1H4CA

Biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
188
Chain Sequence
MTTITGVVLAGGKARAMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of the Molybdenum Cofactor Biosynthesis Protein Moba
pubmed doi rcsb
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN A
molecule tags Molybdenum cofactor biosynthesis
source organism Escherichia coli
total genus 58
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h4cA00
4HO5A 2RIYA 4B5BA 5FTVA 1O7OA 3E25A 3U0XA 1H7LA 1VM8A 1H7EA 4AC3A 5L6SA 1QGQA 3CKVA 1ZIZA 5IDTA 1MC3A 4EE3A 2BO8A 2Y4KA 1G95A 5CMGX 4K6RA 2P73A 1G0RA 4B4MA 5I1FA 1E5KA 4ZDQA 3SX8A 3ZGGA 1IINA 1S4PA 5FYEA 4KT7A 5FV9A 2WVMA 2V0KA 1ZI5A 1LL2A 2O1GA 1H3MA 2FYCB 3ZGFA 2RJ0A 4NAIA 2BO6A 1LZJA 5FU0A 3SX7A 1W77A 2AE7A 4FREA 1VGZA 1GA8A 3PKQA 3V0LA 4IRPA 1V82A 3SPTA 2AGDA 4FRHA 1HM9A 1WT3A 2GGQA 1VICA 2OEGA 2FYAA 2W0WA 4M28A 4Y7TA 2W0VA 4D0TA 3CKNA 3IOHA 3D98A 2A8UA 2RJ1A 4NAKA 3V90A 1H5RB 2YC3A 2XWLA 1YP4A 1R82A 1LZ7A 4D0ZA 3O3PA 1TZFA 2JCLA 3ZF8A 1IIMA 1G2VA 1FO9A 3OH2A 2AM3A 1TVYA 4M2BA 2Y6PA 4ARWA 2VXMA 1O0RA 1H5SA 4G3QA 3SXDA 3E26A 2V0HA 3V91A 3OH4A 3I0FA 5CQMX 3ZLKA 3U2VA 2P6WA 3JUJA 3QVBA 2AM5A 2RJ6A 4HO0A 2FYBA 1G23A 1R81A 3FWWA 1S4OA 4B42A 1WSZA 4B4BA 4KXOA 4GBPA 1O7QA 4KNRA 4EE5A 4JD0A 3I0EA 1XZ6A 4P00A 1MP3A 5C1LA 2AECA 2P72A 4D11C 3F1CA 1QWJA 1NHEB 2YQJA 4FRLA 5CQPA 1WVCA 5AJNA 3U2WA 2PGYA 1GX4A 2VSIA 1WT2A 4FRBA 3Q4SA 3CKOA 3I0IX 5EJ1A 1VGWA 2XWNA 3GUEA 2D0JA 1VZUA 1FO8A 2VFZA 2O1HA 1ON6A 3LW6A 3SXCA 4EEMA 3V0NA 2DPWA 1V84A 3R2WA 4M2AA 5CQOA 1O23B 3Q80A 2YQCA 2YC5A 3FOQA 1WT0A 5AJOA 4G87A 1ZI3A 3OAMA 1YP2A 4EEOA 5C38A 5IFYA 3OH3A 1HV9A 3DUVA 1PZTA 3D5NA 3DK5A 2X60A 4LW3A 2X5SA 1H5SB 1GQCA 5FUHA 3CGXA 3SXAA 1LZ0A 1MP5A 1G1LA 2ICYA 2WGZA 4CVHA 5CMJA 4P02A 3ST8A 1JV3A 5CMIA 4DDZA 1ZJ2A 3SXBA 1OQMB 1JYKA 2ZU9A 5C1HA 1VH3A 3F1YA 3OH1A 2ZU8A 3IOJA 4FCUA 1NKHB 2RJ9A 4KC1A 2V0LA 1HJJA 3T7NA 4Y64A 1QG8A 4HO6A 4B2XA 1ZCYA 3OC9A 2PGVA 1FGGA 1ZJ3A 1Z90A 3USRA 5C8RA 5FTSA 3I0CA 5CQLX 1HJLA 2Y7AA 4KRVA 3N9WA 1H7HA 1FOAA 2AH9A 5CQNX 4HO4A 3BRKX 1YP3A 1EYRA 3JUKA 4FRQA 2VS5A 5HS2A 1ZDGA 1GWWA 2YCMA 2FY7A 3I0GA 1HM8A 3OH0A 1JVGA 4G3SA 4CJBA 2QH5A 4ASYA 3U2UA 2GGOA 4C2SA 2VXLA 5JQQA 1W55A 3DJ4A 3USQA 1OMZA 3I0HA 4CJ8A 5C4FA 3D8VA 1VPAA 1FRWA 4LW6A 1VZTA 2RJ8A 3I0KA 2JCJA 3V0QA 2A8WA 1R7UA 4L41C 1V83A 3TQDA 2RIZA 2O1FA 4KPZA 2WEEA 1LL3A 4Y7GA 1INIA 3BCVA 2D7IA 1FR8A 5C48A 2OEFA 1TW5A 3V0PA 1FXOA 4FRAA 4B4GA 2RJ7A 1VGTA 1R7VA 1YROB 4Y7FA 5FU8A 1NMMB 1ZJ1A 4AYJA 1FR9A 2RJ5A 2I5EA 1INJA 3OKRA 2I7BA 4MYBA 4AYLA 1H5SD 2JCKA 2PA4A 5J49A 4HO3A 3Q7UA 3U0YA 1H7GA 1H4DA 1K4VA 3RSBA 1OMXA 4BMAA 1ZJ0A 2OI6A 5DDVA 1H5TA 5C3BA 1KWSA 5C3DA 5C1GA 4XWIA 2Z86A 5C3AA 3RMVA 1HM0A 1G3LA 5CMFX 2VS4A 2BO4A 2UX8A 2WE9A 2WAWA 3IOIA 1LL0A 4YS8A 1TW1A 4Y6UA 3CU0A 2AESA 3T7OA 5DDTA 2FYDB 3KIAA 2VD4A 1FXJA 4KC2A 2I5KA 1ZCUA 1EZIA 1FZWA 3V0OA 2E3DA 1WT1A 1NF5B 4CJCA 4DE7A 1H4CA 4HOCA 4B2WA 1ZJPA 2MZBA 2QKXA 2V0JA 2AM4A 3CKQA 2CU2A 2BO7A 2X5ZA 3PNNA 3V0MA 5C49A 1H4EA 2APCA 3PKPA 1VZXA 1G97A 1VGUA 4EEGA 1G9RA 4EVWA 1ON8A 1ZJOA 2Y4MA 1H7FA 3SXGA 1FG5N 2X65A 2XMEA 1H7QA 4KNXA 4R7PA 5L6VA 1GQ9A 1W57A 3SX3A 1JVDA 1ZCTA 1R7YA 2V0IA 5EJZA 4Y7VA 2PX7A 4FQWA 2RITA 4FRMA 4FRPA 1H5TB 2Z87A 5C36A 1FWYA 3R3IA 4JISA 2XMHA 1PZYB 3V8ZA 4Y63A 1G8OA 3NGWA 2NXVA 4M4KA 1I52A 3HL3A 2WVLA 3K8EA 3T7MA 5C4DA 3TZTA 3ZLLA 1JYLA 4Y62A 1ZCVA 5IDSA 2E8BA 5C47A 3U2TA 2VSHA 1NQIB 1R80A 1G93A 4BQHA 3EE5A 1LVWA 2Q4JA 1VH1A 2OI7A 1NWGB 4HO8A 2RJ4A 2OI5A 