3T7NA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
254
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 254
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3t7nA00
1H7EA 1TW5A 1VZUA 3K8DA 5CMGX 1R7VA 3R3IA 2ZU9A 4HG6A 2VD4A 2YQSA 3SXAA 3CKVA 1G23A 1H5RA 4DDZA 5CMIA 5CQMX 1H5SD 2ZU7A 5CQNX 2AE7A 1H7GA 4KNRA 2Q4JA 5C4FA 3SX8A 3OH2A 5CMJA 1VGUA 1GWWA 1JV1A 4Y9XA 2VS3A 4KC1A 4C2SA 4Y7TA 1FRWA 2YC3A 1YP2A 4FRBA 2E8BA 5FUHA 1OQMB 2CU2A 3O3PA 3OC9A 1R80A 5C1GA 4ECMA 3U2UA 1SS9A 2JCOA 3CKNA 1O23B 1H7TA 3QVBA 4ARWA 1R7XA 1NHEB 2MZBA 5C38A 4P02A 1LL2A 1TVYA 4NALA 4KNXA 2QKXA 2PA4A 3N9WA 2GGOA 5IDSA 2DPWA 5C48A 2WVMA 2WVLA 2VSHA 5AJNA 1W55A 1G95A 5C3DA 4NAIA 4B2WA 3DJ4A 1H7HA 1V82A 2FFVA 5CQPA 4LW3A 1W77A 5CMHA 3GUEA 1GX4A 1S4PA 3IOHA 4CVHA 1INIA 1S4OA 3DK5A 1V83A 1HM0A 3OH4A 1FG5N 1H4CA 1JYLA 2X5SA 3SXBA 3I0GA 1H5RB 1R7UA 1MP5A 2GGQA 2V0IA 4KC4A 4Y6UA 3Q4SA 4B4GA 1XHBA 3I0IX 5C3BA 4HOCA 3K8EA 4BMAA 3I0KA 4EE3A 1YP4A 4UEGA 2AESA 5FU0A 2O1FA 1ZJPA 5C8RA 1LZJA 3PNNA 3IOJA 3CKQA 5IDTA 1QWJA 3ZLLA 2RJ4A 2V0JA 4HO3A 4HO4A 4FREA 2Z87A 2I7BA 1WT2A 1FR9A 5CQOA 3PKPA 2BO4A 2UX8A 2PGYA 2JCJA 3V8ZA 4FROA 3E25A 1MP4A 3USRA 1GWVA 1VH1A 3ZLKA 1H7FA 5EIYA 4R7PA 3ST8A 1NKHB 4HO9A 1ZHJA 2BO6A 3OH3A 4CJ8A 1QG8A 1NWGB 1VGZA 1ZDFA 4AAWA 4FCEA 5FYEA 2OEGA 1H4EA 5BXCA 1K4VA 1ZI1A 1IINA 4KXOA 2E3DA 4MNDA 4HCQA 4AC3A 1EYRA 2YC5A 4B5BA 1S4NA 2YQHA 3V0OA 4HO8A 2RIXA 3CKJA 3NGWA 3SPTA 1GA8A 2X65A 2XMHA 3OGZA 2NXVA 1ZJ0A 1G3LA 4B4BA 4MYBA 1NQIB 2VSIA 3OAMA 2V0HA 3BRKX 2XMEA 4FRHA 1INJA 4D48A 2X5ZA 1FXOA 4HO5A 1FWYA 1H5SB 4M2BA 2Y4LA 2Y6PA 4G3QA 3I0DA 4K6RA 4D0ZA 4EEGA 2RITA 3V0PA 3I0JA 3V91A 4NAKA 4FRDA 4XWIA 1JV3A 3V0MA 4EEOA 5JQQA 2OI6A 4G3PA 4G3SA 4D0TA 4B4MA 2PX7A 3IOIA 1GQCA 3RMVA 3TQDA 4E1KA 1JYKA 1TW1A 5I1FA 1ZIZA 3SXCA 1YP3A 2RJ5A 4ASYA 3ZGFA 4EE4A 5FU8A 2V0KA 3V8YA 2PGVA 5AJPA 3JTJA 1FOAA 1Z90A 4IRQA 1O7OA 4FCUA 5EJ1A 1G8OA 4Y7VA 1R81A 2ICXA 2D0JA 3SXDA 4D11C 2Y4MA 4Y63A 1ZI3A 5C4DA 1G2VA 1FGXA 1LZIA 3ZF8A 2YQJA 4KT7A 4EVWA 4M28A 1LZ7A 4L41C 2AM4A 1NF5B 1V84A 4DECA 2RJ8A 1VPAA 1VM8A 2I5KA 1HM9A 1O7QA 1H7QA 2VS5A 3D5NA 1GQ9A 5CQLX 4NANA 4AYLA 2OI5A 2AH9A 2VFZA 4Y7UA 1LL3A 3TZTA 4FRAA 3DUVA 2JCLA 1OMZA 4CJCA 4DE7A 3OH1A 5FTSA 2O1HA 1H3MA 3SX5A 2XWNA 1QGQA 4FRLA 2JCKA 1PZTA 2VXLA 4Y6NA 5FTVA 4CJBA 2D7RA 3F1CA 2WVKA 1HJJA 4HO2A 2AGDA 1JVDA 1FXJA 2FYAA 3HL3A 4FQWA 3CKOA 2P72A 4KQLA 3SX3A 4Y64A 1ZJ2A 3USQA 2RJ6A 2WEEA 3JUJA 3Q80A 4D11A 2RJ7A 3I0FA 1H5TA 1QGSA 1E5KA 2ICYA 2W0VA 2Y4JA 4FRPA 2WGZA 5C47A 1NMMB 2W0WA 1LZ0A 3E26A 1YROB 1VZTA 1WT3A 3JUKA 2OI7A 2A8UA 2AM3A 3V0LA 1I52A 3I0EA 3V90A 1ZCVA 1H5SC 5EJZA 2D7IA 1FGGA 4M2AA 2P6WA 1WVCA 2AECA 1FO9A 4AYJA 4G87A 3U0YA 1LVWA 5HS2A 1G93A 2XWMA 3V0NA 3D98A 1G0RA 1GX0A 4EE5A 3I0HA 4KPXA 4EEAA 2YESA 3CGXA 4HO6A 4J18A 3T7MA 1O0RA 2QGIA 4KC2A 1R82A 2P73A 5C3AA 3OH0A 3U2XA 1W57A 2Z86A 2Y4KA 4ASJA 1ON6A 1VGTA 2RJ1A 5C1LA 1FO8A 4B2XA 1ZJ3A 4FRQA 2RIZA 4IRPA 3T7NA 1ON8A 1ZDGA 5C4EA 1LL0A 1H5TB 2BO7A 2O1GA 4KRVA 1FR8A 1XZ6A 1G97A 5AJOA 2QH5A 2ZU8A 2FYBA 5DDTA 3ZGGA 2V0LA 1WSZA 4BQHA 1R7TA 2WAWA 4M4KA 4Y62A 1IIMA 2YCMA 5J49A 4ZDQA 4B42A 3U2WA 1H5SA 4P00A 1WT0A 3I0LA 1VICA 2RIYA 2OEFA 3U0XA 1MP3A 1WT1A 3U2TA 3U2VA 1MC3A 1ZJ1A 2AM5A 5C1HA 2FYDB 1PZYB 1JVGA 2RJ9A 4Y7GA 5CMFX 5DDVA 2FY7A 2X60A 1KWSA 3RMWA 2BO8A 3RSBA 3LW6A 5C49A 1HJLA 1ZI4A 4B3UA 2FYCB 1ZI5A 4HO0A 3SXGA 2A8WA 3V0QA 2APCA 5L6SA 1ZCYA 3I0CA 3OKRA 1VZXA 2VS4A 2I5EA 3F1YA 3PKQA 1ZCUA 3R2WA 3KIAA 3Q7UA 3SX7A 1FZWA 1R7YA 4YS8A 5C36A 4FRMA 1OMXA 2Y7AA 4JISA 5C4BA 4Y7FA 1HV9A 3SXEA 2YQCA 5FV9A 4JD0A 5L6VA 4KPZA 3D8VA 3EE5A 3FWWA 3POLA 3T7OA 2VXMA 1TZFA 1VH3A 2RJ0A 2XWLA 1ZJOA 1VGWA 5C4CA 5IFYA 4EEMA 1EZIA 4LW6A 1HM8A 3FOQA 1H7LA 4GBPA 1G9RA 2FFUA 1G1LA 3CU0A 3BCVA 2WE9A 1ZCTA 1H4DA
