1R81A

Glycosyltransferase a in complex with 3-amino-acceptor analog inhibitor and uridine diphosphate-n-acetyl-galactose
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
266
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 266
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r81A00
3T7MA 1NQIB 5CQPA 2Y4JA 1H7HA 2O1GA 1VGWA 4G3QA 1LVWA 2OEFA 1LZ0A 4YS8A 5CMJA 4KXOA 3CKQA 3V90A 4ARWA 1ZJPA 5FUHA 1ZI5A 1ZCYA 3IOJA 5FU8A 4KNXA 1W77A 3V0MA 4Y7TA 3RMWA 3NGWA 2X65A 2RJ6A 4KNRA 5FU0A 3U0YA 5CQNX 4Y6UA 1O7OA 2Z86A 2A8UA 3D5NA 3U0XA 2Y7AA 4HO0A 2VS3A 1H5SC 3I0HA 3TZTA 3KIAA 4M2AA 3Q80A 1H7QA 2YQSA 2OI5A 1W57A 1LZJA 2ICYA 3BCVA 2VXLA 1V83A 1FR9A 4FRAA 4JISA 3GUEA 2VD4A 1JV3A 1ZI4A 2D7RA 1FGXA 3JUKA 2A8WA 1GA8A 3USQA 3CKJA 4Y63A 5AJPA 4J18A 5DDVA 4B5BA 2JCOA 2AH9A 4NANA 3OC9A 1G8OA 3IOIA 1ZIZA 1V82A 2WVLA 1HM9A 4R7PA 4C2SA 4D11A 2ZU8A 1HM0A 2O1FA 1OMZA 1H5TA 4EE5A 2VXMA 1O7QA 3F1CA 4B4BA 3OAMA 5C47A 1GWWA 1G95A 1R7XA 4G3SA 3HL3A 1H7GA 1H7LA 4EEOA 2BO6A 4B3UA 4Y7VA 1LZ7A 2RITA 2V0KA 3SX8A 1ZHJA 5BXCA 1IIMA 4FRMA 3U2UA 5L6SA 1GX0A 2ICXA 4MNDA 1FGGA 4B2XA 5FYEA 1WVCA 4DE7A 3ZGFA 1VZXA 2PGVA 5JQQA 2JCLA 2YESA 1H5RA 2VSIA 4FREA 3ZGGA 4HO9A 4EEAA 1G9RA 3V0QA 5C48A 3SX5A 2CU2A 1INIA 2WAWA 4KC4A 3SXCA 3I0GA 1ZJ0A 3BRKX 1GX4A 3I0EA 3ZLKA 3DUVA 2ZU9A 1ON6A 1O0RA 1WT1A 2WE9A 1QG8A 3I0JA 1JVDA 4ASYA 1G2VA 3SXGA 4ASJA 5C1HA 1FO8A 4XWIA 1FZWA 1XZ6A 2P73A 3E25A 4D48A 4Y6NA 3DK5A 4Y7UA 3I0CA 1H5TB 1W55A 2E8BA 1OQMB 5AJOA 2FY7A 1NMMB 2FYBA 2Z87A 1EZIA 5C1GA 1LZIA 4KPXA 4KT7A 1I52A 1WSZA 5HS2A 4M4KA 1H7TA 1JV1A 1MP4A 2I7BA 3PKQA 5C1LA 4CJ8A 1ZCTA 1OMXA 1GQCA 1HM8A 4NALA 4AYJA 1WT3A 2FFVA 1H5RB 2WVMA 2FYCB 2XMHA 2Y4LA 3TQDA 3V8YA 1S4NA 2APCA 1JVGA 4HO6A 5C4EA 1QGQA 1R7YA 2YQJA 2RJ7A 3O3PA 1HJLA 1ON8A 2QKXA 2WVKA 2XWNA 1SS9A 3SX7A 1ZDGA 1NHEB 4NAIA 5C36A 1FRWA 4EE4A 1TVYA 1H4CA 3U2VA 2JCJA 4L41C 2QGIA 2RJ5A 4P00A 2RIZA 3K8DA 1K4VA 2YC5A 3JTJA 1VZTA 2X60A 4EE3A 3QVBA 1FG5N 5CQLX 5DDTA 1KWSA 4D0TA 1INJA 2FFUA 4FCUA 4LW3A 5C4CA 3USRA 1VGUA 3ST8A 1H7FA 1V84A 3V0OA 2RJ4A 2YC3A 3ZF8A 1VH3A 4CJCA 3I0DA 4HOCA 4GBPA 2O1HA 2AM5A 4M2BA 2XWLA 2BO7A 2W0WA 4FRQA 5EJZA 1H7EA 4MYBA 4FRDA 1MP5A 5CQMX 1FXJA 5C49A 5C3AA 1G3LA 5AJNA 2BO4A 1ZI1A 2AM4A 4B4GA 2PX7A 1FO9A 1VH1A 2WEEA 2PA4A 3I0KA 3R2WA 2BO8A 1NWGB 1FWYA 2AECA 1PZTA 1R82A 2OI6A 4LW6A 1G97A 2AGDA 3OH3A 3OH4A 3SXEA 2VSHA 3PNNA 2RJ1A 3JUJA 4K6RA 4HO2A 1E5KA 2UX8A 1VICA 4D0ZA 2RJ0A 3CU0A 4BQHA 5EIYA 2FYAA 2GGQA 4Y62A 1ZJ3A 2XWMA 5C3DA 2RJ8A 4AC3A 4HG6A 1TW5A 1H5SA 1ZDFA 2MZBA 4BMAA 1TZFA 1MP3A 1ZJ2A 5C4FA 4Y7FA 3POLA 4D11C 3V0PA 4B2WA 2RIXA 4EEMA 1WT2A 2Y6PA 4FRPA 4NAKA 2P6WA 5C38A 4P02A 1Z90A 2GGOA 1VGTA 3OH0A 2V0HA 1R81A 5C4DA 3IOHA 3Q7UA 2V0IA 1XHBA 3V0LA 3CGXA 2PGYA 3FWWA 4JD0A 4B42A 5CMGX 3RMVA 3CKVA 3OH2A 1FOAA 1JYLA 2P72A 2Y4MA 3V8ZA 1VPAA 1ZJOA 4AAWA 3EE5A 3Q4SA 4G3PA 2ZU7A 5CQOA 2AESA 4EVWA 1H4DA 4FRLA 5CMHA 3T7OA 2I5KA 2RIYA 1H5SD 1HJJA 3OH1A 4Y7GA 4ECMA 1H5SB 5IDSA 3U2TA 1PZYB 3T7NA 1R7TA 2XMEA 5CMIA 2D0JA 2FYDB 2YQHA 2VS5A 2AM3A 1MC3A 1YP3A 5C4BA 1H4EA 1R80A 3OKRA 1VZUA 1S4PA 3U2WA 5FTVA 5C8RA 1ZI3A 2RJ9A 3U2XA 2X5SA 2AE7A 3PKPA 2NXVA 4KPZA 1R7VA 3CKOA 4FROA 3N9WA 1WT0A 5EJ1A 3I0FA 3K8EA 5L6VA 5J49A 1ZCVA 4HO4A 3V0NA 4HO8A 3CKNA 2DPWA 4KC2A 4KRVA 5CMFX 3SPTA 1QGSA 2V0LA 3I0IX 2D7IA 4FQWA 1IINA 3D98A 1LL0A 1G0RA 1S4OA 1TW1A 5I1FA 1VM8A 2YCMA 4HCQA 2VS4A 1JYKA 4M28A 4CVHA 1H3MA 4FRBA 3R3IA 4G87A 4HO3A 4UEGA 2V0JA 4KC1A 3ZLLA 3OGZA 1FXOA 2I5EA 4E1KA 4B4MA 3SXDA 1ZJ1A 1LL3A 1R7UA 1G1LA 3V91A 1YP4A 3D8VA 2E3DA 4DECA 5C3BA 3FOQA 3LW6A 3E26A 5FTSA 1FR8A 1GWVA 4DDZA 2WGZA 4CJBA 1HV9A 4ZDQA 4HO5A 1YP2A 2OI7A 4IRPA 5IDTA 2QH5A 3F1YA 2Q4JA 1NKHB 2VFZA 4FCEA 1GQ9A 4Y9XA 5FV9A 1LL2A 2Y4KA 2JCKA 3RSBA 3I0LA 1ZCUA 3SXAA 1G23A 1NF5B 2W0VA 4FRHA 3DJ4A 1O23B 4KQLA 2OEGA 4Y64A 1VGZA 1YROB 3SX3A 4AYLA 4EEGA 3SXBA 2YQCA 1QWJA 1G93A 5IFYA 4IRQA 1EYRA 2X5ZA