4FRDA 4HG6A 4NANA 1SS9A 1QGSA 4E1KA 1H5SC 3U2XA 4ASJA 2FFVA 2XWMA 4AAWA 2Y4JA 1H7TA 1FGXA 4Y9XA 4EEAA 1MP4A 1ZDFA 2RIXA 3OGZA 4FCEA 3K8DA 1ZI4A 1S4NA 3I0DA 4EE4A 4Y6NA 3CKJA 3SXEA 4KPXA 4HO9A 1JV1A 4G3PA 4Y7UA 4HCQA 4D48A 4UEGA 4DECA 5C4BA 1LZIA 4HO2A 4MNDA 3V8YA 3I0LA 5C4EA 4D11A 5C4CA 1ZI1A 1R7TA 3JTJA 2D7RA 2JCOA 2Y4LA 1GX0A 2YQSA 5BXCA 3I0JA 5CMHA 4IRQA 2WVKA 4NALA 4B3UA 4ECMA 5AJPA 2VS3A 4KQLA 1GWVA 2YQHA 2QGIA 1ZHJA 2ZU7A 3RMWA 2FFUA 4FROA 5EIYA 2YESA 1R7XA 1H5RA 3SX5A 3POLA 2ICXA 4KC4A 4J18A 1XHBA
chains in the Genus database with same CATH superfamily
4HO5A 2RIYA 4B5BA 5FTVA 1O7OA 3E25A 3U0XA 1H7LA 1VM8A 1H7EA 4AC3A 5L6SA 1QGQA 3CKVA 1ZIZA 5IDTA 1MC3A 4EE3A 2BO8A 2Y4KA 1G95A 5CMGX 4K6RA 2P73A 4O6MA 1G0RA 4B4MA 5I1FA 1E5KA 4ZDQA 3SX8A 3ZGGA 1IINA 1S4PA 5FYEA 4KT7A 5FV9A 2WVMA 4MIXA 2V0KA 1ZI5A 1LL2A 2C0NA 2O1GA 1H3MA 2FYCB 3ZGFA 2RJ0A 4NAIA 2BO6A 1LZJA 5FU0A 3SX7A 1W77A 2AE7A 4FREA 1VGZA 1GA8A 3PKQA 3V0LA 4IRPA 1V82A 3SPTA 2AGDA 4FRHA 1HM9A 1WT3A 2GGQA 1VICA 2OEGA 2FYAA 2W0WA 4M28A 4Y7TA 2W0VA 4D0TA 3CKNA 3IOHA 3D98A 2A8UA 2RJ1A 4NAKA 3V90A 2J0AA 1H5RB 2YC3A 2XWLA 1YP4A 1R82A 1LZ7A 4D0ZA 3O3PA 1TZFA 2JCLA 3ZF8A 1IIMA 1G2VA 1FO9A 3OH2A 2AM3A 1TVYA 4M2BA 2Y6PA 4ARWA 2VXMA 1O0RA 1H5SA 4G3QA 3SXDA 3E26A 2V0HA 3V91A 3OH4A 3I0FA 5CQMX 3ZLKA 3U2VA 2P6WA 3JUJA 2J0BA 3QVBA 2AM5A 2RJ6A 4HO0A 2FYBA 1G23A 1R81A 3FWWA 1S4OA 4B42A 1WSZA 4B4BA 4KXOA 4GBPA 1O7QA 4KNRA 4EE5A 4JD0A 3I0EA 1XZ6A 4P00A 1MP3A 5C1LA 2AECA 2P72A 4D11C 3F1CA 1QWJA 1NHEB 2YQJA 4FRLA 5CQPA 1WVCA 5AJNA 3U2WA 2VK9A 2PGYA 1GX4A 2VSIA 1WT2A 4FRBA 3Q4SA 3CKOA 3I0IX 5EJ1A 1VGWA 2XWNA 3GUEA 2D0JA 1VZUA 1FO8A 2VFZA 2O1HA 1ON6A 3LW6A 3SXCA 4EEMA 5D91A 3V0NA 2DPWA 1V84A 3R2WA 4M2AA 5CQOA 1O23B 3Q80A 2YQCA 2YC5A 3FOQA 1WT0A 5AJOA 4G87A 1ZI3A 3OAMA 1YP2A 4EEOA 5C38A 5IFYA 3OH3A 1HV9A 3DUVA 1PZTA 3D5NA 3DK5A 2X60A 4LW3A 2X5SA 1H5SB 1GQCA 5FUHA 3CGXA 3SXAA 1LZ0A 1MP5A 1G1LA 2ICYA 2WGZA 4CVHA 5CMJA 4P02A 3ST8A 1JV3A 5CMIA 4DDZA 1ZJ2A 3SXBA 1OQMB 1JYKA 2ZU9A 5D92A 5C1HA 1VH3A 3F1YA 3OH1A 2ZU8A 3IOJA 4FCUA 1NKHB 2RJ9A 4KC1A 2V0LA 1HJJA 3T7NA 4Y64A 1QG8A 4HO6A 4B2XA 1ZCYA 4Q7CA 3OC9A 2PGVA 1FGGA 1ZJ3A 1Z90A 3USRA 5C8RA 5FTSA 3I0CA 5CQLX 1HJLA 2Y7AA 4KRVA 3N9WA 1H7HA 1FOAA 2AH9A 4FIYA 5CQNX 4HO4A 3BRKX 1YP3A 1EYRA 3JUKA 4FRQA 2VS5A 5HS2A 1ZDGA 1GWWA 2YCMA 2FY7A 3I0GA 1HM8A 3OH0A 1JVGA 4G3SA 4CJBA 2QH5A 4ASYA 3U2UA 2GGOA 4C2SA 2VXLA 5JQQA 1W55A 3DJ4A 3USQA 1OMZA 3I0HA 4CJ8A 5C4FA 3D8VA 1VPAA 1FRWA 4LW6A 1VZTA 2RJ8A 3I0KA 2JCJA 3V0QA 2A8WA 1R7UA 4L41C 1V83A 3TQDA 2RIZA 2O1FA 4KPZA 2WEEA 1LL3A 4Y7GA 1INIA 3BCVA 2D7IA 1FR8A 5C48A 2OEFA 4FIXA 1TW5A 3V0PA 1FXOA 4FRAA 4B4GA 2RJ7A 1VGTA 1R7VA 1YROB 4Y7FA 5FU8A 1NMMB 1ZJ1A 4AYJA 1FR9A 2RJ5A 2I5EA 1INJA 3OKRA 2I7BA 4MYBA 4AYLA 1H5SD 2JCKA 2PA4A 5J49A 4HO3A 3Q7UA 3U0YA 1H7GA 1H4DA 1K4VA 3RSBA 1OMXA 4BMAA 1ZJ0A 2OI6A 5DDVA 1H5TA 5C3BA 1KWSA 5C3DA 5C1GA 4XWIA 2Z86A 5C3AA 3RMVA 1HM0A 1G3LA 5CMFX 2VS4A 2BO4A 2UX8A 2WE9A 2WAWA 3IOIA 1LL0A 4YS8A 1TW1A 4Y6UA 3CU0A 2AESA 3T7OA 5DDTA 2FYDB 3KIAA 2VD4A 1FXJA 4KC2A 2I5KA 1ZCUA 1EZIA 1FZWA 3V0OA 2E3DA 1WT1A 1NF5B 4CJCA 4DE7A 1H4CA 4HOCA 4B2WA 1ZJPA 2MZBA 2QKXA 2V0JA 2AM4A 3CKQA 2CU2A 2BO7A 2X5ZA 3PNNA 3V0MA 5C49A 1H4EA 2APCA 3PKPA 1VZXA 1G97A 1VGUA 4EEGA 1G9RA 4EVWA 1ON8A 1ZJOA 2Y4MA 1H7FA 3SXGA 1FG5N 2X65A 2XMEA 1H7QA 4KNXA 4R7PA 5L6VA 1GQ9A 1W57A 3SX3A 1JVDA 1ZCTA 1R7YA 2V0IA 5EJZA 4Y7VA 2PX7A 4FQWA 2RITA 4FRMA 4FRPA 1H5TB 2Z87A 5C36A 1FWYA 3R3IA 4JISA 2XMHA 1PZYB 3V8ZA 4Y63A 