4A 3K8DA 2XMEA 1O3UA 1V55C 4Y62A 1HMDA 1Q0MA 2WE9A 4BEJA 4DVZA 4EE3A 4JTDB 1TW5A 2HZ8A 5CMJA 3SXZA 1H7FA 1GS9A 3ZQVA 4O6MA 5EHHA 5HV9A 1VOMA 3H65A 4NY3A 1VGUA 4GEHA 2ICWG 3O10A 1JR8A 2J0XA 1BR1A 3FXHA 5K0IA 2XL4A 1EKYA 2GGQA 1ZI1A 5DDVA 3AGTA 1CPQA 3U2VA 2MYSA 1JVDA 1WWPA 2YZSA 3IHUA 2JCLA 1QGQA 2VSIA 3UMKA 4HO0A 3TULA 5L6VA 5T3WA 3JUJA 5JRAA 4J7YA 2VXLA 2AWYA 4EKWA 1WGWA 1GX4A 2O1FA 5C8RA 4KNWA 2J9UA 4NANA 2HSBA 1LIHA 2BE5F 2YC5A 2GGOA 1LZJA 2YWAA 2XLMA 1V74B 1GQAA 1SZIA 2J9VA 3POVA 4OIQF 4CS9C 4DXWA 4NAKA 2P6VA 5L0DA 2X51A 2DYRC 5EJ1A 4XWJA 3RQGA 1Z23A 1MP5A 4PFOA 4PJLA 5FV9A 1EZIA 4EBJA 3PMRA 4WJ0A 1ZJPA 3C8GB 4BEMJ 2Y3HA 3S9OA 1VM8A 1H5SA 3OH0A 3B0UX 1NLXA 4D0TA 5AC4A 3R7CA 1XZPA 1NU9C 3VM6A 1NZEA 1H4DA 1ZJ1A 3KKBA 3U5SA 2ZXOA 1D0XA 3KYJA 3DM5A 3RKOF 4G3SA 1NWGB 1WATA 4AAWA 3GM2A 2A1DD 3SXDA 3Q6NA 1ZHYA 2VD4A 1OXBA 3DUVA 3MYIA 3IOIA 2P73A 2J9WA 1ZZPA 4HG6A 2RIZA 1KTMA 2Q3TA 3RQEA 1ORJA 5KYNA 3U0CA 2IXPA 5KYUA 1RKCA 5C1LA 5L0IA 3V5XA 4CVHA 1OW6A 4DVYP 3FAJA 3EHNA 4ZDQA 1KNYA 5AGFA 4QDLA 4BJ1A 5HSWA 3AGUA 1QGSA 1V54C 4C3DA 4KXOA 4KNVA 2WVMA 4JTCB 3ZTMA 1ZDGA 3USRA 2AP3A 2YC3A 5FU0A 1BR2A 2AU5A 2NUPB 3QW0A 4DE7A 1RKEB 2GWWA 1FOAA 4JW1A 3K1HA 1H7EA 1JMWA 4XPXA 5JT4A 4XPWA 2Y6PA 1H5TA 3V5YA 4L6RA 1VGZA 1M2OA 4D11A 1FTSA 2DGJA 2NSGA 3TOMA 1VH1A 2HV6A 1MP4A 4O79A 1R5ID 1LKXA 5BQIA 5BQGA 1YYJA 1MMDA 5KYYA 2R7RA 4XEFA 4JEAA 5B1AC 2KC3A 2IBFA 2XLWA 4ASYA 3JTJA 4LDRA 1D1AA 2QE9A 2P61A 1HE1A 1T6QA 4OIPF 3SPTA 2HKVA 1BDJB 2CW0F 2E8BA 2PP4A 3EHMA 1H9TA 2DI3A 1NFNA 4K1OA 3V0PA 2ETSA 4Z9JA 2VS4A 2W45A 1K4VA 2FFHA 3F46A 1LZIA 2RD9A 3NG1A 3T9OA 2WZFA 1YDIA 3CKQA 3I0JA 1I4YA 3EG9B 3CKOA 1ZI3A 5JS5A 2RIYA 5BUOA 4AC3A 4E18A 3O55A 4NCQA 1G95A 1ZJ2A 1LI5A 3V5ZA 1FO8A 1FMVA 3N24A 4IAQA 3V0QA 1MMGA 1PZTA 1CGME 2VXMA 2I7BA 3HJCA 2E87A 5J49A 1GM5A 3T7OA 3U3BA 5F5FA 3LUTB 2KW3C 2A69F 2KNHA 5BQHA 3S0XA 2A0UA 2XL6A 3UGPA 4U5BE 2ASRA 3HNLA 1GWVA 3LLIA 3WHNA 2PGYA 4LERA 4U5HA 4G87A 5A6KA 2VC9A 3B0PA 3IQ5A 2XWMA 4B6IA 3U3FA 1YYXA 2OI5A 1XZQA 2LD6A 1XZ6A 3AG1C 5JLIA 3SX8A 3OC9A 4BPMA 2ZU9A 1ZHZA 2YL3A 4BG0A 3SXEA 2KQ9A 2NUTB 2HMQA 1E2XA 1WVCA 1LS4A 1MMAA 1JAFA 3SNHA 4KC2A 1H5RA 1MQVA 1R81A 3C18A 3LJBA 2J9BA 4MVOA 5BXCA 3DK5A 2D4UA 2YLDA 2VS5A 3GM1A 3EFOB 1YP3A 1BR4A 3N2ZB 3NYJA 1Y4CA 2LP4A 1S05A 3AG4C 2A6EF 2RJ4A 4AYJA 2VH3A 2V0LA 3GEHA 3DWWA 2X5ZA 1G93A 3VRCA 3W8HA 2PX0A 1YZAA 4Y6NA 4C7OB 4ULWA 2H7OA 3EZIA 1VYKA 3GODA 2Q7RA 3S90A 2R7SA 1OKKD 3H2UA 3DXJF 3SXMA 4LLCA 1ZCYA 1JOGA 2XXAA 4J32B 5JQQA 4P02A 5D92A 2QNLA 2WZLA 3ZG1A 3CU0A 3RVYA 4X0RA 3U0YA 1IZMA 1RXQA 3ECSA 3PKPA 3GEIA 1I5NA 2O1HA 5AJPA 1VB5A 1ZIZA 2HUJA 1TR2A 3SXBA 3U9JA 2L81A 2WVQA 2QY9A 5KYWB 2EPOA 1QZXA 3A11A 3SX7A 2J0WA 3HNKA 3V0OA 1E85A 1ZW3A 3ST8A 4CS9A 2RJ8A 1AUEA 3T6BA 3JUKA 3HTKC 2D7RA 1G3LA 2FYCB 4KPXA 4NTAA 1SMYF 1G8OA 2AECA 2G62A 4UDVA 3GUEA 3NKDA 2ZXRA 1GA8A 2ZD9A 1H3MA 2AE7A 3TQDA 3DJNB 2A8WA 2AM5A 2R03A 3DAFA 2VCCA 4HO3A 4XQ1A 4KRVA 4J18A 1U6HA 1O7OA 2FYAA 3HLZA 3S27A 4MW8A 4I44A 1VMAA 2ZXPA 3S29A 2EILC 3RYLA 1E83A 2CDQA 3NGWA 2Y69C 4N4WA 5L0CA 4KNXA 4EUKB 2W4BA 4FREA 3FOQA 4Y7FA 3M15A 3OA1A 2VCBA 4KC4A 3ZSUA 2X5SA 5C36A 1G1LA 3OAMA 2X65A 1D1CA 3OKRA 5I1FA 2EPMX 2AWCA 3D5NA 1M57C 3U0XA 2EINC 4KT7A 2W0WA 1VTMP 2XS8A 1VGWA 1FNTc 3EQLF 4IRPA 2MWQA 3N9WA 3F1CA 2XSEA 3KL4A 1HMOA 4E17A 2MHRA 1MP3A 1RJ9A 1D1BA 2CNWA 1S4OA 2LCHA 2CNWD 3K7DA 5L3VA 4IWBA 4NC3A 1V84A 2YQHA 3K6BA 3RMWA 3HKKA 3QZCA 2FFVA 4C3BA 2M4EA 3S28A 1PV3A 3OEOA 3FDQA 5EGYA 2HSQA 4YT4A 2ICYA 2AM4A 4WGYA 3JT1A 5B3SC 1O23B 1Z90A 1FAPB 4Y63A 4BJ6C 1Z5ZA 4G3QA 2HJMA 1TWGA 2YLIA 1FFHA 4EE5A 3EE5A 3Q4SA 3R2WA 5A6AA 4DOZA 3QW1A 4EIYA 3OH4A 1TWCA 2PGVA 5CQPA 3E26A 3QVZA 4B5BA 4JTAB 3ZVRA 3I5QA 4GBPA 4MVZA 1FFTC 2IXNA 3ZWIA 4XLPF 4K6RA 2IXMA 5E2QA 3CAXA 1YROB 4E0HA 1H9GA 5EIYA 3EGDA 4HO2A 2D0JA 1H4EA 5FTVA 3JSEO 3X1OA 5A69A 4P6IC 3JRMO 3CSKA 2RJ9A 5CMHA 4NTBA 3JSZA 1LL2A 3FWWA 2B0JA 3G4XA 3U8PA 1LVWA 2X60A 4ASJA 3IEEA 2AM3A 4JJGA 1H5SB 4WGZA 2R7XA 2D5RB 1WT0A 2XWLA 1JPNA 1QLEC 3LESA 3GANA 3V0NA 4C2SA 1QVXA 4DBRA 3RH3A 5CQNX 1D0ZA 1M6TA 4JCHA 2P7VA 2X0CA 3ZGGA 3GWLA 1Q0FA 1V82A 1Q0KA 2TMVP 2OEGA 2OJED 2BO4A 4E1KA 5CQOA 5HS2A 3C8ZA 2PFDA 4XLNF 1ZDFA 3ZGFA 4MQ9F 2QH5A 4U9DA 3JRTA 1ZCVA 3I4UA 1PD1A 2RJ6A 2WEEA 5IFYA 2JX0A 5L6SA 2JCKA 4LDQA 5KYUB 2WZGA 4K7BA 1A0BA 3LS0A 5E3CA 1H5SD 1RMVA 1RCPA 4ARWA 5E3AA 2PBEA 4M28A 4MVMA 2YQCA 4G3PA 1AVOB 1TFOB 2XLOA 3KIAA 1JYLA 1ZCUA 2HJ3A 3G4ZA 3TZTA 4EEGA 2J45A 3QTHA 3F47A 1PD0A 2J7PA 4IARA 2YRFA 3C7JA 3KMIA 2J7PD 2BL2A 3CKJA 4EBBA 4O6YA 3UNGC 2UX8A 2YESA 5IDSA 2FFUA 5F5HA 2WGZA 1JV3A 3OGZA 2AGDA 1QPUA 1H5TB 4M63A 1Z7Qc 5FUHA 2LFDA 3Q6MA 4EE4A 4IGGA 1YARO 4CSAC 2HV7A 1NFOA 2R7QA 2XLEA 4JISA 5KYYB 4IB4A 1WN0A 3AOUA 1DOWA 5CMIA 2H7VC 4YL1A 3RW0A 2BC5A 3CZ6A 3IOHA 1JRAA 2I5KA 1I52A 2BO6A 4AL1A 3ZLLA 2Z86A 4RDAA 1NQIB 3QMKA 4BJ5A 1LS1A 4IAOA 5COGA 1VGTA 2EPKX 1G4WR 5GPGB 3UGOA 1S4PA 3V7OA 3EGXA 2LK4A 1S7ZA 1H7LA 1OW7A 1VZTA 4MTOA 5KYXA 1L3PA 2VCAA 2R9RB 3CKVA 4CJGA 1QG8A 2Z15A 1H7QA 2UUIA 5TJ5E 3I0KA 4MVUA 3D8VA 2C04A 4NALA 3AQCA 2Y4JA 4WABA 4OIRF 5JP7A 2XL8A 3A9CA 2OG2A 5DS4A 2QLAA 4D0ZA 2OU6A 5IDTA 3I0DA 4BJTA 4JCZA 4BMAA 4XTKA 2Q00A 3R3IA 4CDYA 4CS8C 3ZC4A 4HE8D 1FMWA 1H7GA 1OR3A 3ITFA 5AJOA 1OR2A 1G2VA 4CJ8A 3V8ZA 4ER9A 2P1AA 4JVSA 1TW1A 4MYBA 1T5OA 3EZHA 1WT1A 2FY7A 1NSGB 1WOLA 3MYFA 1ZU5A 3ABLC 3C63A 4MTFA 1W77A 5CMFX 2V0KA 3SP1A 4FRBA 1IW7F 2Q9BA 4IRQA 3ZTZA