chains in the Genus database with same CATH superfamily
1H7EA 1TW5A 1VZUA 3K8DA 5CMGX 1R7VA 3R3IA 4MIXA 2ZU9A 4HG6A 2VD4A 2YQSA 3SXAA 3CKVA 1G23A 1H5RA 4DDZA 5CMIA 2J0BA 5CQMX 1H5SD 2ZU7A 5CQNX 2AE7A 1H7GA 4KNRA 2Q4JA 5C4FA 3SX8A 3OH2A 5CMJA 1VGUA 1GWWA 1JV1A 4Y9XA 2VS3A 4KC1A 4C2SA 4Y7TA 1FRWA 2YC3A 5D92A 1YP2A 4FRBA 2E8BA 5FUHA 1OQMB 2CU2A 3O3PA 3OC9A 1R80A 5C1GA 4ECMA 3U2UA 1SS9A 2JCOA 3CKNA 1O23B 1H7TA 3QVBA 4ARWA 1R7XA 1NHEB 2MZBA 5C38A 4P02A 1LL2A 1TVYA 4NALA 4KNXA 2QKXA 2PA4A 3N9WA 2GGOA 5IDSA 2DPWA 5C48A 2WVMA 2WVLA 2VSHA 5AJNA 1W55A 1G95A 5C3DA 4NAIA 4B2WA 3DJ4A 1H7HA 1V82A 2FFVA 5CQPA 4LW3A 1W77A 5CMHA 3GUEA 1GX4A 1S4PA 3IOHA 4FIYA 4CVHA 1INIA 1S4OA 3DK5A 1V83A 1HM0A 3OH4A 1FG5N 1H4CA 1JYLA 2X5SA 3SXBA 3I0GA 1H5RB 4Q7CA 1R7UA 1MP5A 2GGQA 2V0IA 4KC4A 4Y6UA 3Q4SA 4B4GA 1XHBA 3I0IX 5C3BA 4HOCA 3K8EA 4BMAA 3I0KA 4EE3A 1YP4A 4UEGA 2AESA 5FU0A 2O1FA 1ZJPA 5C8RA 1LZJA 3PNNA 3IOJA 3CKQA 5IDTA 1QWJA 3ZLLA 2RJ4A 2V0JA 4HO3A 4HO4A 4FREA 2Z87A 2I7BA 1WT2A 1FR9A 5CQOA 3PKPA 2BO4A 2UX8A 2PGYA 2JCJA 2C0NA 3V8ZA 4FROA 3E25A 1MP4A 3USRA 1GWVA 1VH1A 3ZLKA 1H7FA 5EIYA 4R7PA 3ST8A 1NKHB 4HO9A 1ZHJA 2BO6A 3OH3A 4CJ8A 1QG8A 1NWGB 1VGZA 1ZDFA 4AAWA 4FCEA 5FYEA 2OEGA 1H4EA 5BXCA 1K4VA 1ZI1A 1IINA 2VK9A 4KXOA 2E3DA 4MNDA 4HCQA 4AC3A 1EYRA 2YC5A 4B5BA 1S4NA 2YQHA 3V0OA 4HO8A 2RIXA 3CKJA 3NGWA 3SPTA 1GA8A 2X65A 2XMHA 3OGZA 2NXVA 1ZJ0A 1G3LA 4B4BA 4MYBA 1NQIB 2VSIA 3OAMA 2V0HA 3BRKX 2XMEA 4FRHA 1INJA 4D48A 2X5ZA 1FXOA 4HO5A 1FWYA 1H5SB 4M2BA 2Y4LA 2Y6PA 4G3QA 3I0DA 4K6RA 4D0ZA 4EEGA 2RITA 3V0PA 3I0JA 3V91A 4NAKA 4FRDA 4XWIA 1JV3A 3V0MA 4EEOA 5JQQA 2OI6A 4G3PA 4G3SA 4D0TA 4B4MA 2PX7A 3IOIA 1GQCA 3RMVA 3TQDA 2J0AA 4E1KA 1JYKA 1TW1A 5I1FA 1ZIZA 3SXCA 1YP3A 2RJ5A 4ASYA 3ZGFA 4EE4A 5FU8A 2V0KA 3V8YA 2PGVA 5AJPA 3JTJA 1FOAA 1Z90A 4IRQA 1O7OA 4FCUA 5EJ1A 1G8OA 4Y7VA 1R81A 2ICXA 2D0JA 3SXDA 4D11C 2Y4MA 4Y63A 1ZI3A 5C4DA 1G2VA 1FGXA 1LZIA 3ZF8A 2YQJA 4KT7A 4EVWA 4M28A 1LZ7A 4L41C 2AM4A 1NF5B 1V84A 4DECA 2RJ8A 1VPAA 1VM8A 2I5KA 1HM9A 1O7QA 1H7QA 2VS5A 3D5NA 1GQ9A 5CQLX 4NANA 4AYLA 2OI5A 2AH9A 2VFZA 4Y7UA 1LL3A 3TZTA 4FRAA 3DUVA 2JCLA 1OMZA 4CJCA 4DE7A 3OH1A 5FTSA 2O1HA 1H3MA 3SX5A 2XWNA 1QGQA 4FRLA 2JCKA 1PZTA 2VXLA 4Y6NA 5FTVA 4CJBA 2D7RA 3F1CA 2WVKA 1HJJA 5D91A 4HO2A 2AGDA 1JVDA 1FXJA 2FYAA 3HL3A 4FQWA 3CKOA 2P72A 4KQLA 3SX3A 4Y64A 1ZJ2A 3USQA 2RJ6A 2WEEA 3JUJA 3Q80A 4D11A 2RJ7A 3I0FA 1H5TA 1QGSA 1E5KA 2ICYA 2W0VA 2Y4JA 4FRPA 2WGZA 5C47A 1NMMB 2W0WA 1LZ0A 3E26A 1YROB 1VZTA 1WT3A 3JUKA 2OI7A 2A8UA 2AM3A 3V0LA 1I52A 3I0EA 3V90A 1ZCVA 1H5SC 5EJZA 2D7IA 1FGGA 4M2AA 2P6WA 1WVCA 2AECA 1FO9A 4AYJA 4G87A 3U0YA 1LVWA 5HS2A 1G93A 2XWMA 3V0NA 3D98A 1G0RA 1GX0A 4EE5A 3I0HA 4KPXA 4EEAA 2YESA 3CGXA 4HO6A 4J18A 3T7MA 1O0RA 2QGIA 4KC2A 1R82A 2P73A 5C3AA 3OH0A 3U2XA 1W57A 2Z86A 2Y4KA 4ASJA 1ON6A 1VGTA 2RJ1A 5C1LA 1FO8A 4B2XA 1ZJ3A 4FRQA 2RIZA 4IRPA 3T7NA 1ON8A 1ZDGA 5C4EA 1LL0A 1H5TB 2BO7A 2O1GA 4FIXA 4KRVA 1FR8A 1XZ6A 1G97A 5AJOA 2QH5A 2ZU8A 2FYBA 5DDTA 3ZGGA 2V0LA 1WSZA 4BQHA 1R7TA 2WAWA 4M4KA 4Y62A 1IIMA 2YCMA 5J49A 4ZDQA 4B42A 3U2WA 1H5SA 4P00A 1WT0A 3I0LA 1VICA 2RIYA 2OEFA 3U0XA 1MP3A 1WT1A 3U2TA 3U2VA 1MC3A 1ZJ1A 2AM5A 