1G8OA 3NGWA 2NXVA 4M4KA 1I52A 3HL3A 2WVLA 3K8EA 3T7MA 5C4DA 3TZTA 3ZLLA 1JYLA 4Y62A 1ZCVA 5IDSA 2E8BA 5C47A 3U2TA 2VSHA 1NQIB 1R80A 1G93A 4BQHA 3EE5A 1LVWA 2Q4JA 1VH1A 2OI7A 1NWGB 4HO8A 2RJ4A 2OI5A 4FRDA 4HG6A 4NANA 1SS9A 1QGSA 4E1KA 1H5SC 3U2XA 4ASJA 2FFVA 2XWMA 4AAWA 2Y4JA 1H7TA 1FGXA 4Y9XA 4EEAA 1MP4A 1ZDFA 2RIXA 3OGZA 4FCEA 3K8DA 1ZI4A 1S4NA 3I0DA 4EE4A 4Y6NA 3CKJA 3SXEA 4KPXA 4HO9A 1JV1A 4G3PA 4Y7UA 4HCQA 4D48A 4UEGA 4DECA 5C4BA 1LZIA 4HO2A 4MNDA 3V8YA 3I0LA 5C4EA 4D11A 5C4CA 1ZI1A 1R7TA 3JTJA 2D7RA 2JCOA 2Y4LA 1GX0A 2YQSA 5BXCA 3I0JA 5CMHA 4IRQA 2WVKA 4NALA 4B3UA 4ECMA 5AJPA 2VS3A 4KQLA 1GWVA 4O6NA 2YQHA 2QGIA 1ZHJA 2ZU7A 3RMWA 2FFUA 4FROA 5EIYA 2YESA 1R7XA 1H5RA 3SX5A 3POLA 2ICXA 4KC4A 4J18A 1XHBA
chains in the Genus database with same CATH topology
4HO5A 2RIYA 4B5BA 5FTVA 1O7OA 3E25A 3U0XA 1H7LA 1VM8A 1H7EA 4AC3A 5L6SA 1QGQA 3CKVA 1ZIZA 5IDTA 1MC3A 4EE3A 2BO8A 2Y4KA 1G95A 5CMGX 4K6RA 2P73A 4O6MA 1G0RA 4B4MA 5I1FA 1E5KA 4ZDQA 3SX8A 3ZGGA 1IINA 1S4PA 5FYEA 4KT7A 5FV9A 2WVMA 4MIXA 2V0KA 1ZI5A 1LL2A 2C0NA 2O1GA 1H3MA 2FYCB 3ZGFA 2RJ0A 4NAIA 2BO6A 1LZJA 5FU0A 3SX7A 1W77A 2AE7A 4FREA 1VGZA 1GA8A 3PKQA 3V0LA 4IRPA 1V82A 3SPTA 2AGDA 4FRHA 1HM9A 1WT3A 2GGQA 1VICA 2OEGA 2FYAA 2W0WA 4M28A 4Y7TA 2W0VA 4D0TA 3CKNA 3IOHA 3D98A 2A8UA 2RJ1A 4NAKA 3V90A 2J0AA 1H5RB 2YC3A 2XWLA 1YP4A 1R82A 1LZ7A 4D0ZA 3O3PA 1TZFA 2JCLA 3ZF8A 1IIMA 1G2VA 1FO9A 3OH2A 2AM3A 1TVYA 4M2BA 2Y6PA 4ARWA 2VXMA 1O0RA 1H5SA 4G3QA 3SXDA 3E26A 2V0HA 3V91A 3OH4A 3I0FA 5CQMX 3ZLKA 3U2VA 2P6WA 3JUJA 2J0BA 3QVBA 2AM5A 2RJ6A 4HO0A 2FYBA 1G23A 1R81A 3FWWA 1S4OA 4B42A 1WSZA 4B4BA 4KXOA 4GBPA 1O7QA 4KNRA 4EE5A 4JD0A 3I0EA 1XZ6A 4P00A 1MP3A 5C1LA 2AECA 2P72A 4D11C 3F1CA 1QWJA 1NHEB 2YQJA 4FRLA 5CQPA 1WVCA 5AJNA 3U2WA 2VK9A 2PGYA 1GX4A 2VSIA 1WT2A 4FRBA 3Q4SA 3CKOA 3I0IX 5EJ1A 1VGWA 2XWNA 3GUEA 2D0JA 1VZUA 1FO8A 2VFZA 2O1HA 1ON6A 3LW6A 3SXCA 4EEMA 5D91A 3V0NA 2DPWA 1V84A 3R2WA 4M2AA 5CQOA 1O23B 3Q80A 2YQCA 2YC5A 3FOQA 1WT0A 5AJOA 4G87A 1ZI3A 3OAMA 1YP2A 4EEOA 5C38A 5IFYA 3OH3A 1HV9A 3DUVA 1PZTA 3D5NA 3DK5A 2X60A 4LW3A 2X5SA 1H5SB 1GQCA 5FUHA 3CGXA 3SXAA 1LZ0A 1MP5A 1G1LA 2ICYA 2WGZA 4CVHA 5CMJA 4P02A 3ST8A 1JV3A 5CMIA 4DDZA 1ZJ2A 3SXBA 1OQMB 1JYKA 2ZU9A 5D92A 5C1HA 1VH3A 3F1YA 3OH1A 2ZU8A 3IOJA 4FCUA 1NKHB 2RJ9A 4KC1A 2V0LA 1HJJA 3T7NA 4Y64A 1QG8A 4HO6A 4B2XA 1ZCYA 4Q7CA 3OC9A 2PGVA 1FGGA 1ZJ3A 1Z90A 3USRA 5C8RA 5FTSA 3I0CA 5CQLX 1HJLA 2Y7AA 4KRVA 3N9WA 1H7HA 1FOAA 2AH9A 4FIYA 5CQNX 4HO4A 3BRKX 1YP3A 1EYRA 3JUKA 4FRQA 2VS5A 5HS2A 1ZDGA 1GWWA 2YCMA 2FY7A 3I0GA 1HM8A 3OH0A 1JVGA 4G3SA 4CJBA 2QH5A 4ASYA 3U2UA 2GGOA 4C2SA 2VXLA 5JQQA 1W55A 3DJ4A 3USQA 1OMZA 3I0HA 4CJ8A 5C4FA 3D8VA 1VPAA 1FRWA 4LW6A 1VZTA 2RJ8A 3I0KA 2JCJA 3V0QA 2A8WA 1R7UA 4L41C 1V83A 3TQDA 2RIZA 2O1FA 4KPZA 2WEEA 1LL3A 4Y7GA 1INIA 3BCVA 2D7IA 1FR8A 5C48A 2OEFA 4FIXA 1TW5A 3V0PA 1FXOA 4FRAA 4B4GA 2RJ7A 1VGTA 1R7VA 1YROB 4Y7FA 5FU8A 1NMMB 1ZJ1A 4AYJA 1FR9A 2RJ5A 2I5EA 1INJA 3OKRA 2I7BA 4MYBA 4AYLA 1H5SD 2JCKA 2PA4A 5J49A 4HO3A 3Q7UA 3U0YA 1H7GA 1H4DA 1K4VA 3RSBA 1OMXA 4BMAA 1ZJ0A 2OI6A 5DDVA 1H5TA 5C3BA 1KWSA 5C3DA 5C1GA 4XWIA 2Z86A 5C3AA 3RMVA 1HM0A 1G3LA 5CMFX 2VS4A 2BO4A 2UX8A 2WE9A 2WAWA 3IOIA 1LL0A 4YS8A 1TW1A 4Y6UA 3CU0A 2AESA 3T7OA 5DDTA 2FYDB 3KIAA 2VD4A 1FXJA 4KC2A 2I5KA 1ZCUA 1EZIA 1FZWA 3V0OA 2E3DA 1WT1A 1NF5B 4CJCA 4DE7A 1H4CA 4HOCA 4B2WA 1ZJPA 2MZBA 2QKXA 2V0JA 2AM4A 3CKQA 2CU2A 2BO7A 2X5ZA 3PNNA 3V0MA 5C49A 1H4EA 2APCA 3PKPA 1VZXA 1G97A 1VGUA 4EEGA 1G9RA 4EVWA 1ON8A 1ZJOA 2Y4MA 