chains in the Genus database with same CATH superfamily
3T7MA 1NQIB 5CQPA 2Y4JA 1H7HA 2O1GA 1VGWA 4G3QA 1LVWA 2OEFA 1LZ0A 4YS8A 5CMJA 4KXOA 3CKQA 3V90A 4ARWA 1ZJPA 5FUHA 1ZI5A 1ZCYA 3IOJA 5FU8A 4KNXA 1W77A 3V0MA 4Y7TA 3RMWA 3NGWA 2X65A 2RJ6A 4KNRA 5FU0A 3U0YA 5CQNX 4Y6UA 1O7OA 2Z86A 4O6NA 2A8UA 3D5NA 3U0XA 2Y7AA 4HO0A 2VS3A 1H5SC 3I0HA 3TZTA 3KIAA 4M2AA 3Q80A 1H7QA 2YQSA 2OI5A 1W57A 1LZJA 2ICYA 3BCVA 2VXLA 1V83A 1FR9A 4FRAA 4JISA 3GUEA 2VD4A 1JV3A 1ZI4A 2D7RA 1FGXA 3JUKA 2A8WA 1GA8A 3USQA 3CKJA 4Y63A 5AJPA 2C0NA 4J18A 5DDVA 4B5BA 2JCOA 2AH9A 4NANA 3OC9A 1G8OA 3IOIA 1ZIZA 1V82A 2WVLA 1HM9A 4R7PA 4C2SA 4D11A 2ZU8A 1HM0A 2O1FA 1OMZA 1H5TA 4EE5A 2VXMA 1O7QA 3F1CA 4B4BA 3OAMA 5C47A 1GWWA 1G95A 1R7XA 4G3SA 3HL3A 1H7GA 1H7LA 4EEOA 2BO6A 4B3UA 4Y7VA 1LZ7A 2RITA 2V0KA 3SX8A 1ZHJA 5BXCA 1IIMA 4FRMA 3U2UA 5L6SA 1GX0A 2ICXA 4MNDA 1FGGA 4B2XA 5FYEA 1WVCA 4DE7A 3ZGFA 1VZXA 2PGVA 5JQQA 2JCLA 4O6MA 2YESA 1H5RA 2VSIA 4FREA 3ZGGA 4HO9A 4EEAA 1G9RA 3V0QA 5C48A 3SX5A 2CU2A 1INIA 2WAWA 4KC4A 3SXCA 3I0GA 1ZJ0A 3BRKX 1GX4A 3I0EA 3ZLKA 3DUVA 2ZU9A 1ON6A 1O0RA 1WT1A 2WE9A 1QG8A 3I0JA 1JVDA 4ASYA 1G2VA 3SXGA 4ASJA 5C1HA 1FO8A 4XWIA 1FZWA 1XZ6A 2P73A 3E25A 4D48A 4Y6NA 3DK5A 4Y7UA 3I0CA 1H5TB 1W55A 2E8BA 1OQMB 5AJOA 2FY7A 1NMMB 2FYBA 2Z87A 1EZIA 5C1GA 1LZIA 4KPXA 4KT7A 1I52A 1WSZA 5HS2A 4M4KA 1H7TA 1JV1A 1MP4A 2I7BA 3PKQA 5C1LA 4CJ8A 2J0BA 1ZCTA 1OMXA 1GQCA 1HM8A 4NALA 4AYJA 1WT3A 2FFVA 1H5RB 2WVMA 2FYCB 2XMHA 2Y4LA 3TQDA 3V8YA 1S4NA 2APCA 1JVGA 4HO6A 5C4EA 1QGQA 1R7YA 2YQJA 2RJ7A 3O3PA 1HJLA 1ON8A 2QKXA 2WVKA 2XWNA 1SS9A 3SX7A 1ZDGA 1NHEB 4NAIA 5C36A 1FRWA 4EE4A 1TVYA 1H4CA 3U2VA 2JCJA 4L41C 2QGIA 2RJ5A 4P00A 2RIZA 3K8DA 1K4VA 2YC5A 3JTJA 1VZTA 5D92A 2X60A 4EE3A 3QVBA 1FG5N 5CQLX 5DDTA 1KWSA 4D0TA 1INJA 2FFUA 4FCUA 4LW3A 5C4CA 3USRA 1VGUA 3ST8A 1H7FA 1V84A 3V0OA 2RJ4A 2YC3A 3ZF8A 1VH3A 4CJCA 3I0DA 4HOCA 4GBPA 2O1HA 2AM5A 4M2BA 2XWLA 2BO7A 2W0WA 4FRQA 5EJZA 1H7EA 4MYBA 4FRDA 1MP5A 5CQMX 1FXJA 5C49A 5C3AA 1G3LA 5AJNA 2BO4A 1ZI1A 2AM4A 4B4GA 2PX7A 1FO9A 1VH1A 2WEEA 2PA4A 3I0KA 3R2WA 2BO8A 1NWGB 1FWYA 2AECA 1PZTA 1R82A 2OI6A 4LW6A 1G97A 2AGDA 3OH3A 3OH4A 3SXEA 2VSHA 3PNNA 2RJ1A 3JUJA 4K6RA 4HO2A 1E5KA 2UX8A 1VICA 4D0ZA 2RJ0A 3CU0A 4BQHA 5EIYA 2FYAA 2GGQA 4Y62A 1ZJ3A 2XWMA 5C3DA 2RJ8A 4AC3A 4HG6A 1TW5A 1H5SA 1ZDFA 2MZBA 4BMAA 1TZFA 1MP3A 1ZJ2A 5C4FA 4Y7FA 3POLA 4D11C 3V0PA 4B2WA 2RIXA 4EEMA 1WT2A 2Y6PA 4FRPA 4NAKA 2P6WA 5C38A 4P02A 1Z90A 2GGOA 1VGTA 3OH0A 2V0HA 1R81A 5C4DA 3IOHA 3Q7UA 2V0IA 1XHBA 3V0LA 3CGXA 2PGYA 3FWWA 4JD0A 4B42A 5CMGX 3RMVA 3CKVA 3OH2A 1FOAA 1JYLA 2P72A 2Y4MA 3V8ZA 1VPAA 1ZJOA 4AAWA 3EE5A 3Q4SA 4G3PA 2ZU7A 5CQOA 2AESA 4EVWA 1H4DA 4FRLA 5CMHA 3T7OA 2I5KA 2RIYA 1H5SD 1HJJA 3OH1A 4Y7GA 4ECMA 1H5SB 5IDSA 3U2TA 1PZYB 3T7NA 1R7TA 2XMEA 5CMIA 2D0JA 2FYDB 2YQHA 2VS5A 2AM3A 1MC3A 1YP3A 5C4BA 1H4EA 1R80A 3OKRA 1VZUA 1S4PA 3U2WA 5FTVA 5C8RA 1ZI3A 2RJ9A 3U2XA 2X5SA 2AE7A 3PKPA 2NXVA 4KPZA 1R7VA 3CKOA 4FROA 3N9WA 4MIXA 1WT0A 5EJ1A 3I0FA 3K8EA 5L6VA 5J49A 1ZCVA 4HO4A 3V0NA 4HO8A 3CKNA 2DPWA 4KC2A 4KRVA 5CMFX 3SPTA 1QGSA 2V0LA 