chains in the Genus database with same CATH topology
3NDBB 2WZLA 1V83A 3ZG1A 3CU0A 4X0RA 2H7BA 4EWCA 3POLA 4HFFB 3U0YA 3CKNA 1J8YF 1IZMA 1H4CA 2WVNA 3V8YA 2NG1A 4M4KA 3ECSA 1HV9A 3E25A 3LEVA 3PKPA 4QI2A 1FGXA 4P00A 4KNRA 2Y3DA 4O6NA 2PA4A 2A8UA 1NMMB 2O1HA 2QGIA 3PKQA 5AJPA 4YWQA 3SX5A 3I0HA 2QTVA 1ZIZA 5CMGX 1G0RA 1TR2A 1YP4A 3SXBA 2L81A 2WVQA 3K8DA 2XMEA 1FXOA 4OD4A 1V55C 1Z6AA 2QY9A 5KYWB 1H5RB 2MZBA 4B4MA 1IINA 3EGXB 1QZXA 2RITA 3SX7A 4YT8A 4Y62A 2J0WA 3V0OA 4DBQA 1QWJA 3IOJA 1S4NA 3VYWA 2WE9A 5KYXB 4BEJA 4DVZA 4EE3A 3DJ4A 3ST8A 4CS9A 2RJ8A 1TW5A 4KI2A 1INJA 1ZYRF 3Q7LA 3T6BA 3JUKA 2JCJA 5CMJA 3HTKC 1H7FA 2D7RA 1G3LA 2FYCB 4KPXA 4O6MA 4PJMA 1SMYF 5EHHA 2R7VA 1TWHA 1G8OA 2AECA 5CQLX 2G62A 4JJFA 1VOMA 3LNRA 3H65A 3GUEA 4NY3A 1VGUA 2W9YA 2WVKA 3SXGA 3NKDA 1NHEB 4Y64A 4GEHA 1VZXA 2ZXRA 3W8IA 5FYEA 4KQLA 1GA8A 1JVGA 1H3MA 2J0XA 5FCLA 1BR1A 3TD7A 2Y4KA 1SF8A 2AE7A 1NU7D 2XL4A 3TQDA 3DJNB 1W55A 2A8WA 2AM5A 3RIPA 2GGQA 3EG9A 1FWYA 3DAFA 1ZI1A 2C0NA 3SYNA 1O5HA 4HO3A 5DDVA 4KRVA 3U2VA 4J18A 2MYSA 1JVDA 1WSZA 3V90A 1OMXA 2W4MA 2QKXA 5C3AA 2YZSA 1O7OA 2FYAA 3HLZA 2ZXWC 2DYSC 2VB6A 1IIMA 3S27A 1NKHB 2JCLA 1QGQA 4LACB 1ZJ0A 2VSIA 4I44A 3UMKA 4HO0A 1VMAA 2G3KA 5L6VA 2ZXPA 3S29A 2R7TA 5C4BA 2EILC 5T3WA 3RYLA 1LZ0A 1ON6A 3JUJA 4ECMA 1INIA 2VXLA 2CDQA 4NAIA 3NGWA 2Y69C 1VPAA 2XXAB 3UMIA 3MLGA 4KNXA 1ZJOA 4FREA 2W4BA 1WGWA 4F4BA 4G7HF 1GX4A 4I1OB 3FOQA 2O1FA 4MIXA 2AESA 5C8RA 4KNWA 2J9UA 1VZUA 4M2AA 4P02A 4NANA 4Y7FA 2V3CC 3OA1A 4KBLA 3Q7UA 2BE5F 4KC4A 1R82A 2YC5A 2GGOA 3ZSUA 3UR3C 3BRKX 1VK5A 3CQZA 2X5SA 3EH1A 1LZJA 2Y4MA 3HL3A 5C36A 1G1LA 4M2BA 1SZIA 2J9VA 3ABMC 4PJJA 3POVA 4CBEA 4OIQF 2FYBA 3OAMA 4CS9C 2X65A 1ZHJA 4OINF 1D1CA 3OKRA 4NAKA 4B2WA 2P6VA 5I1FA 4DECA 4Y7TA 2RJ7A 3D5NA 2X51A 2DYRC 3EJNA 1TZFA 5EJ1A 1M57C 4CS7A 2EINC 4XWJA 1G97A 1OCZC 3U0XA 1Z23A 2P6WA 1MP5A 4KT7A 4PFOA 2OI6A 2W0WA 3I0CA 4PJLA 1M2VA 1VGWA 3EQLF 4IRPA 5FV9A 2MWQA 2R7WA 5C47A 3DAGA 4ZLCA 3N9WA 4HO6A 4HO8A 1EZIA 4K0DA 3F1CA 3F1YA 2EIMC 2XSEA 3KL4A 1R7XA 3QVBA 3PMRA 1ZI5A 4WJ0A 1ZJPA 4LW6A 1MP3A 1RJ9A 3WODF 1D1BA 2CNWA 2NUPA 1S4OA 2Y3HA 2ZU8A 4FWVA 2VASA 1VM8A 2CNWD 3K7DA 2RJ5A 4FCUA 5L3VA 4IWBA 2APCA 1H5SA 3OH0A 3B0UX 1V84A 4D0TA 2YQHA 4OIOF 5C3DA 3K6BA 3FHDA 3RMWA 2Q4JA 1O0RA 3K1IC 2O1GA 1VYIA 4AE4A 1W57A 3QZCA 2A68F 2Y3BA 2D7IA 1NU9C 2FFVA 1ZHXA 1XHBA 4D48A 3DD7A 1NZEA 4XWIA 3DM9B 4C3BA 2V0IA 1GQ9A 1H4DA 2M4EA 1ZJ1A 3S28A 3KKBA 2J46A 2AH9A 2ZXOA 4Q4ZF 3OEOA 4KPZA 1D0XA 3FDQA 3DM5A 3O39A 3RKOF 5EGYA 4G3SA 1NWGB 4YT4A 1E5KA 2ICYA 4AAWA 2AM4A 2P72A 2A1DD 4O7GA 3WG7C 3JT1A 5B3SC 1O23B 1Z90A 2C03A 3SXDA 3Q6NA 1ZHYA 4G7ZF 4BJ6C 4Y63A 1Z5ZA 5C3BA 4G3QA 4HCQA 3ABKC 3Q80A 1JYKA 5D91A 1TWGA 5DQZA 2VD4A 2BO8A 3DUVA 3IOIA 4EEMA 3I0EA 1FFHA 3U2UA 2PX7A 1JV1A 2P73A 2J9WA 3LAYA 1G8XA 3I5PA 2Q9AA 3OH2A 4B42A 4HG6A 4U5CE 2RIZA 2Q3TA 4EE5A 1O87A 3EE5A 3Q4SA 3R2WA 3V0LA 4B2XA 3MX3A 5KYNA 5L3QA 3ZLKA 4DOZA 2XMHA 2IXPA 5KYUA 3SEOA 3OH4A 3JYHA 4R7PA 1TWCA 5C1LA 2PGVA 4W8KA 5CQPA 3E26A 4CVHA 4DVYP 4B5BA 2O9XA 3FAJA 3I5QA 3ZVRA 1FG5N 4GBPA 3EHNA 2I5EA 1FFTC 4ZDQA 1OCRC 2IXNA 3JCUQ 4XLPF 4QDLA 4BJ1A 3OH1A 4K6RA 2IXMA 4YJWA 5E2QA 3M1CB 5HSWA 1QGSA 1ON8A 1YROB 3AG3C 1V54C 4C3DA 4U5GA 1ZI4A 5EIYA 4KXOA 4KNVA 2V0HA 3EGDA 2WVMA 3V0NA 1M2VB 4ANJA 1ZDGA 4HO2A 3E70C 2D0JA 1H4EA 1PCXA 4FIXA 3USRA 5C1HA 5FTVA 1TWAA 5CI8A 3X1OA 4EEOA 2I8BA 4P6IC 1H5SC 2YC3A 1ZHTA 3CSKA 2RJ9A 1O7QA 5CMHA 3JSZA 3FVYA 1LL2A 3FWWA 2B0JA 4AYLA 2Q9BA 4FRQA 4GYTA 5FU0A 1BR2A 2V26A 4A2NB 1LVWA 1RJ9B 1FR8A 2NUPB 2X60A 3IEEA 4ASJA 3USQA 1R7VA 4DE7A 2RIXA 2CU2A 2AM3A 1Z3IX 4JJGA 1H5SB 3W2WA 2R7XA 1FOAA 2D5RB 4I1MA 3DMDA 1ZJ3A 1WT0A 4JW1A 2CGEA 1MNDA 2XWLA 1JPNA 5C4FA 1QLEC 3LESA 3GANA 3K1HA 2LSEA 4AE4B 4BJ6A 3OWTA 1H7EA 4KC1A 3SZRA 1OCOC 3RMVA 2Y6PA 3U2TA 4C2SA 1H5TA 5C4EA 4DBRA 3I0LA 3RH3A 2VFZA 5CQNX 1D0ZA 4JCHA 2P7VA 1VGZA 1M2OA 4D11A 1FTSA 2DGJA 4PK4A 4Y6UA 1HM9A 2Q9CA 2DPWA 3U2XA 3ZGGA 1VH1A 3AG2C 3K33A 2HV6A 2L9JA 1HM0A 1MP4A 1H7TA 4O79A 1V82A 2WAWA 3U2WA 2OEGA 4Y9XA 2V0JA 2WB7A 3DZAA 3K66A 2BO4A 1HM8A 5CQOA 1LKXA 4E1KA 5HS2A 1HJJA 4UEGA 4FRMA 4HO9A 4FESA 4PFPA 3NKEA 2PFDA 3N0TA 1MMDA 4XLNF 5KYYA 3BCVA 2R7RA 1ZDFA 4MQ9F 2VSHA 4FRHA 3ZGFA 1KWSA 2Y39A 2QH5A 5B1AC 1JPJA 4ASYA 4YT2A 4CSAA 1D1AA 4LLEA 4ZLDA 3JTJA 3JRTA 1ZCVA 3I4UA 1PD1A 4L41C 4OIPF 5DQTA 2RJ6A 3SPTA 4JURI 2WEEA 3OH3A 5IFYA 4FRDA 2FYDB 1HJLA 2JCKA 5L6SA 5EJZA 5CI9A 5KYUB 2WZGA 2CW0F 4EEAA 1NF5B 3K8EA 2E8BA 4K7BA 2PP4A 3EHMA 4FX5A 3B0VC 3V91A 3LS0A 1OCCC 3T4RA 3ZF8A 5C49A 5C4DA 4G7OF 