5C1HA 2FYDB 1PZYB 1JVGA 2RJ9A 4Y7GA 5CMFX 5DDVA 2FY7A 2X60A 1KWSA 3RMWA 2BO8A 3RSBA 3LW6A 5C49A 1HJLA 1ZI4A 4B3UA 2FYCB 1ZI5A 4HO0A 3SXGA 2A8WA 3V0QA 2APCA 4O6MA 5L6SA 1ZCYA 3I0CA 3OKRA 1VZXA 2VS4A 2I5EA 3F1YA 3PKQA 1ZCUA 3R2WA 3KIAA 3Q7UA 3SX7A 4O6NA 1FZWA 1R7YA 4YS8A 5C36A 4FRMA 1OMXA 2Y7AA 4JISA 5C4BA 4Y7FA 1HV9A 3SXEA 2YQCA 5FV9A 4JD0A 5L6VA 4KPZA 3D8VA 3EE5A 3FWWA 3POLA 3T7OA 2VXMA 1TZFA 1VH3A 2RJ0A 2XWLA 1ZJOA 1VGWA 5C4CA 5IFYA 4EEMA 1EZIA 4LW6A 1HM8A 3FOQA 1H7LA 4GBPA 1G9RA 2FFUA 1G1LA 3CU0A 3BCVA 2WE9A 1ZCTA 1H4DA
chains in the Genus database with same CATH topology
1H7EA 1TW5A 1VZUA 3K8DA 5CMGX 1R7VA 3R3IA 4MIXA 2ZU9A 4HG6A 2VD4A 2YQSA 3SXAA 3CKVA 1G23A 1H5RA 4DDZA 5CMIA 2J0BA 5CQMX 1H5SD 2ZU7A 5CQNX 2AE7A 1H7GA 4KNRA 2Q4JA 5C4FA 3SX8A 3OH2A 5CMJA 1VGUA 1GWWA 1JV1A 4Y9XA 2VS3A 4KC1A 4C2SA 4Y7TA 1FRWA 2YC3A 5D92A 1YP2A 4FRBA 2E8BA 5FUHA 1OQMB 2CU2A 3O3PA 3OC9A 1R80A 5C1GA 4ECMA 3U2UA 1SS9A 2JCOA 3CKNA 1O23B 1H7TA 3QVBA 4ARWA 1R7XA 1NHEB 2MZBA 5C38A 4P02A 1LL2A 1TVYA 4NALA 4KNXA 2QKXA 2PA4A 3N9WA 2GGOA 5IDSA 2DPWA 5C48A 2WVMA 2WVLA 2VSHA 5AJNA 1W55A 1G95A 5C3DA 4NAIA 4B2WA 3DJ4A 1H7HA 1V82A 2FFVA 5CQPA 4LW3A 1W77A 5CMHA 3GUEA 1GX4A 1S4PA 3IOHA 4FIYA 4CVHA 1INIA 1S4OA 3DK5A 1V83A 1HM0A 3OH4A 1FG5N 1H4CA 1JYLA 2X5SA 3SXBA 3I0GA 1H5RB 4Q7CA 1R7UA 1MP5A 2GGQA 2V0IA 4KC4A 4Y6UA 3Q4SA 4B4GA 1XHBA 3I0IX 5C3BA 4HOCA 3K8EA 4BMAA 3I0KA 4EE3A 1YP4A 4UEGA 2AESA 5FU0A 2O1FA 1ZJPA 5C8RA 1LZJA 3PNNA 3IOJA 3CKQA 5IDTA 1QWJA 3ZLLA 2RJ4A 2V0JA 4HO3A 4HO4A 4FREA 2Z87A 2I7BA 1WT2A 1FR9A 5CQOA 3PKPA 2BO4A 2UX8A 2PGYA 2JCJA 2C0NA 3V8ZA 4FROA 3E25A 1MP4A 3USRA 1GWVA 1VH1A 3ZLKA 1H7FA 5EIYA 4R7PA 3ST8A 1NKHB 4HO9A 1ZHJA 2BO6A 3OH3A 4CJ8A 1QG8A 1NWGB 1VGZA 1ZDFA 4AAWA 4FCEA 5FYEA 2OEGA 1H4EA 5BXCA 1K4VA 1ZI1A 1IINA 2VK9A 4KXOA 2E3DA 4MNDA 4HCQA 4AC3A 1EYRA 2YC5A 4B5BA 1S4NA 2YQHA 3V0OA 4HO8A 2RIXA 3CKJA 3NGWA 3SPTA 1GA8A 2X65A 2XMHA 3OGZA 2NXVA 1ZJ0A 1G3LA 4B4BA 4MYBA 1NQIB 2VSIA 3OAMA 2V0HA 3BRKX 2XMEA 4FRHA 1INJA 4D48A 2X5ZA 1FXOA 4HO5A 1FWYA 1H5SB 4M2BA 2Y4LA 2Y6PA 4G3QA 3I0DA 4K6RA 4D0ZA 4EEGA 2RITA 3V0PA 3I0JA 3V91A 4NAKA 4FRDA 4XWIA 1JV3A 3V0MA 4EEOA 5JQQA 2OI6A 4G3PA 4G3SA 4D0TA 4B4MA 2PX7A 3IOIA 1GQCA 3RMVA 3TQDA 2J0AA 4E1KA 1JYKA 1TW1A 5I1FA 1ZIZA 3SXCA 1YP3A 2RJ5A 4ASYA 3ZGFA 4EE4A 5FU8A 2V0KA 3V8YA 2PGVA 5AJPA 3JTJA 1FOAA 1Z90A 4IRQA 1O7OA 4FCUA 5EJ1A 1G8OA 4Y7VA 1R81A 2ICXA 2D0JA 3SXDA 4D11C 2Y4MA 4Y63A 1ZI3A 5C4DA 1G2VA 1FGXA 1LZIA 3ZF8A 2YQJA 4KT7A 4EVWA 4M28A 1LZ7A 4L41C 2AM4A 1NF5B 1V84A 4DECA 2RJ8A 1VPAA 1VM8A 2I5KA 1HM9A 1O7QA 1H7QA 2VS5A 3D5NA 1GQ9A 5CQLX 4NANA 4AYLA 2OI5A 2AH9A 2VFZA 4Y7UA 1LL3A 3TZTA 4FRAA 3DUVA 2JCLA 1OMZA 4CJCA 4DE7A 3OH1A 5FTSA 2O1HA 1H3MA 3SX5A 2XWNA 1QGQA 4FRLA 2JCKA 1PZTA 2VXLA 4Y6NA 5FTVA 4CJBA 2D7RA 3F1CA 2WVKA 1HJJA 5D91A 4HO2A 2AGDA 1JVDA 1FXJA 2FYAA 3HL3A 4FQWA 3CKOA 2P72A 4KQLA 3SX3A 4Y64A 1ZJ2A 3USQA 2RJ6A 2WEEA 3JUJA 3Q80A 4D11A 2RJ7A 3I0FA 1H5TA 1QGSA 1E5KA 2ICYA 2W0VA 2Y4JA 4FRPA 2WGZA 5C47A 1NMMB 2W0WA 1LZ0A 3E26A 1YROB 1VZTA 1WT3A 3JUKA 2OI7A 2A8UA 2AM3A 3V0LA 1I52A 3I0EA 3V90A 1ZCVA 1H5SC 5EJZA 2D7IA 1FGGA 4M2AA 2P6WA 1WVCA 2AECA 1FO9A 4AYJA 4G87A 3U0YA 1LVWA 5HS2A 1G93A 2XWMA 3V0NA 3D98A 1G0RA 1GX0A 4EE5A 3I0HA 4KPXA 4EEAA 2YESA 3CGXA 4HO6A 4J18A 3T7MA 1O0RA 2QGIA 4KC2A 1R82A 2P73A 5C3AA 3OH0A 3U2XA 1W57A 2Z86A 2Y4KA 4ASJA 1ON6A 1VGTA 2RJ1A 5C1LA 1FO8A 4B2XA 1ZJ3A 4FRQA 2RIZA 4IRPA 3T7NA 1ON8A 1ZDGA 5C4EA 1LL0A 1H5TB 2BO7A 2O1GA 4FIXA 