3T7NA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
254
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 254
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3t7nA00
3CKQA 4HG6A 4Y64A 5C36A 2X5SA 3U2XA 4EE4A 5IDTA 5C3DA 2RJ4A 5IFYA 1NMMB 2UX8A 2FY7A 5AJOA 3SX3A 3OH1A 5C1LA 1V84A 1JVGA 2FYDB 1O7OA 1R7VA 1NF5B 1FGGA 5DDVA 1YP2A 4FCUA 4M28A 2AGDA 1LZIA 2V0HA 4FRMA 1ZIZA 2OEGA 4D11C 2JCOA 1FO8A 2RIYA 3CU0A 1R82A 5C49A 1R7TA 3V0LA 1FOAA 4LW6A 2FYAA 1FXJA 4HO5A 4IRQA 4CJ8A 2XMHA 1JV3A 5CQLX 1ZHJA 4LW3A 2O1FA 3SXAA 5C8RA 4MNDA 3CKOA 2WE9A 2VFZA 2E3DA 1VGWA 1GQ9A 3V90A 4DECA 1OQMB 4KC2A 1VZTA 4D48A 3OH0A 1HJJA 2Y4KA 1ZCYA 1ZDFA 3T7OA 3SX8A 1JVDA 2Z86A 4YS8A 5CMIA 1QGSA 1VGTA 4Y7VA 4KRVA 1W57A 2YC3A 2RJ1A 2V0LA 2FFVA 1FR8A 5EIYA 4D0ZA 2I7BA 3CKJA 5AJNA 1EZIA 2FYBA 1GWVA 2AM4A 1YROB 3NGWA 1PZTA 2E8BA 2VD4A 2X60A 4P02A 1VM8A 1QG8A 3IOHA 2ZU7A 4AAWA 3POLA 1WT0A 4FRHA 2O1GA 4HO9A 1H5TB 1LL0A 2YC5A 1JYKA 2PX7A 5C3AA 4ASJA 4G3SA 2QGIA 1NWGB 4HO2A 2OEFA 3IOIA 3USQA 4KC4A 2WVKA 1LZJA 3V0PA 1H4DA 1KWSA 2XMEA 4Y62A 3V0OA 1EYRA 3SXCA 2ICYA 4AC3A 1ZDGA 3I0KA 4Y6UA 3T7MA 4KPZA 4G87A 1SS9A 3ZGGA 1INIA 1VICA 4G3PA 3DK5A 3ZLKA 5L6SA 1YP4A 3D98A 5FUHA 1HM9A 5BXCA 2D7RA 1ZI3A 2AESA 3I0DA 5C4DA 4AYJA 2RJ0A 1WT2A 1HV9A 1IIMA 1R80A 1S4OA 1W77A 4BMAA 1ZJOA 1H5SB 2OI5A 1HM8A 5C3BA 3FWWA 3OAMA 1H7LA 2DPWA 3Q4SA 5C4BA 4FRDA 1MP4A 3V0NA 3SXEA 5FTVA 2O1HA 1LZ0A 1R7YA 2VXLA 2RIXA 1H5SC 3SXGA 3V0MA 4UEGA 2VSHA 4B42A 3OH2A 1TVYA 1NHEB 4Y6NA 4B4MA 1FRWA 2PGYA 2RITA 1G0RA 3V0QA 2VXMA 1NKHB 4AYLA 3U2WA 1VZXA 1ZCTA 1GX0A 4EEMA 5C4CA 5FU0A 2RIZA 3U0XA 2Q4JA 1NQIB 4M4KA 4B2XA 2BO6A 1H7HA 2V0KA 5C48A 2JCKA 1S4PA 2W0VA 5C47A 4NANA 3FOQA 2JCJA 3EE5A 2FFUA 3OC9A 4FRPA 4Y63A 4DDZA 3RMVA 3SXDA 4CJCA 1O7QA 2VS5A 3I0CA 1G1LA 1VH3A 4HO3A 5FU8A 4HO0A 1R7UA 1OMZA 3U2TA 1G3LA 3U2UA 4NAKA 4KNXA 1E5KA 2RJ9A 2BO4A 2Y4LA 5CMJA 3ZGFA 5CQNX 4KQLA 2XWLA 2GGOA 5CQMX 2WAWA 2A8UA 1GX4A 1H5SD 3DUVA 1LL2A 2Y4MA 4HO6A 3RMWA 1H7TA 3SPTA 4L41C 3I0EA 3K8DA 2QKXA 4B4BA 1ON6A 2PA4A 1WT1A 2P6WA 5C4FA 4FREA 3Q80A 5CMHA 1IINA 3R2WA 1V82A 5DDTA 4ASYA 2YESA 3I0IX 5CMFX 4EEAA 1XZ6A 3E26A 2GGQA 1W55A 2AM3A 1O0RA 3JUKA 2JCLA 5EJ1A 1H5RA 4IRPA 1FZWA 1FG5N 2I5EA 3K8EA 4Y7TA 3D5NA 5IDSA 2NXVA 4ZDQA 2X65A 1LL3A 4P00A 3QVBA 2VS3A 3I0JA 3BRKX 2Z87A 4FROA 4K6RA 2P73A 4B2WA 1H7QA 1PZYB 3T7NA 1K4VA 2YCMA 3ZF8A 1WT3A 1ZCUA 4Y7UA 1HJLA 4D11A 2RJ6A 1FXOA 2AECA 4FRLA 2CU2A 3HL3A 3OGZA 4FRQA 3SX7A 3D8VA 3TQDA 3KIAA 3OH4A 2QH5A 1ZI5A 3BCVA 1V83A 1YP3A 1H4EA 1TZFA 2VSIA 1FGXA 4FCEA 1JYLA 3TZTA 2FYCB 2AM5A 3GUEA 4M2AA 4R7PA 3F1CA 1G97A 1ZI4A 3E25A 4Y7GA 5JQQA 3I0LA 1QWJA 1G8OA 4XWIA 1ZCVA 3PKPA 1I52A 4GBPA 1FO9A 2YQCA 3CGXA 5HS2A 5C1HA 2YQSA 3LW6A 4J18A 4FRBA 4JD0A 5J49A 1GWWA 1H7FA 2D0JA 4B5BA 1H7GA 1Z90A 3CKNA 2V0IA 3I0GA 4EE3A 4BQHA 5FTSA 3V91A 1VGUA 2ICXA 1VPAA 5FYEA 1MP5A 1O23B 3I0HA 4CJBA 1LZ7A 1R81A 3ZLLA 4EEOA 2ZU8A 2I5KA 3R3IA 1LVWA 2VS4A 4EVWA 2OI7A 5C38A 2X5ZA 4C2SA 3OH3A 3F1YA 4D0TA 4NAIA 3U2VA 1H3MA 4KNRA 1H4CA 2RJ7A 1ZJ1A 3JUJA 4FQWA 3PNNA 2V0JA 1FR9A 4G3QA 2A8WA 3Q7UA 2D7IA 1FWYA 4ARWA 3RSBA 3V8YA 1H5TA 2WGZA 1TW5A 1G23A 4NALA 3CKVA 1ZJ3A 3PKQA 2YQHA 1VH1A 5CQOA 5CMGX 2Y6PA 2OI6A 5I1FA 1R7XA 3SXBA 2RJ8A 1WSZA 4HCQA 1GA8A 1HM0A 2AE7A 2XWNA 4ECMA 1ZJPA 1MP3A 4KXOA 4B4GA 3ST8A 2Y4JA 4HO4A 3V8ZA 5AJPA 4CVHA 3IOJA 1INJA 1TW1A 1G93A 1H7EA 2MZBA 2BO8A 4DE7A 2W0WA 3I0FA 3OKRA 5C1GA 4JISA 3USRA 5C4EA 1ZI1A 3N9WA 2BO7A 2WVLA 1ON8A 3U0YA 2WVMA 4FRAA 1H5SA 2ZU9A 4Y9XA 2YQJA 5CQPA 1QGQA 1JV1A 2RJ5A 4HOCA 2P72A 1ZJ0A 3DJ4A 1G9RA 4B3UA 4M2BA 5EJZA 1S4NA 3O3PA 4EEGA 4E1KA 1G95A 4KC1A 4EE5A 5L6VA 1VZUA 1OMXA 4Y7FA 3SX5A 2AH9A 1XHBA 4KPXA 1ZJ2A 1G2VA 1VGZA 2APCA 2WEEA 2PGVA 4HO8A 1GQCA 1H5RB 5FV9A 4KT7A 4MYBA 3JTJA 2Y7AA 1WVCA 2XWMA 1MC3A