3I0IX 2D7IA 4FQWA 1IINA 3D98A 1LL0A 1G0RA 1S4OA 1TW1A 2VK9A 1VM8A 2YCMA 4HCQA 5I1FA 2VS4A 1JYKA 4M28A 4CVHA 4FIYA 1H3MA 4FRBA 3R3IA 4G87A 4HO3A 4UEGA 2J0AA 2V0JA 4KC1A 3ZLLA 4Q7CA 3OGZA 1FXOA 2I5EA 4E1KA 4B4MA 3SXDA 1ZJ1A 1LL3A 1R7UA 1G1LA 3V91A 1YP4A 3D8VA 2E3DA 4DECA 5C3BA 3FOQA 3LW6A 3E26A 5FTSA 1FR8A 1GWVA 4DDZA 2WGZA 4CJBA 1HV9A 4ZDQA 4HO5A 1YP2A 2OI7A 4IRPA 5IDTA 2QH5A 3F1YA 2Q4JA 1NKHB 2VFZA 4FCEA 1GQ9A 4Y9XA 5FV9A 1LL2A 2Y4KA 2JCKA 3RSBA 3I0LA 1ZCUA 3SXAA 1G23A 1NF5B 2W0VA 4FIXA 4FRHA 3DJ4A 5D91A 1O23B 4KQLA 2OEGA 4Y64A 1VGZA 1YROB 3SX3A 4AYLA 4EEGA 3SXBA 2YQCA 1QWJA 1G93A 5IFYA 4IRQA 1EYRA 2X5ZA
chains in the Genus database with same CATH topology
3T7MA 1NQIB 5CQPA 2Y4JA 1H7HA 2O1GA 1VGWA 4G3QA 1LVWA 2OEFA 1LZ0A 4YS8A 5CMJA 4KXOA 3CKQA 3V90A 4ARWA 1ZJPA 5FUHA 1ZI5A 1ZCYA 3IOJA 5FU8A 4KNXA 1W77A 3V0MA 4Y7TA 3RMWA 3NGWA 2X65A 2RJ6A 4KNRA 5FU0A 3U0YA 5CQNX 4Y6UA 1O7OA 2Z86A 4O6NA 2A8UA 3D5NA 3U0XA 2Y7AA 4HO0A 2VS3A 1H5SC 3I0HA 3TZTA 3KIAA 4M2AA 3Q80A 1H7QA 2YQSA 2OI5A 1W57A 1LZJA 2ICYA 3BCVA 2VXLA 1V83A 1FR9A 4FRAA 4JISA 3GUEA 2VD4A 1JV3A 1ZI4A 2D7RA 1FGXA 3JUKA 2A8WA 1GA8A 3USQA 3CKJA 4Y63A 5AJPA 2C0NA 4J18A 5DDVA 4B5BA 2JCOA 2AH9A 4NANA 3OC9A 1G8OA 3IOIA 1ZIZA 1V82A 2WVLA 1HM9A 4R7PA 4C2SA 4D11A 2ZU8A 1HM0A 2O1FA 1OMZA 1H5TA 4EE5A 2VXMA 1O7QA 3F1CA 4B4BA 3OAMA 5C47A 1GWWA 1G95A 1R7XA 4G3SA 3HL3A 1H7GA 1H7LA 4EEOA 2BO6A 4B3UA 4Y7VA 1LZ7A 2RITA 2V0KA 3SX8A 1ZHJA 5BXCA 1IIMA 4FRMA 3U2UA 5L6SA 1GX0A 2ICXA 4MNDA 1FGGA 4B2XA 5FYEA 1WVCA 4DE7A 3ZGFA 1VZXA 2PGVA 5JQQA 2JCLA 4O6MA 2YESA 1H5RA 2VSIA 4FREA 3ZGGA 4HO9A 4EEAA 1G9RA 3V0QA 5C48A 3SX5A 2CU2A 1INIA 2WAWA 4KC4A 3SXCA 3I0GA 1ZJ0A 3BRKX 1GX4A 3I0EA 3ZLKA 3DUVA 2ZU9A 1ON6A 1O0RA 1WT1A 2WE9A 1QG8A 3I0JA 1JVDA 4ASYA 1G2VA 3SXGA 4ASJA 5C1HA 1FO8A 4XWIA 1FZWA 1XZ6A 2P73A 3E25A 4D48A 4Y6NA 3DK5A 4Y7UA 3I0CA 1H5TB 1W55A 2E8BA 1OQMB 5AJOA 2FY7A 1NMMB 2FYBA 2Z87A 1EZIA 5C1GA 1LZIA 4KPXA 4KT7A 1I52A 1WSZA 5HS2A 4M4KA 1H7TA 1JV1A 1MP4A 2I7BA 3PKQA 5C1LA 4CJ8A 2J0BA 1ZCTA 1OMXA 1GQCA 1HM8A 4NALA 4AYJA 1WT3A 2FFVA 1H5RB 2WVMA 2FYCB 2XMHA 2Y4LA 3TQDA 3V8YA 1S4NA 2APCA 1JVGA 4HO6A 5C4EA 1QGQA 1R7YA 2YQJA 2RJ7A 3O3PA 1HJLA 1ON8A 2QKXA 2WVKA 2XWNA 1SS9A 3SX7A 1ZDGA 1NHEB 4NAIA 5C36A 1FRWA 4EE4A 1TVYA 1H4CA 3U2VA 2JCJA 4L41C 2QGIA 2RJ5A 4P00A 2RIZA 3K8DA 1K4VA 2YC5A 3JTJA 1VZTA 5D92A 2X60A 4EE3A 3QVBA 1FG5N 5CQLX 5DDTA 1KWSA 4D0TA 1INJA 2FFUA 4FCUA 4LW3A 5C4CA 3USRA 1VGUA 3ST8A 1H7FA 1V84A 3V0OA 2RJ4A 2YC3A 3ZF8A 1VH3A 4CJCA 3I0DA 4HOCA 4GBPA 2O1HA 2AM5A 4M2BA 2XWLA 2BO7A 2W0WA 4FRQA 5EJZA 1H7EA 4MYBA 4FRDA 1MP5A 5CQMX 1FXJA 5C49A 5C3AA 1G3LA 5AJNA 2BO4A 1ZI1A 2AM4A 4B4GA 2PX7A 1FO9A 1VH1A 2WEEA 2PA4A 3I0KA 3R2WA 2BO8A 1NWGB 1FWYA 2AECA 1PZTA 1R82A 2OI6A 4LW6A 1G97A 2AGDA 3OH3A 3OH4A 3SXEA 2VSHA 3PNNA 2RJ1A 3JUJA 4K6RA 4HO2A 1E5KA 2UX8A 1VICA 4D0ZA 2RJ0A 3CU0A 4BQHA 5EIYA 2FYAA 2GGQA 4Y62A 1ZJ3A 2XWMA 5C3DA 2RJ8A 4AC3A 4HG6A 1TW5A 1H5SA 1ZDFA 2MZBA 4BMAA 1TZFA 1MP3A 1ZJ2A 5C4FA 4Y7FA 3POLA 4D11C 3V0PA 4B2WA 2RIXA 4EEMA 1WT2A 2Y6PA 4FRPA 4NAKA 2P6WA 5C38A 4P02A 1Z90A 2GGOA 1VGTA 3OH0A 2V0HA 1R81A 5C4DA 3IOHA 3Q7UA 2V0IA 1XHBA 3V0LA 3CGXA 2PGYA 3FWWA 4JD0A 4B42A 5CMGX 3RMVA 3CKVA 3OH2A 1FOAA 1JYLA 2P72A 2Y4MA 3V8ZA 1VPAA 1ZJOA 4AAWA 3EE5A 3Q4SA 4G3PA 2ZU7A 5CQOA 2AESA 4EVWA 1H4DA 4FRLA 5CMHA 3T7OA 2I5KA 2RIYA 1H5SD 1HJJA 3OH1A 4Y7GA 4ECMA 1H5SB 5IDSA 3U2TA 1PZYB 3T7NA 1R7TA 2XMEA 5CMIA 2D0JA 2FYDB 2YQHA 2VS5A 2AM3A 1MC3A 1YP3A 5C4BA 1H4EA 1R80A 3OKRA 