3LS1A 3V0PA 4MNDA 5E3CA 3RFYA 1H5SD 2VS4A 4CJCA 2W45A 1TVYA 1K4VA 4ARWA 1ST6A 2FFHA 3F46A 2NUTA 1LZIA 2WVLA 2YQSA 5DDTA 5E3AA 4Y7GA 3NG1A 3SXAA 3NYMA 5IY5C 2WZFA 1OKKA 4M28A 4YS8A 2YQCA 1WT3A 3CKQA 3I0JA 4G3PA 3EGDB 4U5EE 3EG9B 4LW3A 3CKOA 2R7OA 1ZI3A 2KGOA 2RIYA 3KIAA 3KH2A 4KC9A 5BUOA 1JYLA 3T7MA 4AC3A 1D0YA 1ZCUA 4HO4A 5C48A 3TZTA 4EEGA 1G95A 2J45A 3T6JA 1ZJ2A 1ZHWA 4YT5A 3F47A 1PD0A 4BJ5C 1R80A 2J7PA 4QI0A 2Z87A 4H4KC 1FO8A 1FMVA 3N24A 1FZWA 3KMIA 2J7PD 3NRHA 1MMGA 1G9RA 1PZTA 2IYLD 2W0VA 3V0QA 3T7NA 3LLKA 4G0HA 3EFOA 2VXMA 3CKJA 4EBBA 4O6YA 3UNGC 2UX8A 4JZAA 2YESA 5IDSA 2I7BA 2FFUA 4D11C 2A6HF 5F5HA 3HJCA 3CGXA 4CJBA 2IXOA 1FR9A 2J0AA 2WGZA 2E87A 5J49A 3T7OA 1JV3A 5F5FA 1R7YA 3OGZA 4IRUA 4RD9A 2KW3C 4CIHA 2A69F 2AGDA 2OI7A 3VAYA 1H5TB 2KNHA 2NXVA 4M63A 2YQJA 5DS6A 3S0XA 1VICA 2BO7A 3UGPA 4FQWA 5FUHA 4N06A 1SS9A 3Q6MA 4EE4A 3AQBA 4U5BE 5T3TA 4JD0A 2G3VA 4FRLA 5E33A 4CSAC 2HV7A 1GWVA 1LVKA 1G23A 1LL0A 2JD3A 4C7OA 4FRAA 2R7QA 3LLIA 5T1DB 4Q7CA 2PGYA 5C1GA 4LERA 4JISA 1VH3A 4U5HA 5B1BC 2R7UA 4I3MA 4G87A 5KYYB 3B0PA 2GFHA 5DLJA 4CS8A 2YEVA 3X2QC 3SX3A 2YHSA 5CMIA 2OCCC 2Y4LA 2XWMA 4B6IA 4J30B 2RJ1A 2YCMA 2XRHA 1FGGA 3I0GA 2H7VC 1LL3A 2XWNA 4IJJA 2RJ0A 4HFKB 3CZ6A 3DJUB 3IOHA 1PZYB 2Y7AA 2I5KA 2OI5A 1XZ6A 2EIKC 3AG1C 3SX8A 1I52A 3OC9A 1TKNA 3L34A 1ZU4A 2BO6A 2ZU9A 1ZHZA 1Z63A 4BG0A 3ZLLA 2Z86A 3SXEA 4U5DE 1OMZA 4RDAA 1NQIB 2KQ9A 3O6XA 3QMKA 3L0IA 1LS1A 4IAOA 4BJ5A 2NUTB 1GX0A 4FRPA 2WL8A 1VGTA 4Y7UA 4FROA 3I0FA 4DDZA 1WVCA 3I0IX 2ZU7A 1H7HA 1KU2A 1MMAA 1LZ7A 4FCEA 3UGOA 3SNHA 1MMNA 1W2WA 5KYWA 1H5RA 3V7OA 3EGXA 1S4PA 1WT2A 4KC2A 1S7ZA 1H7LA 2KJGA 2FGYA 2PF4E 1VZTA 1ZCTA 1R81A 4E7SA 3LW6A 5DVWA 3SXCA 3EPVA 5KYXA 2JCOA 3LJBA 3D98A 5C4CA 4B3UA 3CKVA 3UMHA 5BXCA 3DK5A 4FIYA 1N1CA 2VS5A 1GQCA 1QG8A 3E9VA 2Z15A 3EFOB 1H7QA 3ASOC 3NYLA 1BR4A 2WVOA 4OD5A 1YP3A 3I0KA 5FU8A 5C38A 3N2ZB 3D8VA 3PHF2 2C04A 3V0MA 3NYJA 4NALA 3AQCA 2Y4JA 2VK9A 4Y7VA 4AK9A 5CQMX 4OIRF 2PX3A 2E3DA 2J0BA 1R7TA 2OG2A 3AG4C 5DS4A 2EIJC 2A6EF 4AX2A 5FTSA 4D0ZA 2RJ4A 4AYJA 2VH3A 3I0DA 5IDTA 2V0LA 1GWWA 4BJTA 3RSBA 4BMAA 4XTKA 2X5ZA 5DS5A 1G93A 1M56C 4HOCA 4B4BA 3R3IA 4CS8C 3ZC4A 4HE8D 1FMWA 3W8HA 1H7GA 3ITFA 3O3PA 4HEAJ 2PX0A 2ICXA 4YN0B 4Y6NA 4E7ZA 1FO9A 4C7OB 5AJOA 1MNEA 2H7OA 4ULWA 1G2VA 3V8ZA 4CJ8A 3EZIA 1VYKA 3GODA 4JVSA 1TW1A 1J8MF 4MYBA 3Q7GA 3B9QA 1EYRA 3EZHA 3ZIBA 1WT1A 2FY7A 2VS3A 2R7SA 2Y3GA 1FXJA 1OKKD 3EH2A 1NG1A 3ASNC 1MC3A 4RBNA 3DXJF 3PNNA 4U5FE 1R7UA 5AJNA 4EVWA 4LLCA 4B4GA 4C3EA 1ZU5A 3ABLC 2OEFA 1YP2A 4BQHA 2IOQA 4Q5SF 1W77A 2V0KA 4PJNA 5CMFX 1ZCYA 3SP1A 1OQMB 1FRWA 2XXAA 4HO5A 4J32B 3W2VA 4FRBA 5JQQA 1IW7F 2ZPAA 4IRQA 5D92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D91 A;  4MND A;  4Q7C A;  4O6N A;  4O6M A;  5D92 A; 
#chains in the Genus database with same CATH topology
 4N6H A;  1YLM A;  1H7I A;  4DRI B;  1J8Y F;  2NG1 A;  256B A;  4EBK A;  4QI2 A;  2Y3D A;  4O6N A;  3BEH A;  1G0R A;  1FXO A;  4OD4 A;  4B4M A;  1Z6A A;  1H5R B;  1SYQ A;  2MZB A;  1IIN A;  4ONS A;  3DJ4 A;  4KI2 A;  4YK5 A;  1INJ A;  1ZYR F;  2GAQ A;  1HW2 A;  3U8V A;  3PCV A;  4PJM A;  2R7V A;  2GA0 A;  3L1M A;  2XLD A;  1YJG A;  2W9Y A;  2WVK A;  5JUA A;  4Y64 A;  1VZX A;  3W8I A;  4KQL A;  3TD7 A;  3TJ5 A;  1NU7 D;  3RIP A;  3EG9 A;  1FWY A;  2C0N A;  1O5H A;  1BBH A;  3V90 A;  3TJ6 A;  2QKX A;  5C3A A;  2VB6 A;  1IIM A;  3DE8 A;  1ZJ0 A;  1UFB A;  2XLV A;  2G3K A;  1LZ0 A;  1ON6 A;  4ECM A;  1EA8 A;  1INI A;  4NAI A;  1VPA A;  2XXA B;  3UMI A;  2AES A;  1VZU A;  4M2A A;  3Q7U A;  1R82 A;  1OW8 A;  3BRK X;  3CQZ A;  3EH1 A;  4E0I A;  3HL3 A;  1LPE A;  2PNO A;  3ABM C;  2FYB A;  3EJN A;  4CS7 A;  3GWN A;  2P6W A;  1M2V A;  3RQF A;  3DAG A;  4K0D A;  3F1Y A;  3FOO A;  1R7X A;  3QVB A;  4LW6 A;  3WOD F;  2L6F A;  2ZU8 A;  1BZ4 A;  2VAS A;  4FCU A;  1ZVZ A;  2XS1 A;  4OIO F;  3FHD A;  1I4Z A;  1O0R A;  3K1I C;  2O1G A;  4AE4 A;  1W57 A;  1ORY A;  2A68 F;  2Y3B A;  4LDK A;  1ZHX A;  1XHB A;  4MTG A;  3DD7 A;  4XWI A;  2V0I A;  1GQ9 A;  1U89 A;  2J46 A;  4Q4Z F;  2HMZ A;  1V4A A;  5L0H A;  2P72 A;  4O7G A;  2C03 A;  4G7Z F;  1TFK B;  4NTF A;  2OEV A;  5A6B A;  4HCQ A;  5D91 A;  5A6B D;  2LIG A;  3JZ0 A;  3U2U A;  2PX7 A;  1JV1 A;  1O87 A;  1VLS A;  3WAQ A;  3TOL A;  3MX3 A;  3ZLK A;  3SEO A;  4R7P A;  4D4N A;  4W8K A;  4NQF A;  4PAC A;  2O9X A;  2B0H A;  4CDV A;  4YJW A;  1T9K A;  4JEB A;  5L0F A;  4U5G A;  1ZI4 A;  2UUH A;  2V0H A;  4ANJ A;  3BRJ A;  5C1H A;  4EEO A;  2YL0 A;  3TQO A;  2P0N A;  3FVY A;  4U9E A;  3H2V A;  4FRQ A;  4GYT A;  4A2N B;  1RJ9 B;  1FR8 A;  3USQ A;  1R7V A;  1A7D A;  3DMD A;  4J7T A;  1MND A;  4MS2 A;  4KC1 A;  3SZR A;  2JPU A;  1CPR A;  3CEX A;  3PDM P;  2KYH A;  3T6G B;  1HM9 A;  2Q9C A;  2DPW A;  3FAP B;  3AG2 C;  3K33 A;  2L9J A;  1HM0 A;  5L0G A;  2WAW A;  3U2W A;  3M4B A;  2V0J A;  2AVK A;  2WB7 A;  3K66 A;  5AC5 A;  1HM8 A;  1H6G A;  1HJJ A;  4FRM A;  4PFP A;  3MFN A;  1CGO A;  2VSH A;  