4KRVA 1FR8A 1XZ6A 1G97A 5AJOA 2QH5A 2ZU8A 2FYBA 5DDTA 3ZGGA 2V0LA 1WSZA 4BQHA 1R7TA 2WAWA 4M4KA 4Y62A 1IIMA 2YCMA 5J49A 4ZDQA 4B42A 3U2WA 1H5SA 4P00A 1WT0A 3I0LA 1VICA 2RIYA 2OEFA 3U0XA 1MP3A 1WT1A 3U2TA 3U2VA 1MC3A 1ZJ1A 2AM5A 5C1HA 2FYDB 1PZYB 1JVGA 2RJ9A 4Y7GA 5CMFX 5DDVA 2FY7A 2X60A 1KWSA 3RMWA 2BO8A 3RSBA 3LW6A 5C49A 1HJLA 1ZI4A 4B3UA 2FYCB 1ZI5A 4HO0A 3SXGA 2A8WA 3V0QA 2APCA 4O6MA 5L6SA 1ZCYA 3I0CA 3OKRA 1VZXA 2VS4A 2I5EA 3F1YA 3PKQA 1ZCUA 3R2WA 3KIAA 3Q7UA 3SX7A 4O6NA 1FZWA 1R7YA 4YS8A 5C36A 4FRMA 1OMXA 2Y7AA 4JISA 5C4BA 4Y7FA 1HV9A 3SXEA 2YQCA 5FV9A 4JD0A 5L6VA 4KPZA 3D8VA 3EE5A 3FWWA 3POLA 3T7OA 2VXMA 1TZFA 1VH3A 2RJ0A 2XWLA 1ZJOA 1VGWA 5C4CA 5IFYA 4EEMA 1EZIA 4LW6A 1HM8A 3FOQA 1H7LA 4GBPA 1G9RA 2FFUA 1G1LA 3CU0A 3BCVA 2WE9A 1ZCTA 1H4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7E A;  1TW5 A;  1VZU A;  3K8D A;  5CMG X;  1R7V A;  3R3I A;  2ZU9 A;  4HG6 A;  2VD4 A;  2YQS A;  3SXA A;  3CKV A;  1G23 A;  1H5R A;  4DDZ A;  5CMI A;  5CQM X;  1H5S D;  2ZU7 A;  5CQN X;  2AE7 A;  1H7G A;  4KNR A;  2Q4J A;  5C4F A;  3SX8 A;  3OH2 A;  5CMJ A;  1VGU A;  1GWW A;  1JV1 A;  4Y9X A;  2VS3 A;  4KC1 A;  4C2S A;  4Y7T A;  1FRW A;  2YC3 A;  1YP2 A;  4FRB A;  2E8B A;  5FUH A;  1OQM B;  2CU2 A;  3O3P A;  3OC9 A;  1R80 A;  5C1G A;  4ECM A;  3U2U A;  1SS9 A;  2JCO A;  3CKN A;  1O23 B;  1H7T A;  3QVB A;  4ARW A;  1R7X A;  1NHE B;  2MZB A;  5C38 A;  4P02 A;  1LL2 A;  1TVY A;  4NAL A;  4KNX A;  2QKX A;  2PA4 A;  3N9W A;  2GGO A;  5IDS A;  2DPW A;  5C48 A;  2WVM A;  2WVL A;  2VSH A;  5AJN A;  1W55 A;  1G95 A;  5C3D A;  4NAI A;  4B2W A;  3DJ4 A;  1H7H A;  1V82 A;  2FFV A;  5CQP A;  4LW3 A;  1W77 A;  5CMH A;  3GUE A;  1GX4 A;  1S4P A;  3IOH A;  4CVH A;  1INI A;  1S4O A;  3DK5 A;  1V83 A;  1HM0 A;  3OH4 A;  1FG5 N;  1H4C A;  1JYL A;  2X5S A;  3SXB A;  3I0G A;  1H5R B;  1R7U A;  1MP5 A;  2GGQ A;  2V0I A;  4KC4 A;  4Y6U A;  3Q4S A;  4B4G A;  1XHB A;  3I0I X;  5C3B A;  4HOC A;  3K8E A;  4BMA A;  3I0K A;  4EE3 A;  1YP4 A;  4UEG A;  2AES A;  5FU0 A;  2O1F A;  1ZJP A;  5C8R A;  1LZJ A;  3PNN A;  3IOJ A;  3CKQ A;  5IDT A;  1QWJ A;  3ZLL A;  2RJ4 A;  2V0J A;  4HO3 A;  4HO4 A;  4FRE A;  2Z87 A;  2I7B A;  1WT2 A;  1FR9 A;  5CQO A;  3PKP A;  2BO4 A;  2UX8 A;  2PGY A;  2JCJ A;  3V8Z A;  4FRO A;  3E25 A;  1MP4 A;  3USR A;  1GWV A;  1VH1 A;  3ZLK A;  1H7F A;  5EIY A;  4R7P A;  3ST8 A;  1NKH B;  4HO9 A;  1ZHJ A;  2BO6 A;  3OH3 A;  4CJ8 A;  1QG8 A;  1NWG B;  1VGZ A;  1ZDF A;  4AAW A;  4FCE A;  5FYE A;  2OEG A;  1H4E A;  5BXC A;  1K4V A;  1ZI1 A;  1IIN A;  4KXO A;  2E3D A;  4MND A;  4HCQ A;  4AC3 A;  1EYR A;  2YC5 A;  4B5B A;  1S4N A;  2YQH A;  3V0O A;  4HO8 A;  2RIX A;  3CKJ A;  3NGW A;  3SPT A;  1GA8 A;  2X65 A;  2XMH A;  3OGZ A;  2NXV A;  1ZJ0 A;  1G3L A;  4B4B A;  4MYB A;  1NQI B;  2VSI A;  3OAM A;  2V0H A;  3BRK X;  2XME A;  4FRH A;  1INJ A;  4D48 A;  2X5Z A;  1FXO A;  4HO5 A;  1FWY A;  1H5S B;  4M2B A;  2Y4L A;  2Y6P A;  4G3Q A;  3I0D A;  4K6R A;  4D0Z A;  4EEG A;  2RIT A;  3V0P A;  3I0J A;  3V91 A;  4NAK A;  4FRD A;  4XWI A;  1JV3 A;  3V0M A;  4EEO A;  5JQQ A;  2OI6 A;  4G3P A;  4G3S A;  4D0T A;  4B4M A;  2PX7 A;  3IOI A;  1GQC A;  3RMV A;  3TQD A;  4E1K A;  1JYK A;  1TW1 A;  5I1F A;  1ZIZ A;  3SXC A;  1YP3 A;  2RJ5 A;  4ASY A;  3ZGF A;  4EE4 A;  5FU8 A;  2V0K A;  3V8Y A;  2PGV A;  5AJP A;  3JTJ A;  1FOA A;  1Z90 A;  4IRQ A;  1O7O A;  4FCU A;  5EJ1 A;  1G8O A;  4Y7V A;  1R81 A;  2ICX A;  2D0J