1H7FA 3SXGA 1FG5N 2X65A 2XMEA 1H7QA 4KNXA 4R7PA 5L6VA 1GQ9A 1W57A 3SX3A 1JVDA 1ZCTA 1R7YA 2V0IA 5EJZA 4Y7VA 2PX7A 4FQWA 2RITA 4FRMA 4FRPA 1H5TB 2Z87A 5C36A 1FWYA 3R3IA 4JISA 2XMHA 1PZYB 3V8ZA 4Y63A 1G8OA 3NGWA 2NXVA 4M4KA 1I52A 3HL3A 2WVLA 3K8EA 3T7MA 5C4DA 3TZTA 3ZLLA 1JYLA 4Y62A 1ZCVA 5IDSA 2E8BA 5C47A 3U2TA 2VSHA 1NQIB 1R80A 1G93A 4BQHA 3EE5A 1LVWA 2Q4JA 1VH1A 2OI7A 1NWGB 4HO8A 2RJ4A 2OI5A 4FRDA 4HG6A 4NANA 1SS9A 1QGSA 4E1KA 1H5SC 3U2XA 4ASJA 2FFVA 2XWMA 4AAWA 2Y4JA 1H7TA 1FGXA 4Y9XA 4EEAA 1MP4A 1ZDFA 2RIXA 3OGZA 4FCEA 3K8DA 1ZI4A 1S4NA 3I0DA 4EE4A 4Y6NA 3CKJA 3SXEA 4KPXA 4HO9A 1JV1A 4G3PA 4Y7UA 4HCQA 4D48A 4UEGA 4DECA 5C4BA 1LZIA 4HO2A 4MNDA 3V8YA 3I0LA 5C4EA 4D11A 5C4CA 1ZI1A 1R7TA 3JTJA 2D7RA 2JCOA 2Y4LA 1GX0A 2YQSA 5BXCA 3I0JA 5CMHA 4IRQA 2WVKA 4NALA 4B3UA 4ECMA 5AJPA 2VS3A 4KQLA 1GWVA 4O6NA 2YQHA 2QGIA 1ZHJA 2ZU7A 3RMWA 2FFUA 4FROA 5EIYA 2YESA 1R7XA 1H5RA 3SX5A 3POLA 2ICXA 4KC4A 4J18A 1XHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO5 A;  2RIY A;  4B5B A;  5FTV A;  1O7O A;  3E25 A;  3U0X A;  1H7L A;  1VM8 A;  1H7E A;  4AC3 A;  5L6S A;  1QGQ A;  3CKV A;  1ZIZ A;  5IDT A;  1MC3 A;  4EE3 A;  2BO8 A;  2Y4K A;  1G95 A;  5CMG X;  4K6R A;  2P73 A;  1G0R A;  4B4M A;  5I1F A;  1E5K A;  4ZDQ A;  3SX8 A;  3ZGG A;  1IIN A;  1S4P A;  5FYE A;  4KT7 A;  5FV9 A;  2WVM A;  2V0K A;  1ZI5 A;  1LL2 A;  2O1G A;  1H3M A;  2FYC B;  3ZGF A;  2RJ0 A;  4NAI A;  2BO6 A;  1LZJ A;  5FU0 A;  3SX7 A;  1W77 A;  2AE7 A;  4FRE A;  1VGZ A;  1GA8 A;  3PKQ A;  3V0L A;  4IRP A;  1V82 A;  3SPT A;  2AGD A;  4FRH A;  1HM9 A;  1WT3 A;  2GGQ A;  1VIC A;  2OEG A;  2FYA A;  2W0W A;  4M28 A;  4Y7T A;  2W0V A;  4D0T A;  3CKN A;  3IOH A;  3D98 A;  2A8U A;  2RJ1 A;  4NAK A;  3V90 A;  1H5R B;  2YC3 A;  2XWL A;  1YP4 A;  1R82 A;  1LZ7 A;  4D0Z A;  3O3P A;  1TZF A;  2JCL A;  3ZF8 A;  1IIM A;  1G2V A;  1FO9 A;  3OH2 A;  2AM3 A;  1TVY A;  4M2B A;  2Y6P A;  4ARW A;  2VXM A;  1O0R A;  1H5S A;  4G3Q A;  3SXD A;  3E26 A;  2V0H A;  3V91 A;  3OH4 A;  3I0F A;  5CQM X;  3ZLK A;  3U2V A;  2P6W A;  3JUJ A;  3QVB A;  2AM5 A;  2RJ6 A;  4HO0 A;  2FYB A;  1G23 A;  1R81 A;  3FWW A;  1S4O A;  4B42 A;  1WSZ A;  4B4B A;  4KXO A;  4GBP A;  1O7Q A;  4KNR A;  4EE5 A;  4JD0 A;  3I0E A;  1XZ6 A;  4P00 A;  1MP3 A;  5C1L A;  2AEC A;  2P72 A;  4D11 C;  3F1C A;  1QWJ A;  1NHE B;  2YQJ A;  4FRL A;  5CQP A;  1WVC A;  5AJN A;  3U2W A;  2PGY A;  1GX4 A;  2VSI A;  1WT2 A;  4FRB A;  3Q4S A;  3CKO A;  3I0I X;  5EJ1 A;  1VGW A;  2XWN A;  3GUE A;  2D0J A;  1VZU A;  1FO8 A;  2VFZ A;  2O1H A;  1ON6 A;  3LW6 A;  3SXC A;  4EEM A;  3V0N A;  2DPW A;  1V84 A;  3R2W A;  4M2A A;  5CQO A;  1O23 B;  3Q80 A;  2YQC A;  2YC5 A;  3FOQ A;  1WT0 A;  5AJO A;  4G87 A;  1ZI3 A;  3OAM A;  1YP2 A;  4EEO A;  5C38 A;  5IFY A;  3OH3 A;  1HV9 A;  3DUV A;  1PZT A;  3D5N A;  3DK5 A;  2X60 A;  4LW3 A;  2X5S A;  1H5S B;  1GQC A;  5FUH A;  3CGX A;  3SXA A;  1LZ0 A;  1MP5 A;  1G1L A;  2ICY A;  2WGZ A;  4CVH A;  5CMJ A;  4P02 A;  3ST8 A;  1JV3 A;  5CMI A;  4DDZ A;  1ZJ2 A;  3SXB A;  1OQM B;  1JYK A;  2ZU9 A;  5C1H A;  1VH3 A;  3F1Y A;  3OH1 A;  2ZU8 A;  3IOJ A;  4FCU A;  1NKH B;  2RJ9 A;  4KC1 A;  2V0L A;  1HJJ A;  3T7N A;  4Y64 A;  1QG8 A;  4HO6 A;  4B2X A;  1ZCY A;  3OC9 A;  2PGV A;  1FGG A;  1ZJ3 A;  1Z90 A;  3USR A;  5C8R A;  5FTS A;  3I0C A;  5CQL X;  1HJL A;  2Y7A A;  4KRV A;  3N9W A;  1H7H A;  1FOA A;  2AH9 A;  5CQN X;  4HO4 A;  3BRK X;  1YP3 A;  1EYR A;  3JUK A;  4FRQ A;  2VS5 A;  5HS2 A;  1ZDG