4FRH A;  1KWS A;  4CSA A;  4LLE A;  4ZLD A;  2RSE B;  4L41 C;  5DQT A;  4JUR I;  3OH3 A;  4FRD A;  1Q0D A;  2FYD B;  5CI9 A;  4CDA A;  4EEA A;  1NF5 B;  2DB4 A;  4FX5 A;  3T4R A;  5C49 A;  5C4D A;  4G7O F;  3RFY A;  1ST6 A;  3LEO A;  2WVL A;  1L7C A;  3NYM A;  5IY5 C;  4YS8 A;  5COF A;  3EGD B;  4LW3 A;  2YQY A;  2KGO A;  3KH2 A;  1D0Y A;  1SR2 A;  4HO4 A;  5C48 A;  1ZHW A;  4YT5 A;  1R80 A;  2Z87 A;  4QI0 A;  1FZW A;  4H4K C;  5CIV A;  2R05 A;  2IYL D;  3T7N A;  3LLK A;  3J06 A;  4MVS A;  3CGX A;  4CJB A;  1FR9 A;  3GOR A;  1R7Y A;  2OI7 A;  1YA7 O;  3VAY A;  2NXV A;  5DS6 A;  3IQT A;  2XM4 A;  3QVY A;  4N06 A;  5T3T A;  1A41 A;  5E33 A;  1E86 A;  1LVK A;  4DRJ B;  1G23 A;  5A6J A;  4G78 A;  1QSP A;  5T1D B;  2L6G A;  4ULV A;  2GFH A;  4CS8 A;  1A7E A;  2YEV A;  2YHS A;  2Y4L A;  4JIO A;  2YCM A;  1FGG A;  5COM A;  2XWN A;  4HFK B;  3DJU B;  2OEX A;  2Y7A A;  1TKN A;  3L34 A;  3HNJ A;  5JSL A;  1YVI A;  3O6X A;  1GX0 A;  4CIP A;  2J8W A;  4FRP A;  2WL8 A;  4XEK A;  4Y7U A;  4FRO A;  3I0F A;  1K05 A;  4DDZ A;  4JKV A;  3GEE A;  4FCE A;  1WT2 A;  2PA4 A;  1MMN A;  1W2W A;  2HFI A;  1ORS C;  2EPN A;  2KJG A;  2FGY A;  2PF4 E;  4E7S A;  5DVW A;  3SXC A;  3EPV A;  2JCO A;  5C4C A;  4B3U A;  2Q4F A;  4FIY A;  1N1C A;  1WAS A;  1GQC A;  3ASO C;  3NYL A;  5FU8 A;  3V0M A;  3MBG A;  1QQ3 A;  2VK9 A;  4Y7V A;  2PX3 A;  2J0B A;  1R7T A;  5FTS A;  3RVZ A;  1GWW A;  3RSB A;  1NBB A;  4B4B A;  4GQH A;  2CYD A;  3O3P A;  4YN0 B;  4E7Z A;  1C03 A;  3US6 A;  1EYR A;  3B9Q A;  2Y3G A;  3EH2 A;  1F1M A;  1NG1 A;  4RBN A;  5AJN A;  4EVW A;  4B4G A;  4YL3 A;  3M4C A;  1YP2 A;  4BQH A;  2IOQ A;  3DE9 A;  4Q5S F;  1OQM B;  4HO5 A;  2L6H A;  3NDB B;  1V83 A;  2H7B A;  3POL A;  4HFF B;  3IQC A;  1H4C A;  5EK0 A;  3KPH A;  4M4K A;  1HV9 A;  3LEV A;  4P9F A;  1FGX A;  4P00 A;  3PKQ A;  2A8U A;  2QGI A;  4YWQ A;  1FR0 A;  2QTV A;  2M64 A;  3ZQY A;  3B29 A;  3EGX B;  2RIT A;  4YT8 A;  4MVR A;  3LNM B;  4DBQ A;  1QWJ A;  3IOJ A;  3G50 A;  1S4N A;  3VYW A;  5KYX B;  4YL0 A;  3Q7L A;  2JCJ A;  2R25 A;  2XM0 A;  1TWH A;  5CQL X;  3C8G A;  4JJF A;  3C8G D;  3LNR A;  3SXG A;  1NHE B;  5FYE A;  1JVG A;  5FCL A;  2Y4K A;  1SF8 A;  1W55 A;  1A7V A;  1GGQ A;  1LE2 A;  3SYN A;  1WSZ A;  3K1I A;  1OMX A;  2W4M A;  2ZXW C;  2DYS C;  1NKH B;  4LAC B;  4W8P A;  1AEP A;  3C62 A;  2R7T A;  5C4B A;  4DJ9 A;  3MLG A;  1ZJO A;  4F4B A;  4G7H F;  4MIX A;  4I1O B;  1C17 M;  2V3C C;  4KBL A;  3UR3 C;  1VK5 A;  4XEV A;  2Y4M A;  2NSF A;  4M2B A;  4PJJ A;  4CBE A;  1ZHJ A;  1K40 A;  4OIN F;  4DEC A;  2YKZ A;  4Y7T A;  2RJ7 A;  3R2P A;  1TZF A;  1G97 A;  1OCZ C;  2OI6 A;  3I0C A;  4EHP A;  1B68 A;  5C47 A;  2R7W A;  4ZLC A;  4HO6 A;  4HO8 A;  4DRH B;  2EIM C;  1ZI5 A;  1T6I A;  2NUP A;  4FWV A;  3M79 A;  2RJ5 A;  3GM3 A;  2APC A;  1RKE A;  3FOP A;  2Q4J A;  1VYI A;  1DOV A;  3L8J A;  3JTL O;  2D7I A;  3U2M A;  4D48 A;  3DM9 B;  2AH9 A;  3ZDL A;  4KPZ A;  5B3I A;  3O39 A;  1Y6D A;  1E5K A;  2YLG A;  3WG7 C;  5C3B A;  2EPL X;  3ABK C;  3AJM A;  3Q80 A;  1JYK A;  2OQM A;  5DQZ A;  2BO8 A;  2H8A A;  3I0E A;  4EEM A;  3LAY A;  1G8X A;  3I5P A;  2Q9A A;  3OH2 A;  3B71 A;  4B42 A;  2YL1 A;  4U5C E;  4FAP B;  3VF0 A;  3V0L A;  4B2X A;  5L3Q A;  2XMH A;  3JYH A;  4XPY A;  2YVK A;  1FG5 N;  4Z9H A;  2I15 A;  2I5E A;  1OCR C;  3OH1 A;  3JCU Q;  3JYY A;  3M1C B;  2IM8 A;  4CX9 A;  3U2L A;  1ON8 A;  3AG3 C;  1G4U S;  2OOC A;  1HE9 A;  1M2V B;  3HNI A;  3E70 C;  1PCX A;  4FIX A;  4R32 A;  1TWA A;  5CI8 A;  5FZT A;  2I8B A;  1H5S C;  1ZHT A;  3S84 A;  1O7Q A;  2CCY A;  4AYL A;  5L0J A;  2V26 A;  2RIX A;  1TQG A;  2CU2 A;  1Z3I X;  1WTY A;  4H54 A;  3W2W A;  2NPU A;  1ZJ3 A;  4I1M A;  4Z9I A;  2CGE A;  5C4F A;  2LSE A;  4AE4 B;  4BJ6 A;  3OWT A;  3RMV A;  1OCO C;  3TK0 A;  3U2T A;  5C4E A;  3I0L A;  4A4A A;  2VFZ A;  4PK4 A;  1E84 A;  4Y6U A;  3U2X A;  1EQ1 A;  1H7T A;  4JC7 A;  4Y9X A;  3DZA A;  2LFF A;  4UEG A;  4HO9 A;  4FES A;  3NKE A;  3N0T A;  1LE4 A;  3BCV A;  2Y39 A;  1JPJ A;  4YT2 A;  1Q0G A;  2LQG A;  2XLH A;  1VLT A;  1ZW2 A;  1HJL A;  5EJZ A;  3DKA A;  3K8E A;  3B0V C;  4PR9 A;  3U9M A;  1OCC C;  1U0B B;  3V91 A;  3ZF8 A;  3LS1 A;  4MND A;  1G5Z A;  4CJC A;  1HY5 A;  1TVY A;  2NUT A;  2KSF A;  2YQS A;  5DDT A;  4Y7G A;  3SXA A;  1R4T A;  1OKK A;  3L8I A;  1WT3 A;  4U5E E;  2R7O A;  1LI7 A;  3T7M A;  4KC9 A;  3KYI A;  4MW3 A;  3T6J A;  3ATP A;  4BJ5 C;  4B2W A;  5F28 E;  3NRH A;  1G9R A;  2W0V A;  4G0H A;  1XWJ A;  3EFO A;  2OJQ A;  3FMS A;  4JZA A;  1QKR A;  2FAP B;  2A6H F;  4D11 C;  1C02 A;  2IXO A;  2J0A A;  4IRU A;  4RD9 A;  4CIH A;  2YQJ A;  1VIC A;  4CJO A;  2BO7 A;  4FQW A;  1SS9 A;  1YZC A;  3AQB A;  4JD0 A;  2G3V A;  4FRL A;  1LL0 A;  1T01 A;  2JD3 A;  4C7O A;  4MVQ A;  4FRA A;  4Q7C A;  5C1G A;  1VH3 A;  5B1B C;  2R7U A;  4I3M A;  5DLJ A;  3X2Q C;  3SX3 A;  2OCC C;  4P9T A;  1YAU O;  1APC A;  4J30 B;  4D4X A;  2RJ1 A;  