A;  3SXD A;  4D11 C;  2Y4M A;  4Y63 A;  1ZI3 A;  5C4D A;  1G2V A;  1FGX A;  1LZI A;  3ZF8 A;  2YQJ A;  4KT7 A;  4EVW A;  4M28 A;  1LZ7 A;  4L41 C;  2AM4 A;  1NF5 B;  1V84 A;  4DEC A;  2RJ8 A;  1VPA A;  1VM8 A;  2I5K A;  1HM9 A;  1O7Q A;  1H7Q A;  2VS5 A;  3D5N A;  1GQ9 A;  5CQL X;  4NAN A;  4AYL A;  2OI5 A;  2AH9 A;  2VFZ A;  4Y7U A;  1LL3 A;  3TZT A;  4FRA A;  3DUV A;  2JCL A;  1OMZ A;  4CJC A;  4DE7 A;  3OH1 A;  5FTS A;  2O1H A;  1H3M A;  3SX5 A;  2XWN A;  1QGQ A;  4FRL A;  2JCK A;  1PZT A;  2VXL A;  4Y6N A;  5FTV A;  4CJB A;  2D7R A;  3F1C A;  2WVK A;  1HJJ A;  4HO2 A;  2AGD A;  1JVD A;  1FXJ A;  2FYA A;  3HL3 A;  4FQW A;  3CKO A;  2P72 A;  4KQL A;  3SX3 A;  4Y64 A;  1ZJ2 A;  3USQ A;  2RJ6 A;  2WEE A;  3JUJ A;  3Q80 A;  4D11 A;  2RJ7 A;  3I0F A;  1H5T A;  1QGS A;  1E5K A;  2ICY A;  2W0V A;  2Y4J A;  4FRP A;  2WGZ A;  5C47 A;  1NMM B;  2W0W A;  1LZ0 A;  3E26 A;  1YRO B;  1VZT A;  1WT3 A;  3JUK A;  2OI7 A;  2A8U A;  2AM3 A;  3V0L A;  1I52 A;  3I0E A;  3V90 A;  1ZCV A;  1H5S C;  5EJZ A;  2D7I A;  1FGG A;  4M2A A;  2P6W A;  1WVC A;  2AEC A;  1FO9 A;  4AYJ A;  4G87 A;  3U0Y A;  1LVW A;  5HS2 A;  1G93 A;  2XWM A;  3V0N A;  3D98 A;  1G0R A;  1GX0 A;  4EE5 A;  3I0H A;  4KPX A;  4EEA A;  2YES A;  3CGX A;  4HO6 A;  4J18 A;  3T7M A;  1O0R A;  2QGI A;  4KC2 A;  1R82 A;  2P73 A;  5C3A A;  3OH0 A;  3U2X A;  1W57 A;  2Z86 A;  2Y4K A;  4ASJ A;  1ON6 A;  1VGT A;  2RJ1 A;  5C1L A;  1FO8 A;  4B2X A;  1ZJ3 A;  4FRQ A;  2RIZ A;  4IRP A;  3T7N A;  1ON8 A;  1ZDG A;  5C4E A;  1LL0 A;  1H5T B;  2BO7 A;  2O1G A;  4KRV A;  1FR8 A;  1XZ6 A;  1G97 A;  5AJO A;  2QH5 A;  2ZU8 A;  2FYB A;  5DDT A;  3ZGG A;  2V0L A;  1WSZ A;  4BQH A;  1R7T A;  2WAW A;  4M4K A;  4Y62 A;  1IIM A;  2YCM A;  5J49 A;  4ZDQ A;  4B42 A;  3U2W A;  1H5S A;  4P00 A;  1WT0 A;  3I0L A;  1VIC A;  2RIY A;  2OEF A;  3U0X A;  1MP3 A;  1WT1 A;  3U2T A;  3U2V A;  1MC3 A;  1ZJ1 A;  2AM5 A;  5C1H A;  2FYD B;  1PZY B;  1JVG A;  2RJ9 A;  4Y7G A;  5CMF X;  5DDV A;  2FY7 A;  2X60 A;  1KWS A;  3RMW A;  2BO8 A;  3RSB A;  3LW6 A;  5C49 A;  1HJL A;  1ZI4 A;  4B3U A;  2FYC B;  1ZI5 A;  4HO0 A;  3SXG A;  2A8W A;  3V0Q A;  2APC A;  5L6S A;  1ZCY A;  3I0C A;  3OKR A;  1VZX A;  2VS4 A;  2I5E A;  3F1Y A;  3PKQ A;  1ZCU A;  3R2W A;  3KIA A;  3Q7U A;  3SX7 A;  1FZW A;  1R7Y A;  4YS8 A;  5C36 A;  4FRM A;  1OMX A;  2Y7A A;  4JIS A;  5C4B A;  4Y7F A;  1HV9 A;  3SXE A;  2YQC A;  5FV9 A;  4JD0 A;  5L6V A;  4KPZ A;  3D8V A;  3EE5 A;  3FWW A;  3POL A;  3T7O A;  2VXM A;  1TZF A;  1VH3 A;  2RJ0 A;  2XWL A;  1ZJO A;  1VGW A;  5C4C A;  5IFY A;  4EEM A;  1EZI A;  4LW6 A;  1HM8 A;  3FOQ A;  1H7L A;  4GBP A;  1G9R A;  2FFU A;  1G1L A;  3CU0 A;  3BCV A;  2WE9 A;  1ZCT A;  1H4D A; 
#chains in the Genus database with same CATH topology
 1H7E A;  1TW5 A;  1VZU A;  3K8D A;  5CMG X;  1R7V A;  3R3I A;  4MIX A;  2ZU9 A;  4HG6 A;  2VD4 A;  2YQS A;  3SXA A;  3CKV A;  1G23 A;  1H5R A;  4DDZ A;  5CMI A;  2J0B A;  5CQM X;  1H5S D;  2ZU7 A;  5CQN X;  2AE7 A;  1H7G A;  4KNR A;  2Q4J A;  5C4F A;  3SX8 A;  3OH2 A;  5CMJ A;  1VGU A;  1GWW A;  1JV1 A;  4Y9X A;  2VS3 A;  4KC1 A;  4C2S A;  4Y7T A;  1FRW A;  2YC3 A;  5D92 A;  1YP2 A;  4FRB A;  2E8B A;  5FUH A;  1OQM B;  2CU2 A;  3O3P A;  3OC9 A;  1R80 A;  5C1G A;  4ECM A;  3U2U A;  1SS9 A;  2JCO A;  3CKN A;  1O23 B;  1H7T A;  3QVB A;  4ARW A;  1R7X A;  1NHE B;  2MZB A;  5C38 A;  4P02 A;  1LL2 A;  1TVY A;  4NAL A;  4KNX A;  2QKX A;  2PA4 