A;  1GWW A;  2YCM A;  2FY7 A;  3I0G A;  1HM8 A;  3OH0 A;  1JVG A;  4G3S A;  4CJB A;  2QH5 A;  4ASY A;  3U2U A;  2GGO A;  4C2S A;  2VXL A;  5JQQ A;  1W55 A;  3DJ4 A;  3USQ A;  1OMZ A;  3I0H A;  4CJ8 A;  5C4F A;  3D8V A;  1VPA A;  1FRW A;  4LW6 A;  1VZT A;  2RJ8 A;  3I0K A;  2JCJ A;  3V0Q A;  2A8W A;  1R7U A;  4L41 C;  1V83 A;  3TQD A;  2RIZ A;  2O1F A;  4KPZ A;  2WEE A;  1LL3 A;  4Y7G A;  1INI A;  3BCV A;  2D7I A;  1FR8 A;  5C48 A;  2OEF A;  1TW5 A;  3V0P A;  1FXO A;  4FRA A;  4B4G A;  2RJ7 A;  1VGT A;  1R7V A;  1YRO B;  4Y7F A;  5FU8 A;  1NMM B;  1ZJ1 A;  4AYJ A;  1FR9 A;  2RJ5 A;  2I5E A;  1INJ A;  3OKR A;  2I7B A;  4MYB A;  4AYL A;  1H5S D;  2JCK A;  2PA4 A;  5J49 A;  4HO3 A;  3Q7U A;  3U0Y A;  1H7G A;  1H4D A;  1K4V A;  3RSB A;  1OMX A;  4BMA A;  1ZJ0 A;  2OI6 A;  5DDV A;  1H5T A;  5C3B A;  1KWS A;  5C3D A;  5C1G A;  4XWI A;  2Z86 A;  5C3A A;  3RMV A;  1HM0 A;  1G3L A;  5CMF X;  2VS4 A;  2BO4 A;  2UX8 A;  2WE9 A;  2WAW A;  3IOI A;  1LL0 A;  4YS8 A;  1TW1 A;  4Y6U A;  3CU0 A;  2AES A;  3T7O A;  5DDT A;  2FYD B;  3KIA A;  2VD4 A;  1FXJ A;  4KC2 A;  2I5K A;  1ZCU A;  1EZI A;  1FZW A;  3V0O A;  2E3D A;  1WT1 A;  1NF5 B;  4CJC A;  4DE7 A;  1H4C A;  4HOC A;  4B2W A;  1ZJP A;  2MZB A;  2QKX A;  2V0J A;  2AM4 A;  3CKQ A;  2CU2 A;  2BO7 A;  2X5Z A;  3PNN A;  3V0M A;  5C49 A;  1H4E A;  2APC A;  3PKP A;  1VZX A;  1G97 A;  1VGU A;  4EEG A;  1G9R A;  4EVW A;  1ON8 A;  1ZJO A;  2Y4M A;  1H7F A;  3SXG A;  1FG5 N;  2X65 A;  2XME A;  1H7Q A;  4KNX A;  4R7P A;  5L6V A;  1GQ9 A;  1W57 A;  3SX3 A;  1JVD A;  1ZCT A;  1R7Y A;  2V0I A;  5EJZ A;  4Y7V A;  2PX7 A;  4FQW A;  2RIT A;  4FRM A;  4FRP A;  1H5T B;  2Z87 A;  5C36 A;  1FWY A;  3R3I A;  4JIS A;  2XMH A;  1PZY B;  3V8Z A;  4Y63 A;  1G8O A;  3NGW A;  2NXV A;  4M4K A;  1I52 A;  3HL3 A;  2WVL A;  3K8E A;  3T7M A;  5C4D A;  3TZT A;  3ZLL A;  1JYL A;  4Y62 A;  1ZCV A;  5IDS A;  2E8B A;  5C47 A;  3U2T A;  2VSH A;  1NQI B;  1R80 A;  1G93 A;  4BQH A;  3EE5 A;  1LVW A;  2Q4J A;  1VH1 A;  2OI7 A;  1NWG B;  4HO8 A;  2RJ4 A;  2OI5 A;  4FRD A;  4HG6 A;  4NAN A;  1SS9 A;  1QGS A;  4E1K A;  1H5S C;  3U2X A;  4ASJ A;  2FFV A;  2XWM A;  4AAW A;  2Y4J A;  1H7T A;  1FGX A;  4Y9X A;  4EEA A;  1MP4 A;  1ZDF A;  2RIX A;  3OGZ A;  4FCE A;  3K8D A;  1ZI4 A;  1S4N A;  3I0D A;  4EE4 A;  4Y6N A;  3CKJ A;  3SXE A;  4KPX A;  4HO9 A;  1JV1 A;  4G3P A;  4Y7U A;  4HCQ A;  4D48 A;  4UEG A;  4DEC A;  5C4B A;  1LZI A;  4HO2 A;  4MND A;  3V8Y A;  3I0L A;  5C4E A;  4D11 A;  5C4C A;  1ZI1 A;  1R7T A;  3JTJ A;  2D7R A;  2JCO A;  2Y4L A;  1GX0 A;  2YQS A;  5BXC A;  3I0J A;  5CMH A;  4IRQ A;  2WVK A;  4NAL A;  4B3U A;  4ECM A;  5AJP A;  2VS3 A;  4KQL A;  1GWV A;  2YQH A;  2QGI A;  1ZHJ A;  2ZU7 A;  3RMW A;  2FFU A;  4FRO A;  5EIY A;  2YES A;  1R7X A;  1H5R A;  3SX5 A;  3POL A;  2ICX A;  4KC4 A;  4J18 A;  1XHB A; 
#chains in the Genus database with same CATH topology
 4HO5 A;  2RIY A;  4B5B A;  5FTV A;  1O7O A;  3E25 A;  3U0X A;  1H7L A;  1VM8 A;  1H7E A;  4AC3 A;  5L6S A;  1QGQ A;  3CKV A;  1ZIZ A;  5IDT A;  1MC3 A;  4EE3 A;  2BO8 A;  2Y4K A;  1G95 A;  5CMG X;  4K6R A;  2P73 A;  4O6M A;  1G0R A;  4B4M A;  5I1F A;  1E5K A;  4ZDQ A;  3SX8 A;  3ZGG A;  1IIN A;  1S4P A;  5FYE A;  4KT7 A;  5FV9 A;  2WVM A;  4MIX A;  2V0K A;  1ZI5 A;  1LL2 A;  2C0N A;  2O1G A;  1H3M A;  2FYC B;  3ZGF A;  2RJ0 A;  4NAI A;  2BO6 A;  1LZJ A;  5FU0 A;  3SX7 A;  1W77 A;  2AE7 A;  4FRE A;  1VGZ A;  1GA8 A;  3PKQ A;  3V0L A;  4IRP A;  