chains in the Genus database with same CATH superfamily
3CKQA 4HG6A 4Y64A 5C36A 2X5SA 3U2XA 4EE4A 5IDTA 5C3DA 2RJ4A 5IFYA 1NMMB 2UX8A 2FY7A 5AJOA 3SX3A 3OH1A 5C1LA 1V84A 1JVGA 2FYDB 1O7OA 1R7VA 1NF5B 1FGGA 5DDVA 1YP2A 4FCUA 4M28A 2AGDA 1LZIA 2V0HA 4FRMA 1ZIZA 2OEGA 4D11C 2JCOA 1FO8A 2RIYA 3CU0A 1R82A 5C49A 1R7TA 3V0LA 1FOAA 4LW6A 2FYAA 1FXJA 4HO5A 4IRQA 4CJ8A 2XMHA 1JV3A 5CQLX 1ZHJA 4LW3A 2O1FA 3SXAA 5C8RA 4MNDA 3CKOA 2WE9A 2VFZA 2E3DA 1VGWA 1GQ9A 3V90A 4DECA 1OQMB 4KC2A 1VZTA 4D48A 3OH0A 1HJJA 2Y4KA 1ZCYA 1ZDFA 3T7OA 3SX8A 1JVDA 2Z86A 4YS8A 5CMIA 1QGSA 1VGTA 4Y7VA 4KRVA 1W57A 2YC3A 2RJ1A 2V0LA 2FFVA 1FR8A 5EIYA 4D0ZA 2I7BA 3CKJA 5AJNA 1EZIA 2FYBA 1GWVA 2AM4A 1YROB 3NGWA 1PZTA 2E8BA 2VD4A 2X60A 4P02A 1VM8A 1QG8A 3IOHA 2ZU7A 4AAWA 3POLA 1WT0A 4FRHA 2O1GA 4HO9A 1H5TB 1LL0A 2YC5A 1JYKA 2PX7A 5C3AA 4ASJA 4G3SA 2QGIA 1NWGB 4HO2A 2OEFA 3IOIA 3USQA 4KC4A 2WVKA 1LZJA 3V0PA 1H4DA 1KWSA 2XMEA 4Y62A 3V0OA 1EYRA 3SXCA 2ICYA 4AC3A 1ZDGA 3I0KA 4Y6UA 3T7MA 4KPZA 4G87A 1SS9A 3ZGGA 1INIA 1VICA 4G3PA 3DK5A 3ZLKA 5L6SA 1YP4A 3D98A 2J0AA 1HM9A 5FUHA 5BXCA 2D7RA 1ZI3A 2AESA 3I0DA 2J0BA 5C4DA 4AYJA 2RJ0A 1WT2A 1HV9A 1IIMA 1R80A 1S4OA 1W77A 4BMAA 1ZJOA 1H5SB 2OI5A 1HM8A 5C3BA 3FWWA 3OAMA 1H7LA 2DPWA 3Q4SA 5C4BA 4FRDA 1MP4A 3V0NA 3SXEA 5FTVA 2O1HA 1LZ0A 1R7YA 2VXLA 2RIXA 1H5SC 3SXGA 3V0MA 4UEGA 2VSHA 4B42A 3OH2A 1TVYA 1NHEB 4Y6NA 2C0NA 4B4MA 1FRWA 2PGYA 2RITA 1G0RA 3V0QA 2VXMA 1NKHB 4AYLA 3U2WA 1VZXA 1ZCTA 1GX0A 4FIXA 4EEMA 5C4CA 5FU0A 2RIZA 3U0XA 2Q4JA 1NQIB 4M4KA 4B2XA 2BO6A 1H7HA 2V0KA 5C48A 2JCKA 1S4PA 2W0VA 5C47A 4NANA 3FOQA 2JCJA 3EE5A 2FFUA 3OC9A 4FRPA 4Y63A 4DDZA 3RMVA 3SXDA 4CJCA 1O7QA 2VS5A 3I0CA 1G1LA 1VH3A 4HO3A 5FU8A 4HO0A 1R7UA 1OMZA 3U2TA 1G3LA 3U2UA 4NAKA 4KNXA 1E5KA 2RJ9A 2BO4A 2Y4LA 5CMJA 3ZGFA 5CQNX 4KQLA 2XWLA 2GGOA 5CQMX 2WAWA 2A8UA 1GX4A 1H5SD 3DUVA 1LL2A 2Y4MA 4HO6A 3RMWA 1H7TA 3SPTA 4L41C 3I0EA 3K8DA 2QKXA 4B4BA 1ON6A 2PA4A 1WT1A 2P6WA 5C4FA 4FREA 3Q80A 5CMHA 5D92A 1IINA 3R2WA 1V82A 5DDTA 4ASYA 2YESA 3I0IX 5CMFX 4EEAA 1XZ6A 4MIXA 3E26A 2GGQA 1W55A 2AM3A 1O0RA 3JUKA 2JCLA 5EJ1A 1H5RA 4IRPA 1FZWA 1FG5N 2I5EA 3K8EA 4Y7TA 3D5NA 5IDSA 2NXVA 4ZDQA 2X65A 1LL3A 4P00A 3QVBA 2VS3A 3I0JA 3BRKX 2Z87A 4FROA 4K6RA 2P73A 4B2WA 1H7QA 1PZYB 3T7NA 1K4VA 2YCMA 3ZF8A 1WT3A 1ZCUA 4Y7UA 1HJLA 4D11A 2RJ6A 1FXOA 2AECA 4FRLA 2CU2A 3HL3A 3OGZA 4FRQA 3SX7A 3D8VA 3TQDA 3KIAA 3OH4A 2QH5A 1ZI5A 3BCVA 1V83A 1YP3A 1H4EA 1TZFA 2VSIA 1FGXA 4FCEA 1JYLA 3TZTA 2FYCB 2AM5A 3GUEA 4M2AA 4R7PA 3F1CA 1G97A 1ZI4A 3E25A 4Y7GA 5JQQA 3I0LA 1QWJA 1G8OA 4XWIA 1ZCVA 3PKPA 1I52A 4GBPA 1FO9A 2YQCA 3CGXA 5HS2A 5C1HA 2YQSA 3LW6A 4J18A 4FRBA 4JD0A 5J49A 1GWWA 1H7FA 2D0JA 4B5BA 1H7GA 1Z90A 3CKNA 2V0IA 3I0GA 4EE3A 4BQHA 5FTSA 3V91A 1VGUA 2ICXA 1VPAA 5FYEA 1MP5A 1O23B 3I0HA 4CJBA 1LZ7A 1R81A 3ZLLA 4EEOA 2ZU8A 2I5KA 3R3IA 1LVWA 2VS4A 4EVWA 2OI7A 5C38A 2X5ZA 4C2SA 3OH3A 3F1YA 4D0TA 4NAIA 3U2VA 1H3MA 4KNRA 1H4CA 2RJ7A 1ZJ1A 3JUJA 4FQWA 3PNNA 2V0JA 1FR9A 4G3QA 2A8WA 3Q7UA 2D7IA 1FWYA 4ARWA 4O6NA 3RSBA 3V8YA 1H5TA 2WGZA 1TW5A 1G23A 4NALA 3CKVA 1ZJ3A 3PKQA 2YQHA 1VH1A 5CQOA 5CMGX 4FIYA 2Y6PA 2OI6A 5I1FA 1R7XA 3SXBA 2RJ8A 1WSZA 4HCQA 1GA8A 1HM0A 