4JRZ A;  2XRH A;  3IQ6 A;  3I0G A;  4N6C A;  1LL3 A;  4IJJ A;  2RJ0 A;  1PZY B;  2EIK C;  2GDC A;  1ZU4 A;  2YL7 A;  1Z63 A;  4U5D E;  2F22 A;  1OMZ A;  3L0I A;  2QUP A;  3I0I X;  2ZU7 A;  1H7H A;  1KU2 A;  1LZ7 A;  5KYW A;  5C3D A;  1OXK A;  1ZCT A;  3LW6 A;  3D98 A;  4JE9 A;  3UMH A;  2HS5 A;  3E9V A;  3NMI A;  3SXY A;  4OD5 A;  2WVO A;  5C38 A;  3PHF 2;  1YA9 A;  2R02 A;  4AK9 A;  5CQM X;  2E3D A;  1HW1 A;  1K04 A;  2EIJ C;  4AX2 A;  2A0B A;  5DS5 A;  1M56 C;  3RF3 A;  4HOC A;  2KK1 A;  3W4Y A;  4HEA J;  2ICX A;  1T6U A;  1FO9 A;  1MNE A;  2OKU A;  1CGN A;  1J8M F;  3Q7G A;  3ZIB A;  2L7A A;  2VS3 A;  1FXJ A;  3SXK A;  3ASN C;  1MC3 A;  3PNN A;  4U5F E;  1R7U A;  4C3E A;  2OEF A;  1EI7 A;  4PJN A;  3DI5 A;  5JVE A;  1FRW A;  3W2V A;  3NMK A;  2ZPA A;  3IPM O;  4EWC A;  3CKN A;  3NMJ A;  1OQC A;  2WVN A;  3V8Y A;  1LM3 B;  1UG7 A;  3E25 A;  4AL0 A;  4KNR A;  3SX5 A;  1NMM B;  3I0H A;  5CMG X;  1YP4 A;  3K8D A;  2XME A;  1O3U A;  1V55 C;  4Y62 A;  1HMD A;  1Q0M A;  2WE9 A;  4BEJ A;  4DVZ A;  4EE3 A;  4JTD B;  1TW5 A;  2HZ8 A;  5CMJ A;  3SXZ A;  1H7F A;  1GS9 A;  3ZQV A;  4O6M A;  5EHH A;  5HV9 A;  1VOM A;  3H65 A;  4NY3 A;  1VGU A;  4GEH A;  2ICW G;  3O10 A;  1JR8 A;  2J0X A;  1BR1 A;  3FXH A;  5K0I A;  2XL4 A;  1EKY A;  2GGQ A;  1ZI1 A;  5DDV A;  3AGT A;  1CPQ A;  3U2V A;  2MYS A;  1JVD A;  1WWP A;  2YZS A;  3IHU A;  2JCL A;  1QGQ A;  2VSI A;  3UMK A;  4HO0 A;  3TUL A;  5L6V A;  5T3W A;  3JUJ A;  5JRA A;  4J7Y A;  2VXL A;  2AWY A;  4EKW A;  1WGW A;  1GX4 A;  2O1F A;  5C8R A;  4KNW A;  2J9U A;  4NAN A;  2HSB A;  1LIH A;  2BE5 F;  2YC5 A;  2GGO A;  1LZJ A;  2YWA A;  2XLM A;  1V74 B;  1GQA A;  1SZI A;  2J9V A;  3POV A;  4OIQ F;  4CS9 C;  4DXW A;  4NAK A;  2P6V A;  5L0D A;  2X51 A;  2DYR C;  5EJ1 A;  4XWJ A;  3RQG A;  1Z23 A;  1MP5 A;  4PFO A;  4PJL A;  5FV9 A;  1EZI A;  4EBJ A;  3PMR A;  4WJ0 A;  1ZJP A;  3C8G B;  4BEM J;  2Y3H A;  3S9O A;  1VM8 A;  1H5S A;  3OH0 A;  3B0U X;  1NLX A;  4D0T A;  5AC4 A;  3R7C A;  1XZP A;  1NU9 C;  3VM6 A;  1NZE A;  1H4D A;  1ZJ1 A;  3KKB A;  3U5S A;  2ZXO A;  1D0X A;  3KYJ A;  3DM5 A;  3RKO F;  4G3S A;  1NWG B;  1WAT A;  4AAW A;  3GM2 A;  2A1D D;  3SXD A;  3Q6N A;  1ZHY A;  2VD4 A;  1OXB A;  3DUV A;  3MYI A;  3IOI A;  2P73 A;  2J9W A;  1ZZP A;  4HG6 A;  2RIZ A;  1KTM A;  2Q3T A;  3RQE A;  1ORJ A;  5KYN A;  3U0C A;  2IXP A;  5KYU A;  1RKC A;  5C1L A;  5L0I A;  3V5X A;  4CVH A;  1OW6 A;  4DVY P;  3FAJ A;  3EHN A;  4ZDQ A;  1KNY A;  5AGF A;  4QDL A;  4BJ1 A;  5HSW A;  3AGU A;  1QGS A;  1V54 C;  4C3D A;  4KXO A;  4KNV A;  2WVM A;  4JTC B;  3ZTM A;  1ZDG A;  3USR A;  2AP3 A;  2YC3 A;  5FU0 A;  1BR2 A;  2AU5 A;  2NUP B;  3QW0 A;  4DE7 A;  1RKE B;  2GWW A;  1FOA A;  4JW1 A;  3K1H A;  1H7E A;  1JMW A;  4XPX A;  5JT4 A;  4XPW A;  2Y6P A;  1H5T A;  3V5Y A;  4L6R A;  1VGZ A;  1M2O A;  4D11 A;  1FTS A;  2DGJ A;  2NSG A;  3TOM A;  1VH1 A;  2HV6 A;  1MP4 A;  4O79 A;  1R5I D;  1LKX A;  5BQI A;  5BQG A;  1YYJ A;  1MMD A;  5KYY A;  2R7R A;  4XEF A;  4JEA A;  5B1A C;  2KC3 A;  2IBF A;  2XLW A;  4ASY A;  3JTJ A;  4LDR A;  1D1A A;  2QE9 A;  2P61 A;  1HE1 A;  1T6Q A;  4OIP F;  3SPT A;  2HKV A;  1BDJ B;  2CW0 F;  2E8B A;  2PP4 A;  3EHM A;  1H9T A;  2DI3 A;  1NFN A;  4K1O A;  3V0P A;  2ETS A;  4Z9J A;  2VS4 A;  2W45 A;  1K4V A;  2FFH A;  3F46 A;  1LZI A;  2RD9 A;  3NG1 A;  3T9O A;  2WZF A;  1YDI A;  3CKQ A;  3I0J A;  1I4Y A;  3EG9 B;  3CKO A;  1ZI3 A;  5JS5 A;  2RIY A;  5BUO A;  4AC3 A;  4E18 A;  3O55 A;  4NCQ A;  1G95 A;  1ZJ2 A;  1LI5 A;  3V5Z A;  1FO8 A;  1FMV A;  3N24 A;  4IAQ A;  3V0Q A;  1MMG A;  1PZT A;  1CGM E;  2VXM A;  2I7B A;  3HJC A;  2E87 A;  5J49 A;  1GM5 A;  3T7O A;  3U3B A;  5F5F A;  3LUT B;  2KW3 C;  2A69 F;  2KNH A;  5BQH A;  3S0X A;  2A0U A;  2XL6 A;  3UGP A;  4U5B E;  2ASR A;  3HNL A;  1GWV A;  3LLI A;  3WHN A;  2PGY A;  4LER A;  4U5H A;  4G87 A;  5A6K A;  2VC9 A;  3B0P A;  3IQ5 A;  2XWM A;  4B6I A;  3U3F A;  1YYX A;  2OI5 A;  1XZQ A;  2LD6 A;  1XZ6 A;  3AG1 C;  5JLI A;  3SX8 A;  3OC9 A;  4BPM A;  2ZU9 A;  1ZHZ A;  2YL3 A;  4BG0 A;  3SXE A;  2KQ9 A;  2NUT B;  2HMQ A;  1E2X A;  1WVC A;  1LS4 A;  1MMA A;  1JAF A;  3SNH A;  4KC2 A;  1H5R A;  1MQV A;  1R81 A;  3C18 A;  3LJB A;  2J9B A;  4MVO A;  5BXC A;  3DK5 A;  2D4U A;  2YLD A;  2VS5 A;  3GM1 A;  3EFO B;  1YP3 A;  1BR4 A;  3N2Z B;  3NYJ A;  1Y4C A;  2LP4 A;  1S05 A;  3AG4 C;  2A6E F;  2RJ4 A;  4AYJ A;  2VH3 A;  2V0L A;  3GEH A;  3DWW A;  2X5Z A;  1G93 A;  3VRC A;  3W8H A;  2PX0 A;  1YZA A;  4Y6N A;  4C7O B;  4ULW A;  2H7O A;  3EZI A;  1VYK A;  3GOD A;  2Q7R A;  3S90 A;  2R7S A;  1OKK D;  3H2U A;  3DXJ F;  3SXM A;  4LLC A;  1ZCY A;  1JOG A;  2XXA A;  4J32 B;  5JQQ A;  4P02 A;  5D92 A;  2QNL A;  2WZL A;  3ZG1 A;  3CU0 A;  3RVY A;  4X0R A;  3U0Y A;  1IZM A;  1RXQ A;  3ECS A;  3PKP A;  3GEI A;  1I5N A;  2O1H A;  5AJP A;  1VB5 A;  1ZIZ A;  2HUJ A;  1TR2 A;  3SXB A;  3U9J A;  2L81 A;  2WVQ A;  2QY9 A;  