A;  3N9W A;  2GGO A;  5IDS A;  2DPW A;  5C48 A;  2WVM A;  2WVL A;  2VSH A;  5AJN A;  1W55 A;  1G95 A;  5C3D A;  4NAI A;  4B2W A;  3DJ4 A;  1H7H A;  1V82 A;  2FFV A;  5CQP A;  4LW3 A;  1W77 A;  5CMH A;  3GUE A;  1GX4 A;  1S4P A;  3IOH A;  4FIY A;  4CVH A;  1INI A;  1S4O A;  3DK5 A;  1V83 A;  1HM0 A;  3OH4 A;  1FG5 N;  1H4C A;  1JYL A;  2X5S A;  3SXB A;  3I0G A;  1H5R B;  4Q7C A;  1R7U A;  1MP5 A;  2GGQ A;  2V0I A;  4KC4 A;  4Y6U A;  3Q4S A;  4B4G A;  1XHB A;  3I0I X;  5C3B A;  4HOC A;  3K8E A;  4BMA A;  3I0K A;  4EE3 A;  1YP4 A;  4UEG A;  2AES A;  5FU0 A;  2O1F A;  1ZJP A;  5C8R A;  1LZJ A;  3PNN A;  3IOJ A;  3CKQ A;  5IDT A;  1QWJ A;  3ZLL A;  2RJ4 A;  2V0J A;  4HO3 A;  4HO4 A;  4FRE A;  2Z87 A;  2I7B A;  1WT2 A;  1FR9 A;  5CQO A;  3PKP A;  2BO4 A;  2UX8 A;  2PGY A;  2JCJ A;  2C0N A;  3V8Z A;  4FRO A;  3E25 A;  1MP4 A;  3USR A;  1GWV A;  1VH1 A;  3ZLK A;  1H7F A;  5EIY A;  4R7P A;  3ST8 A;  1NKH B;  4HO9 A;  1ZHJ A;  2BO6 A;  3OH3 A;  4CJ8 A;  1QG8 A;  1NWG B;  1VGZ A;  1ZDF A;  4AAW A;  4FCE A;  5FYE A;  2OEG A;  1H4E A;  5BXC A;  1K4V A;  1ZI1 A;  1IIN A;  2VK9 A;  4KXO A;  2E3D A;  4MND A;  4HCQ A;  4AC3 A;  1EYR A;  2YC5 A;  4B5B A;  1S4N A;  2YQH A;  3V0O A;  4HO8 A;  2RIX A;  3CKJ A;  3NGW A;  3SPT A;  1GA8 A;  2X65 A;  2XMH A;  3OGZ A;  2NXV A;  1ZJ0 A;  1G3L A;  4B4B A;  4MYB A;  1NQI B;  2VSI A;  3OAM A;  2V0H A;  3BRK X;  2XME A;  4FRH A;  1INJ A;  4D48 A;  2X5Z A;  1FXO A;  4HO5 A;  1FWY A;  1H5S B;  4M2B A;  2Y4L A;  2Y6P A;  4G3Q A;  3I0D A;  4K6R A;  4D0Z A;  4EEG A;  2RIT A;  3V0P A;  3I0J A;  3V91 A;  4NAK A;  4FRD A;  4XWI A;  1JV3 A;  3V0M A;  4EEO A;  5JQQ A;  2OI6 A;  4G3P A;  4G3S A;  4D0T A;  4B4M A;  2PX7 A;  3IOI A;  1GQC A;  3RMV A;  3TQD A;  2J0A A;  4E1K A;  1JYK A;  1TW1 A;  5I1F A;  1ZIZ A;  3SXC A;  1YP3 A;  2RJ5 A;  4ASY A;  3ZGF A;  4EE4 A;  5FU8 A;  2V0K A;  3V8Y A;  2PGV A;  5AJP A;  3JTJ A;  1FOA A;  1Z90 A;  4IRQ A;  1O7O A;  4FCU A;  5EJ1 A;  1G8O A;  4Y7V A;  1R81 A;  2ICX A;  2D0J A;  3SXD A;  4D11 C;  2Y4M A;  4Y63 A;  1ZI3 A;  5C4D A;  1G2V A;  1FGX A;  1LZI A;  3ZF8 A;  2YQJ A;  4KT7 A;  4EVW A;  4M28 A;  1LZ7 A;  4L41 C;  2AM4 A;  1NF5 B;  1V84 A;  4DEC A;  2RJ8 A;  1VPA A;  1VM8 A;  2I5K A;  1HM9 A;  1O7Q A;  1H7Q A;  2VS5 A;  3D5N A;  1GQ9 A;  5CQL X;  4NAN A;  4AYL A;  2OI5 A;  2AH9 A;  2VFZ A;  4Y7U A;  1LL3 A;  3TZT A;  4FRA A;  3DUV A;  2JCL A;  1OMZ A;  4CJC A;  4DE7 A;  3OH1 A;  5FTS A;  2O1H A;  1H3M A;  3SX5 A;  2XWN A;  1QGQ A;  4FRL A;  2JCK A;  1PZT A;  2VXL A;  4Y6N A;  5FTV A;  4CJB A;  2D7R A;  3F1C A;  2WVK A;  1HJJ A;  5D91 A;  4HO2 A;  2AGD A;  1JVD A;  1FXJ A;  2FYA A;  3HL3 A;  4FQW A;  3CKO A;  2P72 A;  4KQL A;  3SX3 A;  4Y64 A;  1ZJ2 A;  3USQ A;  2RJ6 A;  2WEE A;  3JUJ A;  3Q80 A;  4D11 A;  2RJ7 A;  3I0F A;  1H5T A;  1QGS A;  1E5K A;  2ICY A;  2W0V A;  2Y4J A;  4FRP A;  2WGZ A;  5C47 A;  1NMM B;  2W0W A;  1LZ0 A;  3E26 A;  1YRO B;  1VZT A;  1WT3 A;  3JUK A;  2OI7 A;  2A8U A;  2AM3 A;  3V0L A;  1I52 A;  3I0E A;  3V90 A;  1ZCV A;  1H5S C;  5EJZ A;  2D7I A;  1FGG A;  4M2A A;  2P6W A;  1WVC A;  2AEC A;  1FO9 A;  4AYJ A;  4G87 A;  3U0Y A;  1LVW A;  5HS2 A;  1G93 A;  2XWM A;  3V0N A;  3D98 A;  1G0R A;  1GX0 A;  4EE5 A;  3I0H A;  4KPX A;  4EEA A;  2YES A;  3CGX A;  4HO6 A;  4J18 A;  3T7M A;  1O0R A;  2QGI A;  4KC2 A;  1R82 A;  2P73 A;  5C3A A;  3OH0 A;  3U2X A;  1W57 A;  2Z86 A;  2Y4K A;  4ASJ A;  1ON6 A;  1VGT