2AE7A 2XWNA 4ECMA 1ZJPA 1MP3A 4KXOA 4B4GA 3ST8A 2Y4JA 4HO4A 3V8ZA 2VK9A 5AJPA 4CVHA 3IOJA 1INJA 1TW1A 1G93A 1H7EA 2MZBA 2BO8A 4DE7A 2W0WA 3I0FA 3OKRA 5C1GA 4Q7CA 4JISA 3USRA 5C4EA 1ZI1A 3N9WA 2BO7A 2WVLA 1ON8A 3U0YA 2WVMA 4FRAA 1H5SA 2ZU9A 4Y9XA 2YQJA 5CQPA 1QGQA 1JV1A 2RJ5A 4HOCA 2P72A 1ZJ0A 3DJ4A 1G9RA 4B3UA 4M2BA 5EJZA 1S4NA 3O3PA 4EEGA 4E1KA 1G95A 4KC1A 4EE5A 4O6MA 5L6VA 1VZUA 1OMXA 4Y7FA 3SX5A 2AH9A 1XHBA 4KPXA 1ZJ2A 1G2VA 1VGZA 2APCA 2WEEA 2PGVA 4HO8A 1GQCA 1H5RB 5FV9A 5D91A 4KT7A 4MYBA 3JTJA 2Y7AA 1WVCA 2XWMA 1MC3A
chains in the Genus database with same CATH topology
3CKQA 4HG6A 4Y64A 5C36A 2X5SA 3U2XA 4EE4A 5IDTA 5C3DA 2RJ4A 5IFYA 1NMMB 2UX8A 2FY7A 5AJOA 3SX3A 3OH1A 5C1LA 1V84A 1JVGA 2FYDB 1O7OA 1R7VA 1NF5B 1FGGA 5DDVA 1YP2A 4FCUA 4M28A 2AGDA 1LZIA 2V0HA 4FRMA 1ZIZA 2OEGA 4D11C 2JCOA 1FO8A 2RIYA 3CU0A 1R82A 5C49A 1R7TA 3V0LA 1FOAA 4LW6A 2FYAA 1FXJA 4HO5A 4IRQA 4CJ8A 2XMHA 1JV3A 5CQLX 1ZHJA 4LW3A 2O1FA 3SXAA 5C8RA 4MNDA 3CKOA 2WE9A 2VFZA 2E3DA 1VGWA 1GQ9A 3V90A 4DECA 1OQMB 4KC2A 1VZTA 4D48A 3OH0A 1HJJA 2Y4KA 1ZCYA 1ZDFA 3T7OA 3SX8A 1JVDA 2Z86A 4YS8A 5CMIA 1QGSA 1VGTA 4Y7VA 4KRVA 1W57A 2YC3A 2RJ1A 2V0LA 2FFVA 1FR8A 5EIYA 4D0ZA 2I7BA 3CKJA 5AJNA 1EZIA 2FYBA 1GWVA 2AM4A 1YROB 3NGWA 1PZTA 2E8BA 2VD4A 2X60A 4P02A 1VM8A 1QG8A 3IOHA 2ZU7A 4AAWA 3POLA 1WT0A 4FRHA 2O1GA 4HO9A 1H5TB 1LL0A 2YC5A 1JYKA 2PX7A 5C3AA 4ASJA 4G3SA 2QGIA 1NWGB 4HO2A 2OEFA 3IOIA 3USQA 4KC4A 2WVKA 1LZJA 3V0PA 1H4DA 1KWSA 2XMEA 4Y62A 3V0OA 1EYRA 3SXCA 2ICYA 4AC3A 1ZDGA 3I0KA 4Y6UA 3T7MA 4KPZA 4G87A 1SS9A 3ZGGA 1INIA 1VICA 4G3PA 3DK5A 3ZLKA 5L6SA 1YP4A 3D98A 2J0AA 1HM9A 5FUHA 5BXCA 2D7RA 1ZI3A 2AESA 3I0DA 2J0BA 5C4DA 4AYJA 2RJ0A 1WT2A 1HV9A 1IIMA 1R80A 1S4OA 1W77A 4BMAA 1ZJOA 1H5SB 2OI5A 1HM8A 5C3BA 3FWWA 3OAMA 1H7LA 2DPWA 3Q4SA 5C4BA 4FRDA 1MP4A 3V0NA 3SXEA 5FTVA 2O1HA 1LZ0A 1R7YA 2VXLA 2RIXA 1H5SC 3SXGA 3V0MA 4UEGA 2VSHA 4B42A 3OH2A 1TVYA 1NHEB 4Y6NA 2C0NA 4B4MA 1FRWA 2PGYA 2RITA 1G0RA 3V0QA 2VXMA 1NKHB 4AYLA 3U2WA 1VZXA 1ZCTA 1GX0A 4FIXA 4EEMA 5C4CA 5FU0A 2RIZA 3U0XA 2Q4JA 1NQIB 4M4KA 4B2XA 2BO6A 1H7HA 2V0KA 5C48A 2JCKA 1S4PA 2W0VA 5C47A 4NANA 3FOQA 2JCJA 3EE5A 2FFUA 3OC9A 4FRPA 4Y63A 4DDZA 3RMVA 3SXDA 4CJCA 1O7QA 2VS5A 3I0CA 1G1LA 1VH3A 4HO3A 5FU8A 4HO0A 1R7UA 1OMZA 3U2TA 1G3LA 3U2UA 4NAKA 4KNXA 1E5KA 2RJ9A 2BO4A 2Y4LA 5CMJA 3ZGFA 5CQNX 4KQLA 2XWLA 2GGOA 5CQMX 2WAWA 2A8UA 1GX4A 1H5SD 3DUVA 1LL2A 2Y4MA 4HO6A 3RMWA 1H7TA 3SPTA 4L41C 3I0EA 3K8DA 2QKXA 4B4BA 1ON6A 2PA4A 1WT1A 2P6WA 5C4FA 4FREA 3Q80A 5CMHA 5D92A 1IINA 3R2WA 1V82A 5DDTA 4ASYA 2YESA 3I0IX 5CMFX 4EEAA 1XZ6A 4MIXA 3E26A 2GGQA 1W55A 2AM3A 1O0RA 3JUKA 2JCLA 5EJ1A 1H5RA 4IRPA 1FZWA 1FG5N 2I5EA 3K8EA 4Y7TA 3D5NA 5IDSA 2NXVA 4ZDQA 2X65A 1LL3A 4P00A 3QVBA 2VS3A 3I0JA 3BRKX 2Z87A 4FROA 4K6RA 2P73A 4B2WA 1H7QA 1PZYB 3T7NA 1K4VA 2YCMA 3ZF8A 1WT3A 1ZCUA 4Y7UA 1HJLA 4D11A 2RJ6A 1FXOA 2AECA 4FRLA 2CU2A 3HL3A 3OGZA 4FRQA 3SX7A 3D8VA 3TQDA 3KIAA 3OH4A 2QH5A 1ZI5A 3BCVA 1V83A 1YP3A 1H4EA 1TZFA 2VSIA 1FGXA 4FCEA 1JYLA 3TZTA 2FYCB 2AM5A 3GUEA 4M2AA 4R7PA 3F1CA 1G97A 1ZI4A 3E25A 4Y7GA 5JQQA 3I0LA 1QWJA 1G8OA 4XWIA 1ZCVA 3PKPA 1I52A 4GBPA 1FO9A 2YQCA 3CGXA 5HS2A 5C1HA 2YQSA 3LW6A 4J18A 4FRBA 4JD0A 5J49A 1GWWA 1H7FA 2D0JA 4B5BA 1H7GA 1Z90A 3CKNA 2V0IA 3I0GA 4EE3A 4BQHA 5FTSA 3V91A 1VGUA 2ICXA 1VPAA 5FYEA 1MP5A 1O23B 3I0HA 4CJBA 1LZ7A 1R81A 3ZLLA 4EEOA 2ZU8A 2I5KA 3R3IA 1LVWA 2VS4A 4EVWA 2OI7A 5C38A 2X5ZA 4C2SA 3OH3A 3F1YA 4D0TA 4NAIA 3U2VA 1H3MA 4KNRA 1H4CA 2RJ7A 