5KYW B;  2EPO A;  1QZX A;  3A11 A;  3SX7 A;  2J0W A;  3HNK A;  3V0O A;  1E85 A;  1ZW3 A;  3ST8 A;  4CS9 A;  2RJ8 A;  1AUE A;  3T6B A;  3JUK A;  3HTK C;  2D7R A;  1G3L A;  2FYC B;  4KPX A;  4NTA A;  1SMY F;  1G8O A;  2AEC A;  2G62 A;  4UDV A;  3GUE A;  3NKD A;  2ZXR A;  1GA8 A;  2ZD9 A;  1H3M A;  2AE7 A;  3TQD A;  3DJN B;  2A8W A;  2AM5 A;  2R03 A;  3DAF A;  2VCC A;  4HO3 A;  4XQ1 A;  4KRV A;  4J18 A;  1U6H A;  1O7O A;  2FYA A;  3HLZ A;  3S27 A;  4MW8 A;  4I44 A;  1VMA A;  2ZXP A;  3S29 A;  2EIL C;  3RYL A;  1E83 A;  2CDQ A;  3NGW A;  2Y69 C;  4N4W A;  5L0C A;  4KNX A;  4EUK B;  2W4B A;  4FRE A;  3FOQ A;  4Y7F A;  3M15 A;  3OA1 A;  2VCB A;  4KC4 A;  3ZSU A;  2X5S A;  5C36 A;  1G1L A;  3OAM A;  2X65 A;  1D1C A;  3OKR A;  5I1F A;  2EPM X;  2AWC A;  3D5N A;  1M57 C;  3U0X A;  2EIN C;  4KT7 A;  2W0W A;  1VTM P;  2XS8 A;  1VGW A;  1FNT c;  3EQL F;  4IRP A;  2MWQ A;  3N9W A;  3F1C A;  2XSE A;  3KL4 A;  1HMO A;  4E17 A;  2MHR A;  1MP3 A;  1RJ9 A;  1D1B A;  2CNW A;  1S4O A;  2LCH A;  2CNW D;  3K7D A;  5L3V A;  4IWB A;  4NC3 A;  1V84 A;  2YQH A;  3K6B A;  3RMW A;  3HKK A;  3QZC A;  2FFV A;  4C3B A;  2M4E A;  3S28 A;  1PV3 A;  3OEO A;  3FDQ A;  5EGY A;  2HSQ A;  4YT4 A;  2ICY A;  2AM4 A;  4WGY A;  3JT1 A;  5B3S C;  1O23 B;  1Z90 A;  1FAP B;  4Y63 A;  4BJ6 C;  1Z5Z A;  4G3Q A;  2HJM A;  1TWG A;  2YLI A;  1FFH A;  4EE5 A;  3EE5 A;  3Q4S A;  3R2W A;  5A6A A;  4DOZ A;  3QW1 A;  4EIY A;  3OH4 A;  1TWC A;  2PGV A;  5CQP A;  3E26 A;  3QVZ A;  4B5B A;  4JTA B;  3ZVR A;  3I5Q A;  4GBP A;  4MVZ A;  1FFT C;  2IXN A;  3ZWI A;  4XLP F;  4K6R A;  2IXM A;  5E2Q A;  3CAX A;  1YRO B;  4E0H A;  1H9G A;  5EIY A;  3EGD A;  4HO2 A;  2D0J A;  1H4E A;  5FTV A;  3JSE O;  3X1O A;  5A69 A;  4P6I C;  3JRM O;  3CSK A;  2RJ9 A;  5CMH A;  4NTB A;  3JSZ A;  1LL2 A;  3FWW A;  2B0J A;  3G4X A;  3U8P A;  1LVW A;  2X60 A;  4ASJ A;  3IEE A;  2AM3 A;  4JJG A;  1H5S B;  4WGZ A;  2R7X A;  2D5R B;  1WT0 A;  2XWL A;  1JPN A;  1QLE C;  3LES A;  3GAN A;  3V0N A;  4C2S A;  1QVX A;  4DBR A;  3RH3 A;  5CQN X;  1D0Z A;  1M6T A;  4JCH A;  2P7V A;  2X0C A;  3ZGG A;  3GWL A;  1Q0F A;  1V82 A;  1Q0K A;  2TMV P;  2OEG A;  2OJE D;  2BO4 A;  4E1K A;  5CQO A;  5HS2 A;  3C8Z A;  2PFD A;  4XLN F;  1ZDF A;  3ZGF A;  4MQ9 F;  2QH5 A;  4U9D A;  3JRT A;  1ZCV A;  3I4U A;  1PD1 A;  2RJ6 A;  2WEE A;  5IFY A;  2JX0 A;  5L6S A;  2JCK A;  4LDQ A;  5KYU B;  2WZG A;  4K7B A;  1A0B A;  3LS0 A;  5E3C A;  1H5S D;  1RMV A;  1RCP A;  4ARW A;  5E3A A;  2PBE A;  4M28 A;  4MVM A;  2YQC A;  4G3P A;  1AVO B;  1TFO B;  2XLO A;  3KIA A;  1JYL A;  1ZCU A;  2HJ3 A;  3G4Z A;  3TZT A;  4EEG A;  2J45 A;  3QTH A;  3F47 A;  1PD0 A;  2J7P A;  4IAR A;  2YRF A;  3C7J A;  3KMI A;  2J7P D;  2BL2 A;  3CKJ A;  4EBB A;  4O6Y A;  3UNG C;  2UX8 A;  2YES A;  5IDS A;  2FFU A;  5F5H A;  2WGZ A;  1JV3 A;  3OGZ A;  2AGD A;  1QPU A;  1H5T B;  4M63 A;  1Z7Q c;  5FUH A;  2LFD A;  3Q6M A;  4EE4 A;  4IGG A;  1YAR O;  4CSA C;  2HV7 A;  1NFO A;  2R7Q A;  2XLE A;  4JIS A;  5KYY B;  4IB4 A;  1WN0 A;  3AOU A;  1DOW A;  5CMI A;  2H7V C;  4YL1 A;  3RW0 A;  2BC5 A;  3CZ6 A;  3IOH A;  1JRA A;  2I5K A;  1I52 A;  2BO6 A;  4AL1 A;  3ZLL A;  2Z86 A;  4RDA A;  1NQI B;  3QMK A;  4BJ5 A;  1LS1 A;  4IAO A;  5COG A;  1VGT A;  2EPK X;  1G4W R;  5GPG B;  3UGO A;  1S4P A;  3V7O A;  3EGX A;  2LK4 A;  1S7Z A;  1H7L A;  1OW7 A;  1VZT A;  4MTO A;  5KYX A;  1L3P A;  2VCA A;  2R9R B;  3CKV A;  4CJG A;  1QG8 A;  2Z15 A;  1H7Q A;  2UUI A;  5TJ5 E;  3I0K A;  4MVU A;  3D8V A;  2C04 A;  4NAL A;  3AQC A;  2Y4J A;  4WAB A;  4OIR F;  5JP7 A;  2XL8 A;  3A9C A;  2OG2 A;  5DS4 A;  2QLA A;  4D0Z A;  2OU6 A;  5IDT A;  3I0D A;  4BJT A;  4JCZ A;  4BMA A;  4XTK A;  2Q00 A;  3R3I A;  4CDY A;  4CS8 C;  3ZC4 A;  4HE8 D;  1FMW A;  1H7G A;  1OR3 A;  3ITF A;  5AJO A;  1OR2 A;  1G2V A;  4CJ8 A;  3V8Z A;  4ER9 A;  2P1A A;  4JVS A;  1TW1 A;  4MYB A;  1T5O A;  3EZH A;  1WT1 A;  2FY7 A;  1NSG B;  1WOL A;  3MYF A;  1ZU5 A;  3ABL C;  3C63 A;  4MTF A;  1W77 A;  5CMF X;  2V0K A;  3SP1 A;  4FRB A;  1IW7 F;  2Q9B A;  4IRQ A;  3ZTZ A; 
#chains in the Genus database with same CATH homology
 3NDB B;  2WZL A;  1V83 A;  3ZG1 A;  3CU0 A;  4X0R A;  2H7B A;  4EWC A;  3POL A;  4HFF B;  3U0Y A;  3CKN A;  1J8Y F;  1IZM A;  1H4C A;  2WVN A;  3V8Y A;  2NG1 A;  4M4K A;  3ECS A;  1HV9 A;  3E25 A;  3LEV A;  3PKP A;  4QI2 A;  1FGX A;  4P00 A;  4KNR A;  2Y3D A;  4O6N A;  2PA4 A;  2A8U A;  1NMM B;  2O1H A;  2QGI A;  3PKQ A;  5AJP A;  4YWQ A;  3SX5 A;  3I0H A;  2QTV A;  1ZIZ A;  5CMG X;  1G0R A;  1TR2 A;  1YP4 A;  3SXB A;  2L81 A;  2WVQ A;  3K8D A;  2XME A;  1FXO A;  4OD4 A;  1V55 C;  1Z6A A;  2QY9 A;  5KYW B;  1H5R B;  2MZB A;  4B4M A;  1IIN A;  3EGX B;  1QZX A;  2RIT A;  3SX7 A;  4YT8 A;  4Y62 A;  2J0W A;  3V0O A;  4DBQ A;  1QWJ A;  3IOJ A;  1S4N A;  3VYW A;  2WE9 A;  5KYX B;  4BEJ A;  4DVZ A;  4EE3 A;  3DJ4 A;  3ST8 A;  4CS9 A;  2RJ8 A;  1TW5 A;  4KI2 A;  1INJ A;  