A;  2RJ1 A;  5C1L A;  1FO8 A;  4B2X A;  1ZJ3 A;  4FRQ A;  2RIZ A;  4IRP A;  3T7N A;  1ON8 A;  1ZDG A;  5C4E A;  1LL0 A;  1H5T B;  2BO7 A;  2O1G A;  4FIX A;  4KRV A;  1FR8 A;  1XZ6 A;  1G97 A;  5AJO A;  2QH5 A;  2ZU8 A;  2FYB A;  5DDT A;  3ZGG A;  2V0L A;  1WSZ A;  4BQH A;  1R7T A;  2WAW A;  4M4K A;  4Y62 A;  1IIM A;  2YCM A;  5J49 A;  4ZDQ A;  4B42 A;  3U2W A;  1H5S A;  4P00 A;  1WT0 A;  3I0L A;  1VIC A;  2RIY A;  2OEF A;  3U0X A;  1MP3 A;  1WT1 A;  3U2T A;  3U2V A;  1MC3 A;  1ZJ1 A;  2AM5 A;  5C1H A;  2FYD B;  1PZY B;  1JVG A;  2RJ9 A;  4Y7G A;  5CMF X;  5DDV A;  2FY7 A;  2X60 A;  1KWS A;  3RMW A;  2BO8 A;  3RSB A;  3LW6 A;  5C49 A;  1HJL A;  1ZI4 A;  4B3U A;  2FYC B;  1ZI5 A;  4HO0 A;  3SXG A;  2A8W A;  3V0Q A;  2APC A;  4O6M A;  5L6S A;  1ZCY A;  3I0C A;  3OKR A;  1VZX A;  2VS4 A;  2I5E A;  3F1Y A;  3PKQ A;  1ZCU A;  3R2W A;  3KIA A;  3Q7U A;  3SX7 A;  4O6N A;  1FZW A;  1R7Y A;  4YS8 A;  5C36 A;  4FRM A;  1OMX A;  2Y7A A;  4JIS A;  5C4B A;  4Y7F A;  1HV9 A;  3SXE A;  2YQC A;  5FV9 A;  4JD0 A;  5L6V A;  4KPZ A;  3D8V A;  3EE5 A;  3FWW A;  3POL A;  3T7O A;  2VXM A;  1TZF A;  1VH3 A;  2RJ0 A;  2XWL A;  1ZJO A;  1VGW A;  5C4C A;  5IFY A;  4EEM A;  1EZI A;  4LW6 A;  1HM8 A;  3FOQ A;  1H7L A;  4GBP A;  1G9R A;  2FFU A;  1G1L A;  3CU0 A;  3BCV A;  2WE9 A;  1ZCT A;  1H4D A; 
#chains in the Genus database with same CATH homology
 1H7E A;  1TW5 A;  1VZU A;  3K8D A;  5CMG X;  1R7V A;  3R3I A;  4MIX A;  2ZU9 A;  4HG6 A;  2VD4 A;  2YQS A;  3SXA A;  3CKV A;  1G23 A;  1H5R A;  4DDZ A;  5CMI A;  2J0B A;  5CQM X;  1H5S D;  2ZU7 A;  5CQN X;  2AE7 A;  1H7G A;  4KNR A;  2Q4J A;  5C4F A;  3SX8 A;  3OH2 A;  5CMJ A;  1VGU A;  1GWW A;  1JV1 A;  4Y9X A;  2VS3 A;  4KC1 A;  4C2S A;  4Y7T A;  1FRW A;  2YC3 A;  5D92 A;  1YP2 A;  4FRB A;  2E8B A;  5FUH A;  1OQM B;  2CU2 A;  3O3P A;  3OC9 A;  1R80 A;  5C1G A;  4ECM A;  3U2U A;  1SS9 A;  2JCO A;  3CKN A;  1O23 B;  1H7T A;  3QVB A;  4ARW A;  1R7X A;  1NHE B;  2MZB A;  5C38 A;  4P02 A;  1LL2 A;  1TVY A;  4NAL A;  4KNX A;  2QKX A;  2PA4 A;  3N9W A;  2GGO A;  5IDS A;  2DPW A;  5C48 A;  2WVM A;  2WVL A;  2VSH A;  5AJN A;  1W55 A;  1G95 A;  5C3D A;  4NAI A;  4B2W A;  3DJ4 A;  1H7H A;  1V82 A;  2FFV A;  5CQP A;  4LW3 A;  1W77 A;  5CMH A;  3GUE A;  1GX4 A;  1S4P A;  3IOH A;  4FIY A;  4CVH A;  1INI A;  1S4O A;  3DK5 A;  1V83 A;  1HM0 A;  3OH4 A;  1FG5 N;  1H4C A;  1JYL A;  2X5S A;  3SXB A;  3I0G A;  1H5R B;  4Q7C A;  1R7U A;  1MP5 A;  2GGQ A;  2V0I A;  4KC4 A;  4Y6U A;  3Q4S A;  4B4G A;  1XHB A;  3I0I X;  5C3B A;  4HOC A;  3K8E A;  4BMA A;  3I0K A;  4EE3 A;  1YP4 A;  4UEG A;  2AES A;  5FU0 A;  2O1F A;  1ZJP A;  5C8R A;  1LZJ A;  3PNN A;  3IOJ A;  3CKQ A;  5IDT A;  1QWJ A;  3ZLL A;  2RJ4 A;  2V0J A;  4HO3 A;  4HO4 A;  4FRE A;  2Z87 A;  2I7B A;  1WT2 A;  1FR9 A;  5CQO A;  3PKP A;  2BO4 A;  2UX8 A;  2PGY A;  2JCJ A;  2C0N A;  3V8Z A;  4FRO A;  3E25 A;  1MP4 A;  3USR A;  1GWV A;  1VH1 A;  3ZLK A;  1H7F A;  5EIY A;  4R7P A;  3ST8 A;  1NKH B;  4HO9 A;  1ZHJ A;  2BO6 A;  3OH3 A;  4CJ8 A;  1QG8 A;  1NWG B;  1VGZ A;  1ZDF A;  4AAW A;  4FCE A;  5FYE A;  2OEG A;  1H4E A;  5BXC A;  1K4V A;  1ZI1 A;  1IIN A;  2VK9 A;  4KXO A;  2E3D A;  4MND A;  4HCQ A;  4AC3 A;  1EYR A;  2YC5 A;  4B5B A;  1S4N A;  2YQH A;  3V0O A;  4HO8 A;  2RIX A;  3CKJ A;  3NGW A;  3SPT A;  1GA8 A;  2X65 A;  2XMH A;  3OGZ A;  2NXV A;  1ZJ0 A;  1G3L A;  4B4B A;  4MYB A;  1NQI B;  2VSI A;  3OAM A;  2V0H