1ZJ1A 3JUJA 4FQWA 3PNNA 2V0JA 1FR9A 4G3QA 2A8WA 3Q7UA 2D7IA 1FWYA 4ARWA 4O6NA 3RSBA 3V8YA 1H5TA 2WGZA 1TW5A 1G23A 4NALA 3CKVA 1ZJ3A 3PKQA 2YQHA 1VH1A 5CQOA 5CMGX 4FIYA 2Y6PA 2OI6A 5I1FA 1R7XA 3SXBA 2RJ8A 1WSZA 4HCQA 1GA8A 1HM0A 2AE7A 2XWNA 4ECMA 1ZJPA 1MP3A 4KXOA 4B4GA 3ST8A 2Y4JA 4HO4A 3V8ZA 2VK9A 5AJPA 4CVHA 3IOJA 1INJA 1TW1A 1G93A 1H7EA 2MZBA 2BO8A 4DE7A 2W0WA 3I0FA 3OKRA 5C1GA 4Q7CA 4JISA 3USRA 5C4EA 1ZI1A 3N9WA 2BO7A 2WVLA 1ON8A 3U0YA 2WVMA 4FRAA 1H5SA 2ZU9A 4Y9XA 2YQJA 5CQPA 1QGQA 1JV1A 2RJ5A 4HOCA 2P72A 1ZJ0A 3DJ4A 1G9RA 4B3UA 4M2BA 5EJZA 1S4NA 3O3PA 4EEGA 4E1KA 1G95A 4KC1A 4EE5A 4O6MA 5L6VA 1VZUA 1OMXA 4Y7FA 3SX5A 2AH9A 1XHBA 4KPXA 1ZJ2A 1G2VA 1VGZA 2APCA 2WEEA 2PGVA 4HO8A 1GQCA 1H5RB 5FV9A 5D91A 4KT7A 4MYBA 3JTJA 2Y7AA 1WVCA 2XWMA 1MC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKQ A;  4HG6 A;  4Y64 A;  5C36 A;  2X5S A;  3U2X A;  4EE4 A;  5IDT A;  5C3D A;  2RJ4 A;  5IFY A;  1NMM B;  2UX8 A;  2FY7 A;  5AJO A;  3SX3 A;  3OH1 A;  5C1L A;  1V84 A;  1JVG A;  2FYD B;  1O7O A;  1R7V A;  1NF5 B;  1FGG A;  5DDV A;  1YP2 A;  4FCU A;  4M28 A;  2AGD A;  1LZI A;  2V0H A;  4FRM A;  1ZIZ A;  2OEG A;  4D11 C;  2JCO A;  1FO8 A;  2RIY A;  3CU0 A;  1R82 A;  5C49 A;  1R7T A;  3V0L A;  1FOA A;  4LW6 A;  2FYA A;  1FXJ A;  4HO5 A;  4IRQ A;  4CJ8 A;  2XMH A;  1JV3 A;  5CQL X;  1ZHJ A;  4LW3 A;  2O1F A;  3SXA A;  5C8R A;  4MND A;  3CKO A;  2WE9 A;  2VFZ A;  2E3D A;  1VGW A;  1GQ9 A;  3V90 A;  4DEC A;  1OQM B;  4KC2 A;  1VZT A;  4D48 A;  3OH0 A;  1HJJ A;  2Y4K A;  1ZCY A;  1ZDF A;  3T7O A;  3SX8 A;  1JVD A;  2Z86 A;  4YS8 A;  5CMI A;  1QGS A;  1VGT A;  4Y7V A;  4KRV A;  1W57 A;  2YC3 A;  2RJ1 A;  2V0L A;  2FFV A;  1FR8 A;  5EIY A;  4D0Z A;  2I7B A;  3CKJ A;  5AJN A;  1EZI A;  2FYB A;  1GWV A;  2AM4 A;  1YRO B;  3NGW A;  1PZT A;  2E8B A;  2VD4 A;  2X60 A;  4P02 A;  1VM8 A;  1QG8 A;  3IOH A;  2ZU7 A;  4AAW A;  3POL A;  1WT0 A;  4FRH A;  2O1G A;  4HO9 A;  1H5T B;  1LL0 A;  2YC5 A;  1JYK A;  2PX7 A;  5C3A A;  4ASJ A;  4G3S A;  2QGI A;  1NWG B;  4HO2 A;  2OEF A;  3IOI A;  3USQ A;  4KC4 A;  2WVK A;  1LZJ A;  3V0P A;  1H4D A;  1KWS A;  2XME A;  4Y62 A;  3V0O A;  1EYR A;  3SXC A;  2ICY A;  4AC3 A;  1ZDG A;  3I0K A;  4Y6U A;  3T7M A;  4KPZ A;  4G87 A;  1SS9 A;  3ZGG A;  1INI A;  1VIC A;  4G3P A;  3DK5 A;  3ZLK A;  5L6S A;  1YP4 A;  3D98 A;  5FUH A;  1HM9 A;  5BXC A;  2D7R A;  1ZI3 A;  2AES A;  3I0D A;  5C4D A;  4AYJ A;  2RJ0 A;  1WT2 A;  1HV9 A;  1IIM A;  1R80 A;  1S4O A;  1W77 A;  4BMA A;  1ZJO A;  1H5S B;  2OI5 A;  1HM8 A;  5C3B A;  3FWW A;  3OAM A;  1H7L A;  2DPW A;  3Q4S A;  5C4B A;  4FRD A;  1MP4 A;  3V0N A;  3SXE A;  5FTV A;  2O1H A;  1LZ0 A;  1R7Y A;  2VXL A;  2RIX A;  1H5S C;  3SXG A;  3V0M A;  4UEG A;  2VSH A;  4B42 A;  3OH2 A;  1TVY A;  1NHE B;  4Y6N A;  4B4M A;  1FRW A;  2PGY A;  2RIT A;  1G0R A;  3V0Q A;  2VXM A;  1NKH B;  4AYL A;  3U2W A;  1VZX A;  1ZCT A;  1GX0 A;  4EEM A;  5C4C A;  5FU0 A;  2RIZ A;  3U0X A;  2Q4J A;  1NQI B;  4M4K A;  4B2X A;  2BO6 A;  1H7H A;  2V0K A;  5C48 A;  2JCK A;  1S4P A;  2W0V A;  5C47 A;  4NAN A;  3FOQ A;  2JCJ A;  3EE5 A;  2FFU A;  3OC9 A;  4FRP A;  4Y63 A;  4DDZ A;  3RMV A;  3SXD A;  4CJC A;  1O7Q A;  2VS5 A;  3I0C A;  1G1L A;  1VH3 A;  4HO3 A;  5FU8 A;  4HO0 A;  1R7U A;  1OMZ A;  3U2T A;  1G3L A;  3U2U A;  4NAK A;  4KNX A;  1E5K A;  2RJ9 A;  2BO4 A;  2Y4L A;  5CMJ A;  3ZGF A;  5CQN X;  4KQL A;  2XWL A;  2GGO A;  5CQM X;  2WAW A;  2A8U A;  1GX4 