1ZYR F;  3Q7L A;  3T6B A;  3JUK A;  2JCJ A;  5CMJ A;  3HTK C;  1H7F A;  2D7R A;  1G3L A;  2FYC B;  4KPX A;  4O6M A;  4PJM A;  1SMY F;  5EHH A;  2R7V A;  1TWH A;  1G8O A;  2AEC A;  5CQL X;  2G62 A;  4JJF A;  1VOM A;  3LNR A;  3H65 A;  3GUE A;  4NY3 A;  1VGU A;  2W9Y A;  2WVK A;  3SXG A;  3NKD A;  1NHE B;  4Y64 A;  4GEH A;  1VZX A;  2ZXR A;  3W8I A;  5FYE A;  4KQL A;  1GA8 A;  1JVG A;  1H3M A;  2J0X A;  5FCL A;  1BR1 A;  3TD7 A;  2Y4K A;  1SF8 A;  2AE7 A;  1NU7 D;  2XL4 A;  3TQD A;  3DJN B;  1W55 A;  2A8W A;  2AM5 A;  3RIP A;  2GGQ A;  3EG9 A;  1FWY A;  3DAF A;  1ZI1 A;  2C0N A;  3SYN A;  1O5H A;  4HO3 A;  5DDV A;  4KRV A;  3U2V A;  4J18 A;  2MYS A;  1JVD A;  1WSZ A;  3V90 A;  1OMX A;  2W4M A;  2QKX A;  5C3A A;  2YZS A;  1O7O A;  2FYA A;  3HLZ A;  2ZXW C;  2DYS C;  2VB6 A;  1IIM A;  3S27 A;  1NKH B;  2JCL A;  1QGQ A;  4LAC B;  1ZJ0 A;  2VSI A;  4I44 A;  3UMK A;  4HO0 A;  1VMA A;  2G3K A;  5L6V A;  2ZXP A;  3S29 A;  2R7T A;  5C4B A;  2EIL C;  5T3W A;  3RYL A;  1LZ0 A;  1ON6 A;  3JUJ A;  4ECM A;  1INI A;  2VXL A;  2CDQ A;  4NAI A;  3NGW A;  2Y69 C;  1VPA A;  2XXA B;  3UMI A;  3MLG A;  4KNX A;  1ZJO A;  4FRE A;  2W4B A;  1WGW A;  4F4B A;  4G7H F;  1GX4 A;  4I1O B;  3FOQ A;  2O1F A;  4MIX A;  2AES A;  5C8R A;  4KNW A;  2J9U A;  1VZU A;  4M2A A;  4P02 A;  4NAN A;  4Y7F A;  2V3C C;  3OA1 A;  4KBL A;  3Q7U A;  2BE5 F;  4KC4 A;  1R82 A;  2YC5 A;  2GGO A;  3ZSU A;  3UR3 C;  3BRK X;  1VK5 A;  3CQZ A;  2X5S A;  3EH1 A;  1LZJ A;  2Y4M A;  3HL3 A;  5C36 A;  1G1L A;  4M2B A;  1SZI A;  2J9V A;  3ABM C;  4PJJ A;  3POV A;  4CBE A;  4OIQ F;  2FYB A;  3OAM A;  4CS9 C;  2X65 A;  1ZHJ A;  4OIN F;  1D1C A;  3OKR A;  4NAK A;  4B2W A;  2P6V A;  5I1F A;  4DEC A;  4Y7T A;  2RJ7 A;  3D5N A;  2X51 A;  2DYR C;  3EJN A;  1TZF A;  5EJ1 A;  1M57 C;  4CS7 A;  2EIN C;  4XWJ A;  1G97 A;  1OCZ C;  3U0X A;  1Z23 A;  2P6W A;  1MP5 A;  4KT7 A;  4PFO A;  2OI6 A;  2W0W A;  3I0C A;  4PJL A;  1M2V A;  1VGW A;  3EQL F;  4IRP A;  5FV9 A;  2MWQ A;  2R7W A;  5C47 A;  3DAG A;  4ZLC A;  3N9W A;  4HO6 A;  4HO8 A;  1EZI A;  4K0D A;  3F1C A;  3F1Y A;  2EIM C;  2XSE A;  3KL4 A;  1R7X A;  3QVB A;  3PMR A;  1ZI5 A;  4WJ0 A;  1ZJP A;  4LW6 A;  1MP3 A;  1RJ9 A;  3WOD F;  1D1B A;  2CNW A;  2NUP A;  1S4O A;  2Y3H A;  2ZU8 A;  4FWV A;  2VAS A;  1VM8 A;  2CNW D;  3K7D A;  2RJ5 A;  4FCU A;  5L3V A;  4IWB A;  2APC A;  1H5S A;  3OH0 A;  3B0U X;  1V84 A;  4D0T A;  2YQH A;  4OIO F;  5C3D A;  3K6B A;  3FHD A;  3RMW A;  2Q4J A;  1O0R A;  3K1I C;  2O1G A;  1VYI A;  4AE4 A;  1W57 A;  3QZC A;  2A68 F;  2Y3B A;  2D7I A;  1NU9 C;  2FFV A;  1ZHX A;  1XHB A;  4D48 A;  3DD7 A;  1NZE A;  4XWI A;  3DM9 B;  4C3B A;  2V0I A;  1GQ9 A;  1H4D A;  2M4E A;  1ZJ1 A;  3S28 A;  3KKB A;  2J46 A;  2AH9 A;  2ZXO A;  4Q4Z F;  3OEO A;  4KPZ A;  1D0X A;  3FDQ A;  3DM5 A;  3O39 A;  3RKO F;  5EGY A;  4G3S A;  1NWG B;  4YT4 A;  1E5K A;  2ICY A;  4AAW A;  2AM4 A;  2P72 A;  2A1D D;  4O7G A;  3WG7 C;  3JT1 A;  5B3S C;  1O23 B;  1Z90 A;  2C03 A;  3SXD A;  3Q6N A;  1ZHY A;  4G7Z F;  4BJ6 C;  4Y63 A;  1Z5Z A;  5C3B A;  4G3Q A;  4HCQ A;  3ABK C;  3Q80 A;  1JYK A;  5D91 A;  1TWG A;  5DQZ A;  2VD4 A;  2BO8 A;  3DUV A;  3IOI A;  4EEM A;  3I0E A;  1FFH A;  3U2U A;  2PX7 A;  1JV1 A;  2P73 A;  2J9W A;  3LAY A;  1G8X A;  3I5P A;  2Q9A A;  3OH2 A;  4B42 A;  4HG6 A;  4U5C E;  2RIZ A;  2Q3T A;  4EE5 A;  1O87 A;  3EE5 A;  3Q4S A;  3R2W A;  3V0L A;  4B2X A;  3MX3 A;  5KYN A;  5L3Q A;  3ZLK A;  4DOZ A;  2XMH A;  2IXP A;  5KYU A;  3SEO A;  3OH4 A;  3JYH A;  4R7P A;  1TWC A;  5C1L A;  2PGV A;  4W8K A;  5CQP A;  3E26 A;  4CVH A;  4DVY P;  4B5B A;  2O9X A;  3FAJ A;  3I5Q A;  3ZVR A;  1FG5 N;  4GBP A;  3EHN A;  2I5E A;  1FFT C;  4ZDQ A;  1OCR C;  2IXN A;  3JCU Q;  4XLP F;  4QDL A;  4BJ1 A;  3OH1 A;  4K6R A;  2IXM A;  4YJW A;  5E2Q A;  3M1C B;  5HSW A;  1QGS A;  1ON8 A;  1YRO B;  3AG3 C;  1V54 C;  4C3D A;  4U5G A;  1ZI4 A;  5EIY A;  4KXO A;  4KNV A;  2V0H A;  3EGD A;  2WVM A;  3V0N A;  1M2V B;  4ANJ A;  1ZDG A;  4HO2 A;  3E70 C;  2D0J A;  1H4E A;  1PCX A;  4FIX A;  3USR A;  5C1H A;  5FTV A;  1TWA A;  5CI8 A;  3X1O A;  4EEO A;  2I8B A;  4P6I C;  1H5S C;  2YC3 A;  1ZHT A;  3CSK A;  2RJ9 A;  1O7Q A;  5CMH A;  3JSZ A;  3FVY A;  1LL2 A;  3FWW A;  2B0J A;  4AYL A;  2Q9B A;  4FRQ A;  4GYT A;  5FU0 A;  1BR2 A;  2V26 A;  4A2N B;  1LVW A;  1RJ9 B;  1FR8 A;  2NUP B;  2X60 A;  3IEE A;  4ASJ A;  3USQ A;  1R7V A;  4DE7 A;  2RIX A;  2CU2 A;  2AM3 A;  1Z3I X;  4JJG A;  1H5S B;  3W2W A;  2R7X A;  1FOA A;  2D5R B;  4I1M A;  3DMD A;  1ZJ3 A;  1WT0 A;  4JW1 A;  2CGE A;  1MND A;  2XWL A;  1JPN A;  5C4F A;  1QLE C;  3LES A;  3GAN A;  3K1H A;  2LSE A;  4AE4 B;  4BJ6 A;  3OWT A;  1H7E A;  4KC1 A;  3SZR A;  1OCO C;  3RMV A;  2Y6P A;  3U2T A;  4C2S A;  1H5T A;  5C4E A;  4DBR A;  3I0L A;  3RH3 A;  2VFZ A;  5CQN X;  1D0Z A;  4JCH A;  2P7V A;  1VGZ A;  1M2O A;  4D11 A;  1FTS A;  2DGJ A;  4PK4 A;  4Y6U A;  1HM9 A;  2Q9C