1VZUA 1S4PA 3U2WA 5FTVA 5C8RA 1ZI3A 2RJ9A 3U2XA 2X5SA 2AE7A 3PKPA 2NXVA 4KPZA 1R7VA 3CKOA 4FROA 3N9WA 4MIXA 1WT0A 5EJ1A 3I0FA 3K8EA 5L6VA 5J49A 1ZCVA 4HO4A 3V0NA 4HO8A 3CKNA 2DPWA 4KC2A 4KRVA 5CMFX 3SPTA 1QGSA 2V0LA 3I0IX 2D7IA 4FQWA 1IINA 3D98A 1LL0A 1G0RA 1S4OA 1TW1A 2VK9A 1VM8A 2YCMA 4HCQA 5I1FA 2VS4A 1JYKA 4M28A 4CVHA 4FIYA 1H3MA 4FRBA 3R3IA 4G87A 4HO3A 4UEGA 2J0AA 2V0JA 4KC1A 3ZLLA 4Q7CA 3OGZA 1FXOA 2I5EA 4E1KA 4B4MA 3SXDA 1ZJ1A 1LL3A 1R7UA 1G1LA 3V91A 1YP4A 3D8VA 2E3DA 4DECA 5C3BA 3FOQA 3LW6A 3E26A 5FTSA 1FR8A 1GWVA 4DDZA 2WGZA 4CJBA 1HV9A 4ZDQA 4HO5A 1YP2A 2OI7A 4IRPA 5IDTA 2QH5A 3F1YA 2Q4JA 1NKHB 2VFZA 4FCEA 1GQ9A 4Y9XA 5FV9A 1LL2A 2Y4KA 2JCKA 3RSBA 3I0LA 1ZCUA 3SXAA 1G23A 1NF5B 2W0VA 4FIXA 4FRHA 3DJ4A 5D91A 1O23B 4KQLA 2OEGA 4Y64A 1VGZA 1YROB 3SX3A 4AYLA 4EEGA 3SXBA 2YQCA 1QWJA 1G93A 5IFYA 4IRQA 1EYRA 2X5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T7M A;  1NQI B;  5CQP A;  2Y4J A;  1H7H A;  2O1G A;  1VGW A;  4G3Q A;  1LVW A;  2OEF A;  1LZ0 A;  4YS8 A;  5CMJ A;  4KXO A;  3CKQ A;  3V90 A;  4ARW A;  1ZJP A;  5FUH A;  1ZI5 A;  1ZCY A;  3IOJ A;  5FU8 A;  4KNX A;  1W77 A;  3V0M A;  4Y7T A;  3RMW A;  3NGW A;  2X65 A;  2RJ6 A;  4KNR A;  5FU0 A;  3U0Y A;  5CQN X;  4Y6U A;  1O7O A;  2Z86 A;  2A8U A;  3D5N A;  3U0X A;  2Y7A A;  4HO0 A;  2VS3 A;  1H5S C;  3I0H A;  3TZT A;  3KIA A;  4M2A A;  3Q80 A;  1H7Q A;  2YQS A;  2OI5 A;  1W57 A;  1LZJ A;  2ICY A;  3BCV A;  2VXL A;  1V83 A;  1FR9 A;  4FRA A;  4JIS A;  3GUE A;  2VD4 A;  1JV3 A;  1ZI4 A;  2D7R A;  1FGX A;  3JUK A;  2A8W A;  1GA8 A;  3USQ A;  3CKJ A;  4Y63 A;  5AJP A;  4J18 A;  5DDV A;  4B5B A;  2JCO A;  2AH9 A;  4NAN A;  3OC9 A;  1G8O A;  3IOI A;  1ZIZ A;  1V82 A;  2WVL A;  1HM9 A;  4R7P A;  4C2S A;  4D11 A;  2ZU8 A;  1HM0 A;  2O1F A;  1OMZ A;  1H5T A;  4EE5 A;  2VXM A;  1O7Q A;  3F1C A;  4B4B A;  3OAM A;  5C47 A;  1GWW A;  1G95 A;  1R7X A;  4G3S A;  3HL3 A;  1H7G A;  1H7L A;  4EEO A;  2BO6 A;  4B3U A;  4Y7V A;  1LZ7 A;  2RIT A;  2V0K A;  3SX8 A;  1ZHJ A;  5BXC A;  1IIM A;  4FRM A;  3U2U A;  5L6S A;  1GX0 A;  2ICX A;  4MND A;  1FGG A;  4B2X A;  5FYE A;  1WVC A;  4DE7 A;  3ZGF A;  1VZX A;  2PGV A;  5JQQ A;  2JCL A;  2YES A;  1H5R A;  2VSI A;  4FRE A;  3ZGG A;  4HO9 A;  4EEA A;  1G9R A;  3V0Q A;  5C48 A;  3SX5 A;  2CU2 A;  1INI A;  2WAW A;  4KC4 A;  3SXC A;  3I0G A;  1ZJ0 A;  3BRK X;  1GX4 A;  3I0E A;  3ZLK A;  3DUV A;  2ZU9 A;  1ON6 A;  1O0R A;  1WT1 A;  2WE9 A;  1QG8 A;  3I0J A;  1JVD A;  4ASY A;  1G2V A;  3SXG A;  4ASJ A;  5C1H A;  1FO8 A;  4XWI A;  1FZW A;  1XZ6 A;  2P73 A;  3E25 A;  4D48 A;  4Y6N A;  3DK5 A;  4Y7U A;  3I0C A;  1H5T B;  1W55 A;  2E8B A;  1OQM B;  5AJO A;  2FY7 A;  1NMM B;  2FYB A;  2Z87 A;  1EZI A;  5C1G A;  1LZI A;  4KPX A;  4KT7 A;  1I52 A;  1WSZ A;  5HS2 A;  4M4K A;  1H7T A;  1JV1 A;  1MP4 A;  2I7B A;  3PKQ A;  5C1L A;  4CJ8 A;  1ZCT A;  1OMX A;  1GQC A;  1HM8 A;  4NAL A;  4AYJ A;  1WT3 A;  2FFV A;  1H5R B;  2WVM A;  2FYC B;  2XMH A;  2Y4L A;  3TQD A;  3V8Y A;  1S4N A;  2APC A;  1JVG A;  4HO6 A;  5C4E A;  1QGQ A;  1R7Y A;  2YQJ A;  2RJ7 A;  3O3P A;  1HJL A;  1ON8 A;  2QKX A;  2WVK A;  2XWN A;  1SS9 A;  3SX7 A;  1ZDG A;  1NHE B;  4NAI A;  5C36 A;  1FRW A;  4EE4 A;  1TVY A;  1H4C A;  3U2V A;  2JCJ A;  4L41 C;  2QGI A;  2RJ5 A;  4P00 A;  2RIZ A;  3K8D A;  1K4V A;  2YC5 A;  3JTJ A;  1VZT A;  2X60 A;  4EE3 A;  3QVB A;  1FG5 N;  5CQL X;  5DDT A;  1KWS A;  4D0T A;  1INJ A;  2FFU A;  4FCU A;  4LW3 A;  5C4C A;  