A;  1H5S D;  3DUV A;  1LL2 A;  2Y4M A;  4HO6 A;  3RMW A;  1H7T A;  3SPT A;  4L41 C;  3I0E A;  3K8D A;  2QKX A;  4B4B A;  1ON6 A;  2PA4 A;  1WT1 A;  2P6W A;  5C4F A;  4FRE A;  3Q80 A;  5CMH A;  1IIN A;  3R2W A;  1V82 A;  5DDT A;  4ASY A;  2YES A;  3I0I X;  5CMF X;  4EEA A;  1XZ6 A;  3E26 A;  2GGQ A;  1W55 A;  2AM3 A;  1O0R A;  3JUK A;  2JCL A;  5EJ1 A;  1H5R A;  4IRP A;  1FZW A;  1FG5 N;  2I5E A;  3K8E A;  4Y7T A;  3D5N A;  5IDS A;  2NXV A;  4ZDQ A;  2X65 A;  1LL3 A;  4P00 A;  3QVB A;  2VS3 A;  3I0J A;  3BRK X;  2Z87 A;  4FRO A;  4K6R A;  2P73 A;  4B2W A;  1H7Q A;  1PZY B;  3T7N A;  1K4V A;  2YCM A;  3ZF8 A;  1WT3 A;  1ZCU A;  4Y7U A;  1HJL A;  4D11 A;  2RJ6 A;  1FXO A;  2AEC A;  4FRL A;  2CU2 A;  3HL3 A;  3OGZ A;  4FRQ A;  3SX7 A;  3D8V A;  3TQD A;  3KIA A;  3OH4 A;  2QH5 A;  1ZI5 A;  3BCV A;  1V83 A;  1YP3 A;  1H4E A;  1TZF A;  2VSI A;  1FGX A;  4FCE A;  1JYL A;  3TZT A;  2FYC B;  2AM5 A;  3GUE A;  4M2A A;  4R7P A;  3F1C A;  1G97 A;  1ZI4 A;  3E25 A;  4Y7G A;  5JQQ A;  3I0L A;  1QWJ A;  1G8O A;  4XWI A;  1ZCV A;  3PKP A;  1I52 A;  4GBP A;  1FO9 A;  2YQC A;  3CGX A;  5HS2 A;  5C1H A;  2YQS A;  3LW6 A;  4J18 A;  4FRB A;  4JD0 A;  5J49 A;  1GWW A;  1H7F A;  2D0J A;  4B5B A;  1H7G A;  1Z90 A;  3CKN A;  2V0I A;  3I0G A;  4EE3 A;  4BQH A;  5FTS A;  3V91 A;  1VGU A;  2ICX A;  1VPA A;  5FYE A;  1MP5 A;  1O23 B;  3I0H A;  4CJB A;  1LZ7 A;  1R81 A;  3ZLL A;  4EEO A;  2ZU8 A;  2I5K A;  3R3I A;  1LVW A;  2VS4 A;  4EVW A;  2OI7 A;  5C38 A;  2X5Z A;  4C2S A;  3OH3 A;  3F1Y A;  4D0T A;  4NAI A;  3U2V A;  1H3M A;  4KNR A;  1H4C A;  2RJ7 A;  1ZJ1 A;  3JUJ A;  4FQW A;  3PNN A;  2V0J A;  1FR9 A;  4G3Q A;  2A8W A;  3Q7U A;  2D7I A;  1FWY A;  4ARW A;  3RSB A;  3V8Y A;  1H5T A;  2WGZ A;  1TW5 A;  1G23 A;  4NAL A;  3CKV A;  1ZJ3 A;  3PKQ A;  2YQH A;  1VH1 A;  5CQO A;  5CMG X;  2Y6P A;  2OI6 A;  5I1F A;  1R7X A;  3SXB A;  2RJ8 A;  1WSZ A;  4HCQ A;  1GA8 A;  1HM0 A;  2AE7 A;  2XWN A;  4ECM A;  1ZJP A;  1MP3 A;  4KXO A;  4B4G A;  3ST8 A;  2Y4J A;  4HO4 A;  3V8Z A;  5AJP A;  4CVH A;  3IOJ A;  1INJ A;  1TW1 A;  1G93 A;  1H7E A;  2MZB A;  2BO8 A;  4DE7 A;  2W0W A;  3I0F A;  3OKR A;  5C1G A;  4JIS A;  3USR A;  5C4E A;  1ZI1 A;  3N9W A;  2BO7 A;  2WVL A;  1ON8 A;  3U0Y A;  2WVM A;  4FRA A;  1H5S A;  2ZU9 A;  4Y9X A;  2YQJ A;  5CQP A;  1QGQ A;  1JV1 A;  2RJ5 A;  4HOC A;  2P72 A;  1ZJ0 A;  3DJ4 A;  1G9R A;  4B3U A;  4M2B A;  5EJZ A;  1S4N A;  3O3P A;  4EEG A;  4E1K A;  1G95 A;  4KC1 A;  4EE5 A;  5L6V A;  1VZU A;  1OMX A;  4Y7F A;  3SX5 A;  2AH9 A;  1XHB A;  4KPX A;  1ZJ2 A;  1G2V A;  1VGZ A;  2APC A;  2WEE A;  2PGV A;  4HO8 A;  1GQC A;  1H5R B;  5FV9 A;  4KT7 A;  4MYB A;  3JTJ A;  2Y7A A;  1WVC A;  2XWM A;  1MC3 A; 
#chains in the Genus database with same CATH topology
 3CKQ A;  4HG6 A;  4Y64 A;  5C36 A;  2X5S A;  3U2X A;  4EE4 A;  5IDT A;  5C3D A;  2RJ4 A;  5IFY A;  1NMM B;  2UX8 A;  2FY7 A;  5AJO A;  3SX3 A;  3OH1 A;  5C1L A;  1V84 A;  1JVG A;  2FYD B;  1O7O A;  1R7V A;  1NF5 B;  1FGG A;  5DDV A;  1YP2 A;  4FCU A;  4M28 A;  2AGD A;  1LZI A;  2V0H A;  4FRM A;  1ZIZ A;  2OEG A;  4D11 C;  2JCO A;  1FO8 A;  2RIY A;  3CU0 A;  1R82 A;  5C49 A;  1R7T A;  3V0L A;  1FOA A;  4LW6 A;  2FYA A;  1FXJ A;  4HO5 A;  4IRQ A;  4CJ8 A;  2XMH A;  1JV3 A;  5CQL X;  1ZHJ A;  4LW3 A;  2O1F A;  3SXA A;  5C8R A;  4MND A;  3CKO A;  2WE9 A;  2VFZ A;  2E3D A;  1VGW A;  1GQ9 A;  3V90 A;  4DEC A;  1OQM B;  4KC2 A;  1VZT A;  4D48 