A;  2DPW A;  3U2X A;  3ZGG A;  1VH1 A;  3AG2 C;  3K33 A;  2HV6 A;  2L9J A;  1HM0 A;  1MP4 A;  1H7T A;  4O79 A;  1V82 A;  2WAW A;  3U2W A;  2OEG A;  4Y9X A;  2V0J A;  2WB7 A;  3DZA A;  3K66 A;  2BO4 A;  1HM8 A;  5CQO A;  1LKX A;  4E1K A;  5HS2 A;  1HJJ A;  4UEG A;  4FRM A;  4HO9 A;  4FES A;  4PFP A;  3NKE A;  2PFD A;  3N0T A;  1MMD A;  4XLN F;  5KYY A;  3BCV A;  2R7R A;  1ZDF A;  4MQ9 F;  2VSH A;  4FRH A;  3ZGF A;  1KWS A;  2Y39 A;  2QH5 A;  5B1A C;  1JPJ A;  4ASY A;  4YT2 A;  4CSA A;  1D1A A;  4LLE A;  4ZLD A;  3JTJ A;  3JRT A;  1ZCV A;  3I4U A;  1PD1 A;  4L41 C;  4OIP F;  5DQT A;  2RJ6 A;  3SPT A;  4JUR I;  2WEE A;  3OH3 A;  5IFY A;  4FRD A;  2FYD B;  1HJL A;  2JCK A;  5L6S A;  5EJZ A;  5CI9 A;  5KYU B;  2WZG A;  2CW0 F;  4EEA A;  1NF5 B;  3K8E A;  2E8B A;  4K7B A;  2PP4 A;  3EHM A;  4FX5 A;  3B0V C;  3V91 A;  3LS0 A;  1OCC C;  3T4R A;  3ZF8 A;  5C49 A;  5C4D A;  4G7O F;  3LS1 A;  3V0P A;  4MND A;  5E3C A;  3RFY A;  1H5S D;  2VS4 A;  4CJC A;  2W45 A;  1TVY A;  1K4V A;  4ARW A;  1ST6 A;  2FFH A;  3F46 A;  2NUT A;  1LZI A;  2WVL A;  2YQS A;  5DDT A;  5E3A A;  4Y7G A;  3NG1 A;  3SXA A;  3NYM A;  5IY5 C;  2WZF A;  1OKK A;  4M28 A;  4YS8 A;  2YQC A;  1WT3 A;  3CKQ A;  3I0J A;  4G3P A;  3EGD B;  4U5E E;  3EG9 B;  4LW3 A;  3CKO A;  2R7O A;  1ZI3 A;  2KGO A;  2RIY A;  3KIA A;  3KH2 A;  4KC9 A;  5BUO A;  1JYL A;  3T7M A;  4AC3 A;  1D0Y A;  1ZCU A;  4HO4 A;  5C48 A;  3TZT A;  4EEG A;  1G95 A;  2J45 A;  3T6J A;  1ZJ2 A;  1ZHW A;  4YT5 A;  3F47 A;  1PD0 A;  4BJ5 C;  1R80 A;  2J7P A;  4QI0 A;  2Z87 A;  4H4K C;  1FO8 A;  1FMV A;  3N24 A;  1FZW A;  3KMI A;  2J7P D;  3NRH A;  1MMG A;  1G9R A;  1PZT A;  2IYL D;  2W0V A;  3V0Q A;  3T7N A;  3LLK A;  4G0H A;  3EFO A;  2VXM A;  3CKJ A;  4EBB A;  4O6Y A;  3UNG C;  2UX8 A;  4JZA A;  2YES A;  5IDS A;  2I7B A;  2FFU A;  4D11 C;  2A6H F;  5F5H A;  3HJC A;  3CGX A;  4CJB A;  2IXO A;  1FR9 A;  2J0A A;  2WGZ A;  2E87 A;  5J49 A;  3T7O A;  1JV3 A;  5F5F A;  1R7Y A;  3OGZ A;  4IRU A;  4RD9 A;  2KW3 C;  4CIH A;  2A69 F;  2AGD A;  2OI7 A;  3VAY A;  1H5T B;  2KNH A;  2NXV A;  4M63 A;  2YQJ A;  5DS6 A;  3S0X A;  1VIC A;  2BO7 A;  3UGP A;  4FQW A;  5FUH A;  4N06 A;  1SS9 A;  3Q6M A;  4EE4 A;  3AQB A;  4U5B E;  5T3T A;  4JD0 A;  2G3V A;  4FRL A;  5E33 A;  4CSA C;  2HV7 A;  1GWV A;  1LVK A;  1G23 A;  1LL0 A;  2JD3 A;  4C7O A;  4FRA A;  2R7Q A;  3LLI A;  5T1D B;  4Q7C A;  2PGY A;  5C1G A;  4LER A;  4JIS A;  1VH3 A;  4U5H A;  5B1B C;  2R7U A;  4I3M A;  4G87 A;  5KYY B;  3B0P A;  2GFH A;  5DLJ A;  4CS8 A;  2YEV A;  3X2Q C;  3SX3 A;  2YHS A;  5CMI A;  2OCC C;  2Y4L A;  2XWM A;  4B6I A;  4J30 B;  2RJ1 A;  2YCM A;  2XRH A;  1FGG A;  3I0G A;  2H7V C;  1LL3 A;  2XWN A;  4IJJ A;  2RJ0 A;  4HFK B;  3CZ6 A;  3DJU B;  3IOH A;  1PZY B;  2Y7A A;  2I5K A;  2OI5 A;  1XZ6 A;  2EIK C;  3AG1 C;  3SX8 A;  1I52 A;  3OC9 A;  1TKN A;  3L34 A;  1ZU4 A;  2BO6 A;  2ZU9 A;  1ZHZ A;  1Z63 A;  4BG0 A;  3ZLL A;  2Z86 A;  3SXE A;  4U5D E;  1OMZ A;  4RDA A;  1NQI B;  2KQ9 A;  3O6X A;  3QMK A;  3L0I A;  1LS1 A;  4IAO A;  4BJ5 A;  2NUT B;  1GX0 A;  4FRP A;  2WL8 A;  1VGT A;  4Y7U A;  4FRO A;  3I0F A;  4DDZ A;  1WVC A;  3I0I X;  2ZU7 A;  1H7H A;  1KU2 A;  1MMA A;  1LZ7 A;  4FCE A;  3UGO A;  3SNH A;  1MMN A;  1W2W A;  5KYW A;  1H5R A;  3V7O A;  3EGX A;  1S4P A;  1WT2 A;  4KC2 A;  1S7Z A;  1H7L A;  2KJG A;  2FGY A;  2PF4 E;  1VZT A;  1ZCT A;  1R81 A;  4E7S A;  3LW6 A;  5DVW A;  3SXC A;  3EPV A;  5KYX A;  2JCO A;  3LJB A;  3D98 A;  5C4C A;  4B3U A;  3CKV A;  3UMH A;  5BXC A;  3DK5 A;  4FIY A;  1N1C A;  2VS5 A;  1GQC A;  1QG8 A;  3E9V A;  2Z15 A;  3EFO B;  1H7Q A;  3ASO C;  3NYL A;  1BR4 A;  2WVO A;  4OD5 A;  1YP3 A;  3I0K A;  5FU8 A;  5C38 A;  3N2Z B;  3D8V A;  3PHF 2;  2C04 A;  3V0M A;  3NYJ A;  4NAL A;  3AQC A;  2Y4J A;  2VK9 A;  4Y7V A;  4AK9 A;  5CQM X;  4OIR F;  2PX3 A;  2E3D A;  2J0B A;  1R7T A;  2OG2 A;  3AG4 C;  5DS4 A;  2EIJ C;  2A6E F;  4AX2 A;  5FTS A;  4D0Z A;  2RJ4 A;  4AYJ A;  2VH3 A;  3I0D A;  5IDT A;  2V0L A;  1GWW A;  4BJT A;  3RSB A;  4BMA A;  4XTK A;  2X5Z A;  5DS5 A;  1G93 A;  1M56 C;  4HOC A;  4B4B A;  3R3I A;  4CS8 C;  3ZC4 A;  4HE8 D;  1FMW A;  3W8H A;  1H7G A;  3ITF A;  3O3P A;  4HEA J;  2PX0 A;  2ICX A;  4YN0 B;  4Y6N A;  4E7Z A;  1FO9 A;  4C7O B;  5AJO A;  1MNE A;  2H7O A;  4ULW A;  1G2V A;  3V8Z A;  4CJ8 A;  3EZI A;  1VYK A;  3GOD A;  4JVS A;  1TW1 A;  1J8M F;  4MYB A;  3Q7G A;  3B9Q A;  1EYR A;  3EZH A;  3ZIB A;  1WT1 A;  2FY7 A;  2VS3 A;  2R7S A;  2Y3G A;  1FXJ A;  1OKK D;  3EH2 A;  1NG1 A;  3ASN C;  1MC3 A;  4RBN A;  3DXJ F;  3PNN A;  4U5F E;  1R7U A;  5AJN A;  4EVW A;  4LLC A;  4B4G A;  4C3E A;  1ZU5 A;  3ABL C;  2OEF A;  1YP2 A;  4BQH A;  2IOQ A;  4Q5S F;  1W77 A;  2V0K A;  4PJN A;  5CMF X;  1ZCY A;  3SP1 A;  1OQM B;  1FRW A;  2XXA A;  4HO5 A;  4J32 B;  3W2V A;  4FRB A;  5JQQ A;  1IW7 F;  2ZPA A;  4IRQ A;  5D92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...