3USR A;  1VGU A;  3ST8 A;  1H7F A;  1V84 A;  3V0O A;  2RJ4 A;  2YC3 A;  3ZF8 A;  1VH3 A;  4CJC A;  3I0D A;  4HOC A;  4GBP A;  2O1H A;  2AM5 A;  4M2B A;  2XWL A;  2BO7 A;  2W0W A;  4FRQ A;  5EJZ A;  1H7E A;  4MYB A;  4FRD A;  1MP5 A;  5CQM X;  1FXJ A;  5C49 A;  5C3A A;  1G3L A;  5AJN A;  2BO4 A;  1ZI1 A;  2AM4 A;  4B4G A;  2PX7 A;  1FO9 A;  1VH1 A;  2WEE A;  2PA4 A;  3I0K A;  3R2W A;  2BO8 A;  1NWG B;  1FWY A;  2AEC A;  1PZT A;  1R82 A;  2OI6 A;  4LW6 A;  1G97 A;  2AGD A;  3OH3 A;  3OH4 A;  3SXE A;  2VSH A;  3PNN A;  2RJ1 A;  3JUJ A;  4K6R A;  4HO2 A;  1E5K A;  2UX8 A;  1VIC A;  4D0Z A;  2RJ0 A;  3CU0 A;  4BQH A;  5EIY A;  2FYA A;  2GGQ A;  4Y62 A;  1ZJ3 A;  2XWM A;  5C3D A;  2RJ8 A;  4AC3 A;  4HG6 A;  1TW5 A;  1H5S A;  1ZDF A;  2MZB A;  4BMA A;  1TZF A;  1MP3 A;  1ZJ2 A;  5C4F A;  4Y7F A;  3POL A;  4D11 C;  3V0P A;  4B2W A;  2RIX A;  4EEM A;  1WT2 A;  2Y6P A;  4FRP A;  4NAK A;  2P6W A;  5C38 A;  4P02 A;  1Z90 A;  2GGO A;  1VGT A;  3OH0 A;  2V0H A;  1R81 A;  5C4D A;  3IOH A;  3Q7U A;  2V0I A;  1XHB A;  3V0L A;  3CGX A;  2PGY A;  3FWW A;  4JD0 A;  4B42 A;  5CMG X;  3RMV A;  3CKV A;  3OH2 A;  1FOA A;  1JYL A;  2P72 A;  2Y4M A;  3V8Z A;  1VPA A;  1ZJO A;  4AAW A;  3EE5 A;  3Q4S A;  4G3P A;  2ZU7 A;  5CQO A;  2AES A;  4EVW A;  1H4D A;  4FRL A;  5CMH A;  3T7O A;  2I5K A;  2RIY A;  1H5S D;  1HJJ A;  3OH1 A;  4Y7G A;  4ECM A;  1H5S B;  5IDS A;  3U2T A;  1PZY B;  3T7N A;  1R7T A;  2XME A;  5CMI A;  2D0J A;  2FYD B;  2YQH A;  2VS5 A;  2AM3 A;  1MC3 A;  1YP3 A;  5C4B A;  1H4E A;  1R80 A;  3OKR A;  1VZU A;  1S4P A;  3U2W A;  5FTV A;  5C8R A;  1ZI3 A;  2RJ9 A;  3U2X A;  2X5S A;  2AE7 A;  3PKP A;  2NXV A;  4KPZ A;  1R7V A;  3CKO A;  4FRO A;  3N9W A;  1WT0 A;  5EJ1 A;  3I0F A;  3K8E A;  5L6V A;  5J49 A;  1ZCV A;  4HO4 A;  3V0N A;  4HO8 A;  3CKN A;  2DPW A;  4KC2 A;  4KRV A;  5CMF X;  3SPT A;  1QGS A;  2V0L A;  3I0I X;  2D7I A;  4FQW A;  1IIN A;  3D98 A;  1LL0 A;  1G0R A;  1S4O A;  1TW1 A;  5I1F A;  1VM8 A;  2YCM A;  4HCQ A;  2VS4 A;  1JYK A;  4M28 A;  4CVH A;  1H3M A;  4FRB A;  3R3I A;  4G87 A;  4HO3 A;  4UEG A;  2V0J A;  4KC1 A;  3ZLL A;  3OGZ A;  1FXO A;  2I5E A;  4E1K A;  4B4M A;  3SXD A;  1ZJ1 A;  1LL3 A;  1R7U A;  1G1L A;  3V91 A;  1YP4 A;  3D8V A;  2E3D A;  4DEC A;  5C3B A;  3FOQ A;  3LW6 A;  3E26 A;  5FTS A;  1FR8 A;  1GWV A;  4DDZ A;  2WGZ A;  4CJB A;  1HV9 A;  4ZDQ A;  4HO5 A;  1YP2 A;  2OI7 A;  4IRP A;  5IDT A;  2QH5 A;  3F1Y A;  2Q4J A;  1NKH B;  2VFZ A;  4FCE A;  1GQ9 A;  4Y9X A;  5FV9 A;  1LL2 A;  2Y4K A;  2JCK A;  3RSB A;  3I0L A;  1ZCU A;  3SXA A;  1G23 A;  1NF5 B;  2W0V A;  4FRH A;  3DJ4 A;  1O23 B;  4KQL A;  2OEG A;  4Y64 A;  1VGZ A;  1YRO B;  3SX3 A;  4AYL A;  4EEG A;  3SXB A;  2YQC A;  1QWJ A;  1G93 A;  5IFY A;  4IRQ A;  1EYR A;  2X5Z A; 
#chains in the Genus database with same CATH topology
 3T7M A;  1NQI B;  5CQP A;  2Y4J A;  1H7H A;  2O1G A;  1VGW A;  4G3Q A;  1LVW A;  2OEF A;  1LZ0 A;  4YS8 A;  5CMJ A;  4KXO A;  3CKQ A;  3V90 A;  4ARW A;  1ZJP A;  5FUH A;  1ZI5 A;  1ZCY A;  3IOJ A;  5FU8 A;  4KNX A;  1W77 A;  3V0M A;  4Y7T A;  3RMW A;  3NGW A;  2X65 A;  2RJ6 A;  4KNR A;  5FU0 A;  3U0Y A;  5CQN X;  4Y6U A;  1O7O A;  2Z86 A;  4O6N A;  2A8U A;  3D5N A;  3U0X A;  2Y7A A;  4HO0 A;  2VS3 A;  1H5S C;  3I0H A;  3TZT A;  3KIA A;  4M2A A;  3Q80 A;  1H7Q A;  2YQS A;  2OI5 A;  1W57 A;  1LZJ A;  2ICY A;  3BCV A;  2VXL A;  1V83 A;  1FR9 A;  4FRA A;  4JIS A;  3GUE A;  2VD4 A;  1JV3 A;  1ZI4 