A;  3OH0 A;  1HJJ A;  2Y4K A;  1ZCY A;  1ZDF A;  3T7O A;  3SX8 A;  1JVD A;  2Z86 A;  4YS8 A;  5CMI A;  1QGS A;  1VGT A;  4Y7V A;  4KRV A;  1W57 A;  2YC3 A;  2RJ1 A;  2V0L A;  2FFV A;  1FR8 A;  5EIY A;  4D0Z A;  2I7B A;  3CKJ A;  5AJN A;  1EZI A;  2FYB A;  1GWV A;  2AM4 A;  1YRO B;  3NGW A;  1PZT A;  2E8B A;  2VD4 A;  2X60 A;  4P02 A;  1VM8 A;  1QG8 A;  3IOH A;  2ZU7 A;  4AAW A;  3POL A;  1WT0 A;  4FRH A;  2O1G A;  4HO9 A;  1H5T B;  1LL0 A;  2YC5 A;  1JYK A;  2PX7 A;  5C3A A;  4ASJ A;  4G3S A;  2QGI A;  1NWG B;  4HO2 A;  2OEF A;  3IOI A;  3USQ A;  4KC4 A;  2WVK A;  1LZJ A;  3V0P A;  1H4D A;  1KWS A;  2XME A;  4Y62 A;  3V0O A;  1EYR A;  3SXC A;  2ICY A;  4AC3 A;  1ZDG A;  3I0K A;  4Y6U A;  3T7M A;  4KPZ A;  4G87 A;  1SS9 A;  3ZGG A;  1INI A;  1VIC A;  4G3P A;  3DK5 A;  3ZLK A;  5L6S A;  1YP4 A;  3D98 A;  2J0A A;  1HM9 A;  5FUH A;  5BXC A;  2D7R A;  1ZI3 A;  2AES A;  3I0D A;  2J0B A;  5C4D A;  4AYJ A;  2RJ0 A;  1WT2 A;  1HV9 A;  1IIM A;  1R80 A;  1S4O A;  1W77 A;  4BMA A;  1ZJO A;  1H5S B;  2OI5 A;  1HM8 A;  5C3B A;  3FWW A;  3OAM A;  1H7L A;  2DPW A;  3Q4S A;  5C4B A;  4FRD A;  1MP4 A;  3V0N A;  3SXE A;  5FTV A;  2O1H A;  1LZ0 A;  1R7Y A;  2VXL A;  2RIX A;  1H5S C;  3SXG A;  3V0M A;  4UEG A;  2VSH A;  4B42 A;  3OH2 A;  1TVY A;  1NHE B;  4Y6N A;  2C0N A;  4B4M A;  1FRW A;  2PGY A;  2RIT A;  1G0R A;  3V0Q A;  2VXM A;  1NKH B;  4AYL A;  3U2W A;  1VZX A;  1ZCT A;  1GX0 A;  4FIX A;  4EEM A;  5C4C A;  5FU0 A;  2RIZ A;  3U0X A;  2Q4J A;  1NQI B;  4M4K A;  4B2X A;  2BO6 A;  1H7H A;  2V0K A;  5C48 A;  2JCK A;  1S4P A;  2W0V A;  5C47 A;  4NAN A;  3FOQ A;  2JCJ A;  3EE5 A;  2FFU A;  3OC9 A;  4FRP A;  4Y63 A;  4DDZ A;  3RMV A;  3SXD A;  4CJC A;  1O7Q A;  2VS5 A;  3I0C A;  1G1L A;  1VH3 A;  4HO3 A;  5FU8 A;  4HO0 A;  1R7U A;  1OMZ A;  3U2T A;  1G3L A;  3U2U A;  4NAK A;  4KNX A;  1E5K A;  2RJ9 A;  2BO4 A;  2Y4L A;  5CMJ A;  3ZGF A;  5CQN X;  4KQL A;  2XWL A;  2GGO A;  5CQM X;  2WAW A;  2A8U A;  1GX4 A;  1H5S D;  3DUV A;  1LL2 A;  2Y4M A;  4HO6 A;  3RMW A;  1H7T A;  3SPT A;  4L41 C;  3I0E A;  3K8D A;  2QKX A;  4B4B A;  1ON6 A;  2PA4 A;  1WT1 A;  2P6W A;  5C4F A;  4FRE A;  3Q80 A;  5CMH A;  5D92 A;  1IIN A;  3R2W A;  1V82 A;  5DDT A;  4ASY A;  2YES A;  3I0I X;  5CMF X;  4EEA A;  1XZ6 A;  4MIX A;  3E26 A;  2GGQ A;  1W55 A;  2AM3 A;  1O0R A;  3JUK A;  2JCL A;  5EJ1 A;  1H5R A;  4IRP A;  1FZW A;  1FG5 N;  2I5E A;  3K8E A;  4Y7T A;  3D5N A;  5IDS A;  2NXV A;  4ZDQ A;  2X65 A;  1LL3 A;  4P00 A;  3QVB A;  2VS3 A;  3I0J A;  3BRK X;  2Z87 A;  4FRO A;  4K6R A;  2P73 A;  4B2W A;  1H7Q A;  1PZY B;  3T7N A;  1K4V A;  2YCM A;  3ZF8 A;  1WT3 A;  1ZCU A;  4Y7U A;  1HJL A;  4D11 A;  2RJ6 A;  1FXO A;  2AEC A;  4FRL A;  2CU2 A;  3HL3 A;  3OGZ A;  4FRQ A;  3SX7 A;  3D8V A;  3TQD A;  3KIA A;  3OH4 A;  2QH5 A;  1ZI5 A;  3BCV A;  1V83 A;  1YP3 A;  1H4E A;  1TZF A;  2VSI A;  1FGX A;  4FCE A;  1JYL A;  3TZT A;  2FYC B;  2AM5 A;  3GUE A;  4M2A A;  4R7P A;  3F1C A;  1G97 A;  1ZI4 A;  3E25 A;  4Y7G A;  5JQQ A;  3I0L A;  1QWJ A;  1G8O A;  4XWI A;  1ZCV A;  3PKP A;  1I52 A;  4GBP A;  1FO9 A;  2YQC A;  3CGX A;  5HS2 A;  5C1H A;  2YQS A;  3LW6 A;  4J18 A;  4FRB A;  4JD0 A;  5J49 A;  1GWW A;  1H7F A;  2D0J A;  4B5B A;  1H7G A;  1Z90 A;  3CKN A;  2V0I A;  3I0G A;  4EE3 A;  4BQH A;  5FTS A;  3V91 A;  1VGU A;  2ICX A;  1VPA A;  5FYE A;  1MP5 A;  1O23 B;  3I0H A;  4CJB A;  1LZ7 A;  1R81 A;  3ZLL A;  4EEO A;  2ZU8 A;  2I5K