A;  3BRK X;  2XME A;  4FRH A;  1INJ A;  4D48 A;  2X5Z A;  1FXO A;  4HO5 A;  1FWY A;  1H5S B;  4M2B A;  2Y4L A;  2Y6P A;  4G3Q A;  3I0D A;  4K6R A;  4D0Z A;  4EEG A;  2RIT A;  3V0P A;  3I0J A;  3V91 A;  4NAK A;  4FRD A;  4XWI A;  1JV3 A;  3V0M A;  4EEO A;  5JQQ A;  2OI6 A;  4G3P A;  4G3S A;  4D0T A;  4B4M A;  2PX7 A;  3IOI A;  1GQC A;  3RMV A;  3TQD A;  2J0A A;  4E1K A;  1JYK A;  1TW1 A;  5I1F A;  1ZIZ A;  3SXC A;  1YP3 A;  2RJ5 A;  4ASY A;  3ZGF A;  4EE4 A;  5FU8 A;  2V0K A;  3V8Y A;  2PGV A;  5AJP A;  3JTJ A;  1FOA A;  1Z90 A;  4IRQ A;  1O7O A;  4FCU A;  5EJ1 A;  1G8O A;  4Y7V A;  1R81 A;  2ICX A;  2D0J A;  3SXD A;  4D11 C;  2Y4M A;  4Y63 A;  1ZI3 A;  5C4D A;  1G2V A;  1FGX A;  1LZI A;  3ZF8 A;  2YQJ A;  4KT7 A;  4EVW A;  4M28 A;  1LZ7 A;  4L41 C;  2AM4 A;  1NF5 B;  1V84 A;  4DEC A;  2RJ8 A;  1VPA A;  1VM8 A;  2I5K A;  1HM9 A;  1O7Q A;  1H7Q A;  2VS5 A;  3D5N A;  1GQ9 A;  5CQL X;  4NAN A;  4AYL A;  2OI5 A;  2AH9 A;  2VFZ A;  4Y7U A;  1LL3 A;  3TZT A;  4FRA A;  3DUV A;  2JCL A;  1OMZ A;  4CJC A;  4DE7 A;  3OH1 A;  5FTS A;  2O1H A;  1H3M A;  3SX5 A;  2XWN A;  1QGQ A;  4FRL A;  2JCK A;  1PZT A;  2VXL A;  4Y6N A;  5FTV A;  4CJB A;  2D7R A;  3F1C A;  2WVK A;  1HJJ A;  5D91 A;  4HO2 A;  2AGD A;  1JVD A;  1FXJ A;  2FYA A;  3HL3 A;  4FQW A;  3CKO A;  2P72 A;  4KQL A;  3SX3 A;  4Y64 A;  1ZJ2 A;  3USQ A;  2RJ6 A;  2WEE A;  3JUJ A;  3Q80 A;  4D11 A;  2RJ7 A;  3I0F A;  1H5T A;  1QGS A;  1E5K A;  2ICY A;  2W0V A;  2Y4J A;  4FRP A;  2WGZ A;  5C47 A;  1NMM B;  2W0W A;  1LZ0 A;  3E26 A;  1YRO B;  1VZT A;  1WT3 A;  3JUK A;  2OI7 A;  2A8U A;  2AM3 A;  3V0L A;  1I52 A;  3I0E A;  3V90 A;  1ZCV A;  1H5S C;  5EJZ A;  2D7I A;  1FGG A;  4M2A A;  2P6W A;  1WVC A;  2AEC A;  1FO9 A;  4AYJ A;  4G87 A;  3U0Y A;  1LVW A;  5HS2 A;  1G93 A;  2XWM A;  3V0N A;  3D98 A;  1G0R A;  1GX0 A;  4EE5 A;  3I0H A;  4KPX A;  4EEA A;  2YES A;  3CGX A;  4HO6 A;  4J18 A;  3T7M A;  1O0R A;  2QGI A;  4KC2 A;  1R82 A;  2P73 A;  5C3A A;  3OH0 A;  3U2X A;  1W57 A;  2Z86 A;  2Y4K A;  4ASJ A;  1ON6 A;  1VGT A;  2RJ1 A;  5C1L A;  1FO8 A;  4B2X A;  1ZJ3 A;  4FRQ A;  2RIZ A;  4IRP A;  3T7N A;  1ON8 A;  1ZDG A;  5C4E A;  1LL0 A;  1H5T B;  2BO7 A;  2O1G A;  4FIX A;  4KRV A;  1FR8 A;  1XZ6 A;  1G97 A;  5AJO A;  2QH5 A;  2ZU8 A;  2FYB A;  5DDT A;  3ZGG A;  2V0L A;  1WSZ A;  4BQH A;  1R7T A;  2WAW A;  4M4K A;  4Y62 A;  1IIM A;  2YCM A;  5J49 A;  4ZDQ A;  4B42 A;  3U2W A;  1H5S A;  4P00 A;  1WT0 A;  3I0L A;  1VIC A;  2RIY A;  2OEF A;  3U0X A;  1MP3 A;  1WT1 A;  3U2T A;  3U2V A;  1MC3 A;  1ZJ1 A;  2AM5 A;  5C1H A;  2FYD B;  1PZY B;  1JVG A;  2RJ9 A;  4Y7G A;  5CMF X;  5DDV A;  2FY7 A;  2X60 A;  1KWS A;  3RMW A;  2BO8 A;  3RSB A;  3LW6 A;  5C49 A;  1HJL A;  1ZI4 A;  4B3U A;  2FYC B;  1ZI5 A;  4HO0 A;  3SXG A;  2A8W A;  3V0Q A;  2APC A;  4O6M A;  5L6S A;  1ZCY A;  3I0C A;  3OKR A;  1VZX A;  2VS4 A;  2I5E A;  3F1Y A;  3PKQ A;  1ZCU A;  3R2W A;  3KIA A;  3Q7U A;  3SX7 A;  4O6N A;  1FZW A;  1R7Y A;  4YS8 A;  5C36 A;  4FRM A;  1OMX A;  2Y7A A;  4JIS A;  5C4B A;  4Y7F A;  1HV9 A;  3SXE A;  2YQC A;  5FV9 A;  4JD0 A;  5L6V A;  4KPZ A;  3D8V A;  3EE5 A;  3FWW A;  3POL A;  3T7O A;  2VXM A;  1TZF A;  1VH3 A;  2RJ0 A;  2XWL A;  1ZJO A;  1VGW A;  5C4C A;  5IFY A;  4EEM A;  1EZI A;  4LW6 A;  1HM8 A;  3FOQ A;  1H7L A;  4GBP A;  1G9R A;  2FFU A;  1G1L A;  3CU0 A;  3BCV A;  2WE9 A;  1ZCT A;  1H4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...