A;  2D7R A;  1FGX A;  3JUK A;  2A8W A;  1GA8 A;  3USQ A;  3CKJ A;  4Y63 A;  5AJP A;  2C0N A;  4J18 A;  5DDV A;  4B5B A;  2JCO A;  2AH9 A;  4NAN A;  3OC9 A;  1G8O A;  3IOI A;  1ZIZ A;  1V82 A;  2WVL A;  1HM9 A;  4R7P A;  4C2S A;  4D11 A;  2ZU8 A;  1HM0 A;  2O1F A;  1OMZ A;  1H5T A;  4EE5 A;  2VXM A;  1O7Q A;  3F1C A;  4B4B A;  3OAM A;  5C47 A;  1GWW A;  1G95 A;  1R7X A;  4G3S A;  3HL3 A;  1H7G A;  1H7L A;  4EEO A;  2BO6 A;  4B3U A;  4Y7V A;  1LZ7 A;  2RIT A;  2V0K A;  3SX8 A;  1ZHJ A;  5BXC A;  1IIM A;  4FRM A;  3U2U A;  5L6S A;  1GX0 A;  2ICX A;  4MND A;  1FGG A;  4B2X A;  5FYE A;  1WVC A;  4DE7 A;  3ZGF A;  1VZX A;  2PGV A;  5JQQ A;  2JCL A;  4O6M A;  2YES A;  1H5R A;  2VSI A;  4FRE A;  3ZGG A;  4HO9 A;  4EEA A;  1G9R A;  3V0Q A;  5C48 A;  3SX5 A;  2CU2 A;  1INI A;  2WAW A;  4KC4 A;  3SXC A;  3I0G A;  1ZJ0 A;  3BRK X;  1GX4 A;  3I0E A;  3ZLK A;  3DUV A;  2ZU9 A;  1ON6 A;  1O0R A;  1WT1 A;  2WE9 A;  1QG8 A;  3I0J A;  1JVD A;  4ASY A;  1G2V A;  3SXG A;  4ASJ A;  5C1H A;  1FO8 A;  4XWI A;  1FZW A;  1XZ6 A;  2P73 A;  3E25 A;  4D48 A;  4Y6N A;  3DK5 A;  4Y7U A;  3I0C A;  1H5T B;  1W55 A;  2E8B A;  1OQM B;  5AJO A;  2FY7 A;  1NMM B;  2FYB A;  2Z87 A;  1EZI A;  5C1G A;  1LZI A;  4KPX A;  4KT7 A;  1I52 A;  1WSZ A;  5HS2 A;  4M4K A;  1H7T A;  1JV1 A;  1MP4 A;  2I7B A;  3PKQ A;  5C1L A;  4CJ8 A;  2J0B A;  1ZCT A;  1OMX A;  1GQC A;  1HM8 A;  4NAL A;  4AYJ A;  1WT3 A;  2FFV A;  1H5R B;  2WVM A;  2FYC B;  2XMH A;  2Y4L A;  3TQD A;  3V8Y A;  1S4N A;  2APC A;  1JVG A;  4HO6 A;  5C4E A;  1QGQ A;  1R7Y A;  2YQJ A;  2RJ7 A;  3O3P A;  1HJL A;  1ON8 A;  2QKX A;  2WVK A;  2XWN A;  1SS9 A;  3SX7 A;  1ZDG A;  1NHE B;  4NAI A;  5C36 A;  1FRW A;  4EE4 A;  1TVY A;  1H4C A;  3U2V A;  2JCJ A;  4L41 C;  2QGI A;  2RJ5 A;  4P00 A;  2RIZ A;  3K8D A;  1K4V A;  2YC5 A;  3JTJ A;  1VZT A;  5D92 A;  2X60 A;  4EE3 A;  3QVB A;  1FG5 N;  5CQL X;  5DDT A;  1KWS A;  4D0T A;  1INJ A;  2FFU A;  4FCU A;  4LW3 A;  5C4C A;  3USR A;  1VGU A;  3ST8 A;  1H7F A;  1V84 A;  3V0O A;  2RJ4 A;  2YC3 A;  3ZF8 A;  1VH3 A;  4CJC A;  3I0D A;  4HOC A;  4GBP A;  2O1H A;  2AM5 A;  4M2B A;  2XWL A;  2BO7 A;  2W0W A;  4FRQ A;  5EJZ A;  1H7E A;  4MYB A;  4FRD A;  1MP5 A;  5CQM X;  1FXJ A;  5C49 A;  5C3A A;  1G3L A;  5AJN A;  2BO4 A;  1ZI1 A;  2AM4 A;  4B4G A;  2PX7 A;  1FO9 A;  1VH1 A;  2WEE A;  2PA4 A;  3I0K A;  3R2W A;  2BO8 A;  1NWG B;  1FWY A;  2AEC A;  1PZT A;  1R82 A;  2OI6 A;  4LW6 A;  1G97 A;  2AGD A;  3OH3 A;  3OH4 A;  3SXE A;  2VSH A;  3PNN A;  2RJ1 A;  3JUJ A;  4K6R A;  4HO2 A;  1E5K A;  2UX8 A;  1VIC A;  4D0Z A;  2RJ0 A;  3CU0 A;  4BQH A;  5EIY A;  2FYA A;  2GGQ A;  4Y62 A;  1ZJ3 A;  2XWM A;  5C3D A;  2RJ8 A;  4AC3 A;  4HG6 A;  1TW5 A;  1H5S A;  1ZDF A;  2MZB A;  4BMA A;  1TZF A;  1MP3 A;  1ZJ2 A;  5C4F A;  4Y7F A;  3POL A;  4D11 C;  3V0P A;  4B2W A;  2RIX A;  4EEM A;  1WT2 A;  2Y6P A;  4FRP A;  4NAK A;  2P6W A;  5C38 A;  4P02 A;  1Z90 A;  2GGO A;  1VGT A;  3OH0 A;  2V0H A;  1R81 A;  5C4D A;  3IOH A;  3Q7U A;  2V0I A;  1XHB A;  3V0L A;  3CGX A;  2PGY A;  3FWW A;  4JD0 A;  4B42 A;  5CMG X;  3RMV A;  3CKV A;  3OH2 A;  1FOA A;  1JYL A;  2P72 A;  2Y4M A;  3V8Z A;  1VPA A;  1ZJO A;  4AAW A;  3EE5 A;  3Q4S A;  4G3P A;  2ZU7 A;  5CQO A;  2AES A;  4EVW A;  1H4D A;  4FRL A;  5CMH A;  3T7O A;  2I5K A;  2RIY A;  1H5S D;  1HJJ A;  3OH1 A;  4Y7G A;  4ECM A;  1H5S B;  5IDS A;  3U2T A;  1PZY B;  3T7N A;  1R7T A;  2XME A;  5CMI A;  2D0J A;  2FYD B;  2YQH