A;  3R3I A;  1LVW A;  2VS4 A;  4EVW A;  2OI7 A;  5C38 A;  2X5Z A;  4C2S A;  3OH3 A;  3F1Y A;  4D0T A;  4NAI A;  3U2V A;  1H3M A;  4KNR A;  1H4C A;  2RJ7 A;  1ZJ1 A;  3JUJ A;  4FQW A;  3PNN A;  2V0J A;  1FR9 A;  4G3Q A;  2A8W A;  3Q7U A;  2D7I A;  1FWY A;  4ARW A;  4O6N A;  3RSB A;  3V8Y A;  1H5T A;  2WGZ A;  1TW5 A;  1G23 A;  4NAL A;  3CKV A;  1ZJ3 A;  3PKQ A;  2YQH A;  1VH1 A;  5CQO A;  5CMG X;  4FIY A;  2Y6P A;  2OI6 A;  5I1F A;  1R7X A;  3SXB A;  2RJ8 A;  1WSZ A;  4HCQ A;  1GA8 A;  1HM0 A;  2AE7 A;  2XWN A;  4ECM A;  1ZJP A;  1MP3 A;  4KXO A;  4B4G A;  3ST8 A;  2Y4J A;  4HO4 A;  3V8Z A;  2VK9 A;  5AJP A;  4CVH A;  3IOJ A;  1INJ A;  1TW1 A;  1G93 A;  1H7E A;  2MZB A;  2BO8 A;  4DE7 A;  2W0W A;  3I0F A;  3OKR A;  5C1G A;  4Q7C A;  4JIS A;  3USR A;  5C4E A;  1ZI1 A;  3N9W A;  2BO7 A;  2WVL A;  1ON8 A;  3U0Y A;  2WVM A;  4FRA A;  1H5S A;  2ZU9 A;  4Y9X A;  2YQJ A;  5CQP A;  1QGQ A;  1JV1 A;  2RJ5 A;  4HOC A;  2P72 A;  1ZJ0 A;  3DJ4 A;  1G9R A;  4B3U A;  4M2B A;  5EJZ A;  1S4N A;  3O3P A;  4EEG A;  4E1K A;  1G95 A;  4KC1 A;  4EE5 A;  4O6M A;  5L6V A;  1VZU A;  1OMX A;  4Y7F A;  3SX5 A;  2AH9 A;  1XHB A;  4KPX A;  1ZJ2 A;  1G2V A;  1VGZ A;  2APC A;  2WEE A;  2PGV A;  4HO8 A;  1GQC A;  1H5R B;  5FV9 A;  5D91 A;  4KT7 A;  4MYB A;  3JTJ A;  2Y7A A;  1WVC A;  2XWM A;  1MC3 A; 
#chains in the Genus database with same CATH homology
 3CKQ A;  4HG6 A;  4Y64 A;  5C36 A;  2X5S A;  3U2X A;  4EE4 A;  5IDT A;  5C3D A;  2RJ4 A;  5IFY A;  1NMM B;  2UX8 A;  2FY7 A;  5AJO A;  3SX3 A;  3OH1 A;  5C1L A;  1V84 A;  1JVG A;  2FYD B;  1O7O A;  1R7V A;  1NF5 B;  1FGG A;  5DDV A;  1YP2 A;  4FCU A;  4M28 A;  2AGD A;  1LZI A;  2V0H A;  4FRM A;  1ZIZ A;  2OEG A;  4D11 C;  2JCO A;  1FO8 A;  2RIY A;  3CU0 A;  1R82 A;  5C49 A;  1R7T A;  3V0L A;  1FOA A;  4LW6 A;  2FYA A;  1FXJ A;  4HO5 A;  4IRQ A;  4CJ8 A;  2XMH A;  1JV3 A;  5CQL X;  1ZHJ A;  4LW3 A;  2O1F A;  3SXA A;  5C8R A;  4MND A;  3CKO A;  2WE9 A;  2VFZ A;  2E3D A;  1VGW A;  1GQ9 A;  3V90 A;  4DEC A;  1OQM B;  4KC2 A;  1VZT A;  4D48 A;  3OH0 A;  1HJJ A;  2Y4K A;  1ZCY A;  1ZDF A;  3T7O A;  3SX8 A;  1JVD A;  2Z86 A;  4YS8 A;  5CMI A;  1QGS A;  1VGT A;  4Y7V A;  4KRV A;  1W57 A;  2YC3 A;  2RJ1 A;  2V0L A;  2FFV A;  1FR8 A;  5EIY A;  4D0Z A;  2I7B A;  3CKJ A;  5AJN A;  1EZI A;  2FYB A;  1GWV A;  2AM4 A;  1YRO B;  3NGW A;  1PZT A;  2E8B A;  2VD4 A;  2X60 A;  4P02 A;  1VM8 A;  1QG8 A;  3IOH A;  2ZU7 A;  4AAW A;  3POL A;  1WT0 A;  4FRH A;  2O1G A;  4HO9 A;  1H5T B;  1LL0 A;  2YC5 A;  1JYK A;  2PX7 A;  5C3A A;  4ASJ A;  4G3S A;  2QGI A;  1NWG B;  4HO2 A;  2OEF A;  3IOI A;  3USQ A;  4KC4 A;  2WVK A;  1LZJ A;  3V0P A;  1H4D A;  1KWS A;  2XME A;  4Y62 A;  3V0O A;  1EYR A;  3SXC A;  2ICY A;  4AC3 A;  1ZDG A;  3I0K A;  4Y6U A;  3T7M A;  4KPZ A;  4G87 A;  1SS9 A;  3ZGG A;  1INI A;  1VIC A;  4G3P A;  3DK5 A;  3ZLK A;  5L6S A;  1YP4 A;  3D98 A;  2J0A A;  1HM9 A;  5FUH A;  5BXC A;  2D7R A;  1ZI3 A;  2AES A;  3I0D A;  2J0B A;  5C4D A;  4AYJ A;  2RJ0 A;  1WT2 A;  1HV9 A;  1IIM A;  1R80 A;  1S4O A;  1W77 A;  4BMA A;  1ZJO A;  1H5S B;  2OI5 A;  1HM8 A;  5C3B A;  3FWW A;  3OAM A;  1H7L A;  2DPW A;  3Q4S A;  5C4B A;  4FRD A;  1MP4 A;  3V0N A;  3SXE A;  5FTV A;  2O1H A;  1LZ0 A;  1R7Y A;  2VXL A;  2RIX A;  1H5S C;  3SXG A;  3V0M A;  4UEG A;  2VSH A;  4B42 A;  3OH2 A;  1TVY A;  1NHE B;  4Y6N A;  2C0N A;  4B4M A;  1FRW A;  2PGY A;  2RIT A;  1G0R A;  3V0Q A;  2VXM A;  1NKH