1V82 A;  3SPT A;  2AGD A;  4FRH A;  1HM9 A;  1WT3 A;  2GGQ A;  1VIC A;  2OEG A;  2FYA A;  2W0W A;  4M28 A;  4Y7T A;  2W0V A;  4D0T A;  3CKN A;  3IOH A;  3D98 A;  2A8U A;  2RJ1 A;  4NAK A;  3V90 A;  2J0A A;  1H5R B;  2YC3 A;  2XWL A;  1YP4 A;  1R82 A;  1LZ7 A;  4D0Z A;  3O3P A;  1TZF A;  2JCL A;  3ZF8 A;  1IIM A;  1G2V A;  1FO9 A;  3OH2 A;  2AM3 A;  1TVY A;  4M2B A;  2Y6P A;  4ARW A;  2VXM A;  1O0R A;  1H5S A;  4G3Q A;  3SXD A;  3E26 A;  2V0H A;  3V91 A;  3OH4 A;  3I0F A;  5CQM X;  3ZLK A;  3U2V A;  2P6W A;  3JUJ A;  2J0B A;  3QVB A;  2AM5 A;  2RJ6 A;  4HO0 A;  2FYB A;  1G23 A;  1R81 A;  3FWW A;  1S4O A;  4B42 A;  1WSZ A;  4B4B A;  4KXO A;  4GBP A;  1O7Q A;  4KNR A;  4EE5 A;  4JD0 A;  3I0E A;  1XZ6 A;  4P00 A;  1MP3 A;  5C1L A;  2AEC A;  2P72 A;  4D11 C;  3F1C A;  1QWJ A;  1NHE B;  2YQJ A;  4FRL A;  5CQP A;  1WVC A;  5AJN A;  3U2W A;  2VK9 A;  2PGY A;  1GX4 A;  2VSI A;  1WT2 A;  4FRB A;  3Q4S A;  3CKO A;  3I0I X;  5EJ1 A;  1VGW A;  2XWN A;  3GUE A;  2D0J A;  1VZU A;  1FO8 A;  2VFZ A;  2O1H A;  1ON6 A;  3LW6 A;  3SXC A;  4EEM A;  5D91 A;  3V0N A;  2DPW A;  1V84 A;  3R2W A;  4M2A A;  5CQO A;  1O23 B;  3Q80 A;  2YQC A;  2YC5 A;  3FOQ A;  1WT0 A;  5AJO A;  4G87 A;  1ZI3 A;  3OAM A;  1YP2 A;  4EEO A;  5C38 A;  5IFY A;  3OH3 A;  1HV9 A;  3DUV A;  1PZT A;  3D5N A;  3DK5 A;  2X60 A;  4LW3 A;  2X5S A;  1H5S B;  1GQC A;  5FUH A;  3CGX A;  3SXA A;  1LZ0 A;  1MP5 A;  1G1L A;  2ICY A;  2WGZ A;  4CVH A;  5CMJ A;  4P02 A;  3ST8 A;  1JV3 A;  5CMI A;  4DDZ A;  1ZJ2 A;  3SXB A;  1OQM B;  1JYK A;  2ZU9 A;  5D92 A;  5C1H A;  1VH3 A;  3F1Y A;  3OH1 A;  2ZU8 A;  3IOJ A;  4FCU A;  1NKH B;  2RJ9 A;  4KC1 A;  2V0L A;  1HJJ A;  3T7N A;  4Y64 A;  1QG8 A;  4HO6 A;  4B2X A;  1ZCY A;  4Q7C A;  3OC9 A;  2PGV A;  1FGG A;  1ZJ3 A;  1Z90 A;  3USR A;  5C8R A;  5FTS A;  3I0C A;  5CQL X;  1HJL A;  2Y7A A;  4KRV A;  3N9W A;  1H7H A;  1FOA A;  2AH9 A;  4FIY A;  5CQN X;  4HO4 A;  3BRK X;  1YP3 A;  1EYR A;  3JUK A;  4FRQ A;  2VS5 A;  5HS2 A;  1ZDG A;  1GWW A;  2YCM A;  2FY7 A;  3I0G A;  1HM8 A;  3OH0 A;  1JVG A;  4G3S A;  4CJB A;  2QH5 A;  4ASY A;  3U2U A;  2GGO A;  4C2S A;  2VXL A;  5JQQ A;  1W55 A;  3DJ4 A;  3USQ A;  1OMZ A;  3I0H A;  4CJ8 A;  5C4F A;  3D8V A;  1VPA A;  1FRW A;  4LW6 A;  1VZT A;  2RJ8 A;  3I0K A;  2JCJ A;  3V0Q A;  2A8W A;  1R7U A;  4L41 C;  1V83 A;  3TQD A;  2RIZ A;  2O1F A;  4KPZ A;  2WEE A;  1LL3 A;  4Y7G A;  1INI A;  3BCV A;  2D7I A;  1FR8 A;  5C48 A;  2OEF A;  4FIX A;  1TW5 A;  3V0P A;  1FXO A;  4FRA A;  4B4G A;  2RJ7 A;  1VGT A;  1R7V A;  1YRO B;  4Y7F A;  5FU8 A;  1NMM B;  1ZJ1 A;  4AYJ A;  1FR9 A;  2RJ5 A;  2I5E A;  1INJ A;  3OKR A;  2I7B A;  4MYB A;  4AYL A;  1H5S D;  2JCK A;  2PA4 A;  5J49 A;  4HO3 A;  3Q7U A;  3U0Y A;  1H7G A;  1H4D A;  1K4V A;  3RSB A;  1OMX A;  4BMA A;  1ZJ0 A;  2OI6 A;  5DDV A;  1H5T A;  5C3B A;  1KWS A;  5C3D A;  5C1G A;  4XWI A;  2Z86 A;  5C3A A;  3RMV A;  1HM0 A;  1G3L A;  5CMF X;  2VS4 A;  2BO4 A;  2UX8 A;  2WE9 A;  2WAW A;  3IOI A;  1LL0 A;  4YS8 A;  1TW1 A;  4Y6U A;  3CU0 A;  2AES A;  3T7O A;  5DDT A;  2FYD B;  3KIA A;  2VD4 A;  1FXJ A;  4KC2 A;  2I5K A;  1ZCU A;  1EZI A;  1FZW A;  3V0O A;  2E3D A;  1WT1 A;  1NF5 B;  4CJC A;  4DE7 A;  1H4C A;  4HOC A;  4B2W A;  1ZJP A;  2MZB A;  2QKX A;  2V0J A;  2AM4 A;  3CKQ A;  2CU2 A;  2BO7 A;  2X5Z A;  3PNN A;  3V0M A;  5C49 A;  1H4E A;  2APC A;  3PKP A;  1VZX A;  1G97 A;  1VGU A;  4EEG A;  1G9R A;  4EVW A;  1ON8 A;  1ZJO A;  2Y4M A;  1H7F A;  3SXG