A;  2VS5 A;  2AM3 A;  1MC3 A;  1YP3 A;  5C4B A;  1H4E A;  1R80 A;  3OKR A;  1VZU A;  1S4P A;  3U2W A;  5FTV A;  5C8R A;  1ZI3 A;  2RJ9 A;  3U2X A;  2X5S A;  2AE7 A;  3PKP A;  2NXV A;  4KPZ A;  1R7V A;  3CKO A;  4FRO A;  3N9W A;  4MIX A;  1WT0 A;  5EJ1 A;  3I0F A;  3K8E A;  5L6V A;  5J49 A;  1ZCV A;  4HO4 A;  3V0N A;  4HO8 A;  3CKN A;  2DPW A;  4KC2 A;  4KRV A;  5CMF X;  3SPT A;  1QGS A;  2V0L A;  3I0I X;  2D7I A;  4FQW A;  1IIN A;  3D98 A;  1LL0 A;  1G0R A;  1S4O A;  1TW1 A;  2VK9 A;  1VM8 A;  2YCM A;  4HCQ A;  5I1F A;  2VS4 A;  1JYK A;  4M28 A;  4CVH A;  4FIY A;  1H3M A;  4FRB A;  3R3I A;  4G87 A;  4HO3 A;  4UEG A;  2J0A A;  2V0J A;  4KC1 A;  3ZLL A;  4Q7C A;  3OGZ A;  1FXO A;  2I5E A;  4E1K A;  4B4M A;  3SXD A;  1ZJ1 A;  1LL3 A;  1R7U A;  1G1L A;  3V91 A;  1YP4 A;  3D8V A;  2E3D A;  4DEC A;  5C3B A;  3FOQ A;  3LW6 A;  3E26 A;  5FTS A;  1FR8 A;  1GWV A;  4DDZ A;  2WGZ A;  4CJB A;  1HV9 A;  4ZDQ A;  4HO5 A;  1YP2 A;  2OI7 A;  4IRP A;  5IDT A;  2QH5 A;  3F1Y A;  2Q4J A;  1NKH B;  2VFZ A;  4FCE A;  1GQ9 A;  4Y9X A;  5FV9 A;  1LL2 A;  2Y4K A;  2JCK A;  3RSB A;  3I0L A;  1ZCU A;  3SXA A;  1G23 A;  1NF5 B;  2W0V A;  4FIX A;  4FRH A;  3DJ4 A;  5D91 A;  1O23 B;  4KQL A;  2OEG A;  4Y64 A;  1VGZ A;  1YRO B;  3SX3 A;  4AYL A;  4EEG A;  3SXB A;  2YQC A;  1QWJ A;  1G93 A;  5IFY A;  4IRQ A;  1EYR A;  2X5Z A; 
#chains in the Genus database with same CATH homology
 3T7M A;  1NQI B;  5CQP A;  2Y4J A;  1H7H A;  2O1G A;  1VGW A;  4G3Q A;  1LVW A;  2OEF A;  1LZ0 A;  4YS8 A;  5CMJ A;  4KXO A;  3CKQ A;  3V90 A;  4ARW A;  1ZJP A;  5FUH A;  1ZI5 A;  1ZCY A;  3IOJ A;  5FU8 A;  4KNX A;  1W77 A;  3V0M A;  4Y7T A;  3RMW A;  3NGW A;  2X65 A;  2RJ6 A;  4KNR A;  5FU0 A;  3U0Y A;  5CQN X;  4Y6U A;  1O7O A;  2Z86 A;  4O6N A;  2A8U A;  3D5N A;  3U0X A;  2Y7A A;  4HO0 A;  2VS3 A;  1H5S C;  3I0H A;  3TZT A;  3KIA A;  4M2A A;  3Q80 A;  1H7Q A;  2YQS A;  2OI5 A;  1W57 A;  1LZJ A;  2ICY A;  3BCV A;  2VXL A;  1V83 A;  1FR9 A;  4FRA A;  4JIS A;  3GUE A;  2VD4 A;  1JV3 A;  1ZI4 A;  2D7R A;  1FGX A;  3JUK A;  2A8W A;  1GA8 A;  3USQ A;  3CKJ A;  4Y63 A;  5AJP A;  2C0N A;  4J18 A;  5DDV A;  4B5B A;  2JCO A;  2AH9 A;  4NAN A;  3OC9 A;  1G8O A;  3IOI A;  1ZIZ A;  1V82 A;  2WVL A;  1HM9 A;  4R7P A;  4C2S A;  4D11 A;  2ZU8 A;  1HM0 A;  2O1F A;  1OMZ A;  1H5T A;  4EE5 A;  2VXM A;  1O7Q A;  3F1C A;  4B4B A;  3OAM A;  5C47 A;  1GWW A;  1G95 A;  1R7X A;  4G3S A;  3HL3 A;  1H7G A;  1H7L A;  4EEO A;  2BO6 A;  4B3U A;  4Y7V A;  1LZ7 A;  2RIT A;  2V0K A;  3SX8 A;  1ZHJ A;  5BXC A;  1IIM A;  4FRM A;  3U2U A;  5L6S A;  1GX0 A;  2ICX A;  4MND A;  1FGG A;  4B2X A;  5FYE A;  1WVC A;  4DE7 A;  3ZGF A;  1VZX A;  2PGV A;  5JQQ A;  2JCL A;  4O6M A;  2YES A;  1H5R A;  2VSI A;  4FRE A;  3ZGG A;  4HO9 A;  4EEA A;  1G9R A;  3V0Q A;  5C48 A;  3SX5 A;  2CU2 A;  1INI A;  2WAW A;  4KC4 A;  3SXC A;  3I0G A;  1ZJ0 A;  3BRK X;  1GX4 A;  3I0E A;  3ZLK A;  3DUV A;  2ZU9 A;  1ON6 A;  1O0R A;  1WT1 A;  2WE9 A;  1QG8 A;  3I0J A;  1JVD A;  4ASY A;  1G2V A;  3SXG A;  4ASJ A;  5C1H A;  1FO8 A;  4XWI A;  1FZW A;  1XZ6 A;  2P73 A;  3E25 A;  4D48 A;  4Y6N A;  3DK5 A;  4Y7U A;  3I0C A;  1H5T B;  1W55 A;  2E8B A;  1OQM B;  5AJO A;  2FY7 A;  1NMM B;  2FYB A;  2Z87 A;  1EZI A;  5C1G A;  1LZI A;  4KPX A;  4KT7 A;  1I52 A;  1WSZ A;  5HS2 A;  4M4K A;  1H7T A;  1JV1 A;  1MP4 A;  2I7B A;  3PKQ A;  5C1L A;  4CJ8 A;  2J0B A;  1ZCT A;  1OMX A;  1GQC A;  1HM8 A;  4NAL A;  4AYJ A;  