B;  4AYL A;  3U2W A;  1VZX A;  1ZCT A;  1GX0 A;  4FIX A;  4EEM A;  5C4C A;  5FU0 A;  2RIZ A;  3U0X A;  2Q4J A;  1NQI B;  4M4K A;  4B2X A;  2BO6 A;  1H7H A;  2V0K A;  5C48 A;  2JCK A;  1S4P A;  2W0V A;  5C47 A;  4NAN A;  3FOQ A;  2JCJ A;  3EE5 A;  2FFU A;  3OC9 A;  4FRP A;  4Y63 A;  4DDZ A;  3RMV A;  3SXD A;  4CJC A;  1O7Q A;  2VS5 A;  3I0C A;  1G1L A;  1VH3 A;  4HO3 A;  5FU8 A;  4HO0 A;  1R7U A;  1OMZ A;  3U2T A;  1G3L A;  3U2U A;  4NAK A;  4KNX A;  1E5K A;  2RJ9 A;  2BO4 A;  2Y4L A;  5CMJ A;  3ZGF A;  5CQN X;  4KQL A;  2XWL A;  2GGO A;  5CQM X;  2WAW A;  2A8U A;  1GX4 A;  1H5S D;  3DUV A;  1LL2 A;  2Y4M A;  4HO6 A;  3RMW A;  1H7T A;  3SPT A;  4L41 C;  3I0E A;  3K8D A;  2QKX A;  4B4B A;  1ON6 A;  2PA4 A;  1WT1 A;  2P6W A;  5C4F A;  4FRE A;  3Q80 A;  5CMH A;  5D92 A;  1IIN A;  3R2W A;  1V82 A;  5DDT A;  4ASY A;  2YES A;  3I0I X;  5CMF X;  4EEA A;  1XZ6 A;  4MIX A;  3E26 A;  2GGQ A;  1W55 A;  2AM3 A;  1O0R A;  3JUK A;  2JCL A;  5EJ1 A;  1H5R A;  4IRP A;  1FZW A;  1FG5 N;  2I5E A;  3K8E A;  4Y7T A;  3D5N A;  5IDS A;  2NXV A;  4ZDQ A;  2X65 A;  1LL3 A;  4P00 A;  3QVB A;  2VS3 A;  3I0J A;  3BRK X;  2Z87 A;  4FRO A;  4K6R A;  2P73 A;  4B2W A;  1H7Q A;  1PZY B;  3T7N A;  1K4V A;  2YCM A;  3ZF8 A;  1WT3 A;  1ZCU A;  4Y7U A;  1HJL A;  4D11 A;  2RJ6 A;  1FXO A;  2AEC A;  4FRL A;  2CU2 A;  3HL3 A;  3OGZ A;  4FRQ A;  3SX7 A;  3D8V A;  3TQD A;  3KIA A;  3OH4 A;  2QH5 A;  1ZI5 A;  3BCV A;  1V83 A;  1YP3 A;  1H4E A;  1TZF A;  2VSI A;  1FGX A;  4FCE A;  1JYL A;  3TZT A;  2FYC B;  2AM5 A;  3GUE A;  4M2A A;  4R7P A;  3F1C A;  1G97 A;  1ZI4 A;  3E25 A;  4Y7G A;  5JQQ A;  3I0L A;  1QWJ A;  1G8O A;  4XWI A;  1ZCV A;  3PKP A;  1I52 A;  4GBP A;  1FO9 A;  2YQC A;  3CGX A;  5HS2 A;  5C1H A;  2YQS A;  3LW6 A;  4J18 A;  4FRB A;  4JD0 A;  5J49 A;  1GWW A;  1H7F A;  2D0J A;  4B5B A;  1H7G A;  1Z90 A;  3CKN A;  2V0I A;  3I0G A;  4EE3 A;  4BQH A;  5FTS A;  3V91 A;  1VGU A;  2ICX A;  1VPA A;  5FYE A;  1MP5 A;  1O23 B;  3I0H A;  4CJB A;  1LZ7 A;  1R81 A;  3ZLL A;  4EEO A;  2ZU8 A;  2I5K A;  3R3I A;  1LVW A;  2VS4 A;  4EVW A;  2OI7 A;  5C38 A;  2X5Z A;  4C2S A;  3OH3 A;  3F1Y A;  4D0T A;  4NAI A;  3U2V A;  1H3M A;  4KNR A;  1H4C A;  2RJ7 A;  1ZJ1 A;  3JUJ A;  4FQW A;  3PNN A;  2V0J A;  1FR9 A;  4G3Q A;  2A8W A;  3Q7U A;  2D7I A;  1FWY A;  4ARW A;  4O6N A;  3RSB A;  3V8Y A;  1H5T A;  2WGZ A;  1TW5 A;  1G23 A;  4NAL A;  3CKV A;  1ZJ3 A;  3PKQ A;  2YQH A;  1VH1 A;  5CQO A;  5CMG X;  4FIY A;  2Y6P A;  2OI6 A;  5I1F A;  1R7X A;  3SXB A;  2RJ8 A;  1WSZ A;  4HCQ A;  1GA8 A;  1HM0 A;  2AE7 A;  2XWN A;  4ECM A;  1ZJP A;  1MP3 A;  4KXO A;  4B4G A;  3ST8 A;  2Y4J A;  4HO4 A;  3V8Z A;  2VK9 A;  5AJP A;  4CVH A;  3IOJ A;  1INJ A;  1TW1 A;  1G93 A;  1H7E A;  2MZB A;  2BO8 A;  4DE7 A;  2W0W A;  3I0F A;  3OKR A;  5C1G A;  4Q7C A;  4JIS A;  3USR A;  5C4E A;  1ZI1 A;  3N9W A;  2BO7 A;  2WVL A;  1ON8 A;  3U0Y A;  2WVM A;  4FRA A;  1H5S A;  2ZU9 A;  4Y9X A;  2YQJ A;  5CQP A;  1QGQ A;  1JV1 A;  2RJ5 A;  4HOC A;  2P72 A;  1ZJ0 A;  3DJ4 A;  1G9R A;  4B3U A;  4M2B A;  5EJZ A;  1S4N A;  3O3P A;  4EEG A;  4E1K A;  1G95 A;  4KC1 A;  4EE5 A;  4O6M A;  5L6V A;  1VZU A;  1OMX A;  4Y7F A;  3SX5 A;  2AH9 A;  1XHB A;  4KPX A;  1ZJ2 A;  1G2V A;  1VGZ A;  2APC A;  2WEE A;  2PGV A;  4HO8 A;  1GQC A;  1H5R B;  5FV9 A;  5D91 A;  4KT7 A;  4MYB A;  3JTJ A;  2Y7A A;  1WVC A;  2XWM A;  1MC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...