A;  1FG5 N;  2X65 A;  2XME A;  1H7Q A;  4KNX A;  4R7P A;  5L6V A;  1GQ9 A;  1W57 A;  3SX3 A;  1JVD A;  1ZCT A;  1R7Y A;  2V0I A;  5EJZ A;  4Y7V A;  2PX7 A;  4FQW A;  2RIT A;  4FRM A;  4FRP A;  1H5T B;  2Z87 A;  5C36 A;  1FWY A;  3R3I A;  4JIS A;  2XMH A;  1PZY B;  3V8Z A;  4Y63 A;  1G8O A;  3NGW A;  2NXV A;  4M4K A;  1I52 A;  3HL3 A;  2WVL A;  3K8E A;  3T7M A;  5C4D A;  3TZT A;  3ZLL A;  1JYL A;  4Y62 A;  1ZCV A;  5IDS A;  2E8B A;  5C47 A;  3U2T A;  2VSH A;  1NQI B;  1R80 A;  1G93 A;  4BQH A;  3EE5 A;  1LVW A;  2Q4J A;  1VH1 A;  2OI7 A;  1NWG B;  4HO8 A;  2RJ4 A;  2OI5 A;  4FRD A;  4HG6 A;  4NAN A;  1SS9 A;  1QGS A;  4E1K A;  1H5S C;  3U2X A;  4ASJ A;  2FFV A;  2XWM A;  4AAW A;  2Y4J A;  1H7T A;  1FGX A;  4Y9X A;  4EEA A;  1MP4 A;  1ZDF A;  2RIX A;  3OGZ A;  4FCE A;  3K8D A;  1ZI4 A;  1S4N A;  3I0D A;  4EE4 A;  4Y6N A;  3CKJ A;  3SXE A;  4KPX A;  4HO9 A;  1JV1 A;  4G3P A;  4Y7U A;  4HCQ A;  4D48 A;  4UEG A;  4DEC A;  5C4B A;  1LZI A;  4HO2 A;  4MND A;  3V8Y A;  3I0L A;  5C4E A;  4D11 A;  5C4C A;  1ZI1 A;  1R7T A;  3JTJ A;  2D7R A;  2JCO A;  2Y4L A;  1GX0 A;  2YQS A;  5BXC A;  3I0J A;  5CMH A;  4IRQ A;  2WVK A;  4NAL A;  4B3U A;  4ECM A;  5AJP A;  2VS3 A;  4KQL A;  1GWV A;  4O6N A;  2YQH A;  2QGI A;  1ZHJ A;  2ZU7 A;  3RMW A;  2FFU A;  4FRO A;  5EIY A;  2YES A;  1R7X A;  1H5R A;  3SX5 A;  3POL A;  2ICX A;  4KC4 A;  4J18 A;  1XHB A; 
#chains in the Genus database with same CATH homology
 4HO5 A;  2RIY A;  4B5B A;  5FTV A;  1O7O A;  3E25 A;  3U0X A;  1H7L A;  1VM8 A;  1H7E A;  4AC3 A;  5L6S A;  1QGQ A;  3CKV A;  1ZIZ A;  5IDT A;  1MC3 A;  4EE3 A;  2BO8 A;  2Y4K A;  1G95 A;  5CMG X;  4K6R A;  2P73 A;  4O6M A;  1G0R A;  4B4M A;  5I1F A;  1E5K A;  4ZDQ A;  3SX8 A;  3ZGG A;  1IIN A;  1S4P A;  5FYE A;  4KT7 A;  5FV9 A;  2WVM A;  4MIX A;  2V0K A;  1ZI5 A;  1LL2 A;  2C0N A;  2O1G A;  1H3M A;  2FYC B;  3ZGF A;  2RJ0 A;  4NAI A;  2BO6 A;  1LZJ A;  5FU0 A;  3SX7 A;  1W77 A;  2AE7 A;  4FRE A;  1VGZ A;  1GA8 A;  3PKQ A;  3V0L A;  4IRP A;  1V82 A;  3SPT A;  2AGD A;  4FRH A;  1HM9 A;  1WT3 A;  2GGQ A;  1VIC A;  2OEG A;  2FYA A;  2W0W A;  4M28 A;  4Y7T A;  2W0V A;  4D0T A;  3CKN A;  3IOH A;  3D98 A;  2A8U A;  2RJ1 A;  4NAK A;  3V90 A;  2J0A A;  1H5R B;  2YC3 A;  2XWL A;  1YP4 A;  1R82 A;  1LZ7 A;  4D0Z A;  3O3P A;  1TZF A;  2JCL A;  3ZF8 A;  1IIM A;  1G2V A;  1FO9 A;  3OH2 A;  2AM3 A;  1TVY A;  4M2B A;  2Y6P A;  4ARW A;  2VXM A;  1O0R A;  1H5S A;  4G3Q A;  3SXD A;  3E26 A;  2V0H A;  3V91 A;  3OH4 A;  3I0F A;  5CQM X;  3ZLK A;  3U2V A;  2P6W A;  3JUJ A;  2J0B A;  3QVB A;  2AM5 A;  2RJ6 A;  4HO0 A;  2FYB A;  1G23 A;  1R81 A;  3FWW A;  1S4O A;  4B42 A;  1WSZ A;  4B4B A;  4KXO A;  4GBP A;  1O7Q A;  4KNR A;  4EE5 A;  4JD0 A;  3I0E A;  1XZ6 A;  4P00 A;  1MP3 A;  5C1L A;  2AEC A;  2P72 A;  4D11 C;  3F1C A;  1QWJ A;  1NHE B;  2YQJ A;  4FRL A;  5CQP A;  1WVC A;  5AJN A;  3U2W A;  2VK9 A;  2PGY A;  1GX4 A;  2VSI A;  1WT2 A;  4FRB A;  3Q4S A;  3CKO A;  3I0I X;  5EJ1 A;  1VGW A;  2XWN A;  3GUE A;  2D0J A;  1VZU A;  1FO8 A;  2VFZ A;  2O1H A;  1ON6 A;  3LW6 A;  3SXC A;  4EEM A;  5D91 A;  3V0N A;  2DPW A;  1V84 A;  3R2W A;  4M2A A;  5CQO A;  1O23 B;  3Q80 A;  2YQC A;  2YC5 A;  3FOQ A;  1WT0 A;  5AJO A;  4G87 A;  1ZI3 A;  3OAM A;  1YP2 A;  4EEO A;  5C38 A;  5IFY A;  3OH3 A;  1HV9 A;  3DUV A;  1PZT A;  3D5N A;  3DK5 A;  2X60 A;  4LW3 A;  2X5S A;  1H5S B;  1GQC A;  5FUH A;  3CGX A;  3SXA A;  1LZ0 A;  1MP5 A;  1G1L A;  2ICY A;  2WGZ A;  