1WT3 A;  2FFV A;  1H5R B;  2WVM A;  2FYC B;  2XMH A;  2Y4L A;  3TQD A;  3V8Y A;  1S4N A;  2APC A;  1JVG A;  4HO6 A;  5C4E A;  1QGQ A;  1R7Y A;  2YQJ A;  2RJ7 A;  3O3P A;  1HJL A;  1ON8 A;  2QKX A;  2WVK A;  2XWN A;  1SS9 A;  3SX7 A;  1ZDG A;  1NHE B;  4NAI A;  5C36 A;  1FRW A;  4EE4 A;  1TVY A;  1H4C A;  3U2V A;  2JCJ A;  4L41 C;  2QGI A;  2RJ5 A;  4P00 A;  2RIZ A;  3K8D A;  1K4V A;  2YC5 A;  3JTJ A;  1VZT A;  5D92 A;  2X60 A;  4EE3 A;  3QVB A;  1FG5 N;  5CQL X;  5DDT A;  1KWS A;  4D0T A;  1INJ A;  2FFU A;  4FCU A;  4LW3 A;  5C4C A;  3USR A;  1VGU A;  3ST8 A;  1H7F A;  1V84 A;  3V0O A;  2RJ4 A;  2YC3 A;  3ZF8 A;  1VH3 A;  4CJC A;  3I0D A;  4HOC A;  4GBP A;  2O1H A;  2AM5 A;  4M2B A;  2XWL A;  2BO7 A;  2W0W A;  4FRQ A;  5EJZ A;  1H7E A;  4MYB A;  4FRD A;  1MP5 A;  5CQM X;  1FXJ A;  5C49 A;  5C3A A;  1G3L A;  5AJN A;  2BO4 A;  1ZI1 A;  2AM4 A;  4B4G A;  2PX7 A;  1FO9 A;  1VH1 A;  2WEE A;  2PA4 A;  3I0K A;  3R2W A;  2BO8 A;  1NWG B;  1FWY A;  2AEC A;  1PZT A;  1R82 A;  2OI6 A;  4LW6 A;  1G97 A;  2AGD A;  3OH3 A;  3OH4 A;  3SXE A;  2VSH A;  3PNN A;  2RJ1 A;  3JUJ A;  4K6R A;  4HO2 A;  1E5K A;  2UX8 A;  1VIC A;  4D0Z A;  2RJ0 A;  3CU0 A;  4BQH A;  5EIY A;  2FYA A;  2GGQ A;  4Y62 A;  1ZJ3 A;  2XWM A;  5C3D A;  2RJ8 A;  4AC3 A;  4HG6 A;  1TW5 A;  1H5S A;  1ZDF A;  2MZB A;  4BMA A;  1TZF A;  1MP3 A;  1ZJ2 A;  5C4F A;  4Y7F A;  3POL A;  4D11 C;  3V0P A;  4B2W A;  2RIX A;  4EEM A;  1WT2 A;  2Y6P A;  4FRP A;  4NAK A;  2P6W A;  5C38 A;  4P02 A;  1Z90 A;  2GGO A;  1VGT A;  3OH0 A;  2V0H A;  1R81 A;  5C4D A;  3IOH A;  3Q7U A;  2V0I A;  1XHB A;  3V0L A;  3CGX A;  2PGY A;  3FWW A;  4JD0 A;  4B42 A;  5CMG X;  3RMV A;  3CKV A;  3OH2 A;  1FOA A;  1JYL A;  2P72 A;  2Y4M A;  3V8Z A;  1VPA A;  1ZJO A;  4AAW A;  3EE5 A;  3Q4S A;  4G3P A;  2ZU7 A;  5CQO A;  2AES A;  4EVW A;  1H4D A;  4FRL A;  5CMH A;  3T7O A;  2I5K A;  2RIY A;  1H5S D;  1HJJ A;  3OH1 A;  4Y7G A;  4ECM A;  1H5S B;  5IDS A;  3U2T A;  1PZY B;  3T7N A;  1R7T A;  2XME A;  5CMI A;  2D0J A;  2FYD B;  2YQH A;  2VS5 A;  2AM3 A;  1MC3 A;  1YP3 A;  5C4B A;  1H4E A;  1R80 A;  3OKR A;  1VZU A;  1S4P A;  3U2W A;  5FTV A;  5C8R A;  1ZI3 A;  2RJ9 A;  3U2X A;  2X5S A;  2AE7 A;  3PKP A;  2NXV A;  4KPZ A;  1R7V A;  3CKO A;  4FRO A;  3N9W A;  4MIX A;  1WT0 A;  5EJ1 A;  3I0F A;  3K8E A;  5L6V A;  5J49 A;  1ZCV A;  4HO4 A;  3V0N A;  4HO8 A;  3CKN A;  2DPW A;  4KC2 A;  4KRV A;  5CMF X;  3SPT A;  1QGS A;  2V0L A;  3I0I X;  2D7I A;  4FQW A;  1IIN A;  3D98 A;  1LL0 A;  1G0R A;  1S4O A;  1TW1 A;  2VK9 A;  1VM8 A;  2YCM A;  4HCQ A;  5I1F A;  2VS4 A;  1JYK A;  4M28 A;  4CVH A;  4FIY A;  1H3M A;  4FRB A;  3R3I A;  4G87 A;  4HO3 A;  4UEG A;  2J0A A;  2V0J A;  4KC1 A;  3ZLL A;  4Q7C A;  3OGZ A;  1FXO A;  2I5E A;  4E1K A;  4B4M A;  3SXD A;  1ZJ1 A;  1LL3 A;  1R7U A;  1G1L A;  3V91 A;  1YP4 A;  3D8V A;  2E3D A;  4DEC A;  5C3B A;  3FOQ A;  3LW6 A;  3E26 A;  5FTS A;  1FR8 A;  1GWV A;  4DDZ A;  2WGZ A;  4CJB A;  1HV9 A;  4ZDQ A;  4HO5 A;  1YP2 A;  2OI7 A;  4IRP A;  5IDT A;  2QH5 A;  3F1Y A;  2Q4J A;  1NKH B;  2VFZ A;  4FCE A;  1GQ9 A;  4Y9X A;  5FV9 A;  1LL2 A;  2Y4K A;  2JCK A;  3RSB A;  3I0L A;  1ZCU A;  3SXA A;  1G23 A;  1NF5 B;  2W0V A;  4FIX A;  4FRH A;  3DJ4 A;  5D91 A;  1O23 B;  4KQL A;  2OEG A;  4Y64 A;  1VGZ A;  1YRO B;  3SX3 A;  4AYL A;  4EEG A;  3SXB A;  2YQC A;  1QWJ A;  1G93 A;  5IFY A;  4IRQ A;  1EYR A;  2X5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...