4CVH A;  5CMJ A;  4P02 A;  3ST8 A;  1JV3 A;  5CMI A;  4DDZ A;  1ZJ2 A;  3SXB A;  1OQM B;  1JYK A;  2ZU9 A;  5D92 A;  5C1H A;  1VH3 A;  3F1Y A;  3OH1 A;  2ZU8 A;  3IOJ A;  4FCU A;  1NKH B;  2RJ9 A;  4KC1 A;  2V0L A;  1HJJ A;  3T7N A;  4Y64 A;  1QG8 A;  4HO6 A;  4B2X A;  1ZCY A;  4Q7C A;  3OC9 A;  2PGV A;  1FGG A;  1ZJ3 A;  1Z90 A;  3USR A;  5C8R A;  5FTS A;  3I0C A;  5CQL X;  1HJL A;  2Y7A A;  4KRV A;  3N9W A;  1H7H A;  1FOA A;  2AH9 A;  4FIY A;  5CQN X;  4HO4 A;  3BRK X;  1YP3 A;  1EYR A;  3JUK A;  4FRQ A;  2VS5 A;  5HS2 A;  1ZDG A;  1GWW A;  2YCM A;  2FY7 A;  3I0G A;  1HM8 A;  3OH0 A;  1JVG A;  4G3S A;  4CJB A;  2QH5 A;  4ASY A;  3U2U A;  2GGO A;  4C2S A;  2VXL A;  5JQQ A;  1W55 A;  3DJ4 A;  3USQ A;  1OMZ A;  3I0H A;  4CJ8 A;  5C4F A;  3D8V A;  1VPA A;  1FRW A;  4LW6 A;  1VZT A;  2RJ8 A;  3I0K A;  2JCJ A;  3V0Q A;  2A8W A;  1R7U A;  4L41 C;  1V83 A;  3TQD A;  2RIZ A;  2O1F A;  4KPZ A;  2WEE A;  1LL3 A;  4Y7G A;  1INI A;  3BCV A;  2D7I A;  1FR8 A;  5C48 A;  2OEF A;  4FIX A;  1TW5 A;  3V0P A;  1FXO A;  4FRA A;  4B4G A;  2RJ7 A;  1VGT A;  1R7V A;  1YRO B;  4Y7F A;  5FU8 A;  1NMM B;  1ZJ1 A;  4AYJ A;  1FR9 A;  2RJ5 A;  2I5E A;  1INJ A;  3OKR A;  2I7B A;  4MYB A;  4AYL A;  1H5S D;  2JCK A;  2PA4 A;  5J49 A;  4HO3 A;  3Q7U A;  3U0Y A;  1H7G A;  1H4D A;  1K4V A;  3RSB A;  1OMX A;  4BMA A;  1ZJ0 A;  2OI6 A;  5DDV A;  1H5T A;  5C3B A;  1KWS A;  5C3D A;  5C1G A;  4XWI A;  2Z86 A;  5C3A A;  3RMV A;  1HM0 A;  1G3L A;  5CMF X;  2VS4 A;  2BO4 A;  2UX8 A;  2WE9 A;  2WAW A;  3IOI A;  1LL0 A;  4YS8 A;  1TW1 A;  4Y6U A;  3CU0 A;  2AES A;  3T7O A;  5DDT A;  2FYD B;  3KIA A;  2VD4 A;  1FXJ A;  4KC2 A;  2I5K A;  1ZCU A;  1EZI A;  1FZW A;  3V0O A;  2E3D A;  1WT1 A;  1NF5 B;  4CJC A;  4DE7 A;  1H4C A;  4HOC A;  4B2W A;  1ZJP A;  2MZB A;  2QKX A;  2V0J A;  2AM4 A;  3CKQ A;  2CU2 A;  2BO7 A;  2X5Z A;  3PNN A;  3V0M A;  5C49 A;  1H4E A;  2APC A;  3PKP A;  1VZX A;  1G97 A;  1VGU A;  4EEG A;  1G9R A;  4EVW A;  1ON8 A;  1ZJO A;  2Y4M A;  1H7F A;  3SXG A;  1FG5 N;  2X65 A;  2XME A;  1H7Q A;  4KNX A;  4R7P A;  5L6V A;  1GQ9 A;  1W57 A;  3SX3 A;  1JVD A;  1ZCT A;  1R7Y A;  2V0I A;  5EJZ A;  4Y7V A;  2PX7 A;  4FQW A;  2RIT A;  4FRM A;  4FRP A;  1H5T B;  2Z87 A;  5C36 A;  1FWY A;  3R3I A;  4JIS A;  2XMH A;  1PZY B;  3V8Z A;  4Y63 A;  1G8O A;  3NGW A;  2NXV A;  4M4K A;  1I52 A;  3HL3 A;  2WVL A;  3K8E A;  3T7M A;  5C4D A;  3TZT A;  3ZLL A;  1JYL A;  4Y62 A;  1ZCV A;  5IDS A;  2E8B A;  5C47 A;  3U2T A;  2VSH A;  1NQI B;  1R80 A;  1G93 A;  4BQH A;  3EE5 A;  1LVW A;  2Q4J A;  1VH1 A;  2OI7 A;  1NWG B;  4HO8 A;  2RJ4 A;  2OI5 A;  4FRD A;  4HG6 A;  4NAN A;  1SS9 A;  1QGS A;  4E1K A;  1H5S C;  3U2X A;  4ASJ A;  2FFV A;  2XWM A;  4AAW A;  2Y4J A;  1H7T A;  1FGX A;  4Y9X A;  4EEA A;  1MP4 A;  1ZDF A;  2RIX A;  3OGZ A;  4FCE A;  3K8D A;  1ZI4 A;  1S4N A;  3I0D A;  4EE4 A;  4Y6N A;  3CKJ A;  3SXE A;  4KPX A;  4HO9 A;  1JV1 A;  4G3P A;  4Y7U A;  4HCQ A;  4D48 A;  4UEG A;  4DEC A;  5C4B A;  1LZI A;  4HO2 A;  4MND A;  3V8Y A;  3I0L A;  5C4E A;  4D11 A;  5C4C A;  1ZI1 A;  1R7T A;  3JTJ A;  2D7R A;  2JCO A;  2Y4L A;  1GX0 A;  2YQS A;  5BXC A;  3I0J A;  5CMH A;  4IRQ A;  2WVK A;  4NAL A;  4B3U A;  4ECM A;  5AJP A;  2VS3 A;  4KQL A;  1GWV A;  4O6N A;  2YQH A;  2QGI A;  1ZHJ A;  2ZU7 A;  3RMW A;  2FFU A;  4FRO A;  5EIY A;  2YES A;  1R7X A;  1H5R A;  3SX5 A;  3POL A;  2ICX A;  4KC4 A;  4J18 A;  1XHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...