3I0JA

Crystal structure of gtb c80s/c196s/c209s + h antigen
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
270
Chain Sequence
PQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGWQDVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 270
sequence length 274
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0jA00
1R7TA 4G3SA 4KRVA 1G2VA 1HV9A 4KQLA 1XHBA 5C49A 2FYAA 4FRHA 3RSBA 2W0WA 2XWNA 3V0NA 3T7NA 4DECA 2RIYA 2GGQA 1VGZA 4AYLA 5FTVA 1K4VA 1LZ7A 1ZI5A 4C2SA 4GBPA 5C1GA 3ZLKA 3SXBA 3K8DA 2YQHA 2AE7A 3EE5A 2OI6A 4MYBA 1IIMA 1FG5N 2PX7A 3CGXA 1VGTA 3I0DA 4K6RA 2AH9A 1G1LA 3POLA 5FYEA 4HO4A 4FRAA 4CJBA 1FXOA 4Y7GA 1SS9A 3IOHA 3OH0A 2APCA 3DK5A 1WT1A 3JTJA 2E8BA 4UEGA 2O1HA 5IFYA 1FRWA 4DDZA 5C3DA 4ASJA 3OGZA 4G3PA 3U2TA 1EYRA 4Y7UA 1VZUA 3ZGGA 2RJ7A 5DDVA 1R7UA 4YS8A 1WSZA 2YQCA 1VGUA 1H4DA 2RIZA 1TZFA 1H5RB 1HJLA 5IDTA 3V8ZA 1H7EA 3TQDA 3OH4A 3LW6A 2RJ4A 2AECA 4Y9XA 5C8RA 3O3PA 2E3DA 1S4OA 2VD4A 3QVBA 3D98A 4J18A 2Z87A 2WVLA 2WVKA 4B5BA 1GQCA 2Y4MA 2P72A 4D11A 3DUVA 1WT3A 5FU8A 1GWVA 1ZCVA 3PKPA 4Y7FA 1FOAA 2WAWA 4EEOA 1ZIZA 2YESA 5J49A 1JV1A 2CU2A 3NGWA 4FRBA 4M2AA 1NHEB 3V8YA 1JV3A 3KIAA 3IOJA 3I0EA 3BCVA 4KNRA 5L6VA 3BRKX 1MP4A 2ZU7A 1NMMB 4DE7A 1LL3A 2Z86A 5CQOA 3USQA 1H4CA 4Y62A 3F1CA 1O7QA 1G93A 5L6SA 4Y7TA 1VPAA 4HO2A 4IRPA 4EE4A 1VM8A 1ZCTA 3I0GA 1VZTA 2VS3A 4B4GA 5BXCA 1GQ9A 5CQNX 3CU0A 2I5KA 1I52A 2RJ6A 1H5RA 2V0LA 3SX8A 3V0LA 3N9WA 3V0MA 3D5NA 4B2XA 1V84A 3I0CA 4CVHA 2JCLA 5HS2A 1O7OA 2I5EA 4D48A 1H7HA 2X5SA 1V82A 5CMFX 3SX7A 1G95A 5AJNA 5FTSA 3Q7UA 1YP3A 4ZDQA 1LL0A 2BO8A 1VICA 2RJ1A 2V0KA 1G9RA 1JYKA 3U2VA 1NWGB 1H7GA 2VFZA 2JCJA 1INJA 3E25A 3D8VA 1R7VA 1YP4A 2VXLA 2BO7A 4B2WA 2D7IA 1VH1A 1MP5A 1LZ0A 4NALA 1ZJ2A 2VSIA 1W57A 4EE3A 4KPXA 2FYBA 4M4KA 4XWIA 1ZJ1A 4KT7A 1LZIA 5FU0A 1ZJ3A 1ZJPA 4HO6A 4Y6NA 1INIA 5C1LA 1VH3A 4HCQA 2XWMA 3FWWA 4Y63A 1GWWA 2MZBA 5EJ1A 1O0RA 2A8UA 1ZJ0A 3T7OA 1E5KA 2P6WA 2YQJA 4FRPA 5CQLX 4B4MA 1NKHB 2Y4KA 4FRLA 3GUEA 2OEGA 2WE9A 1ZI3A 5DDTA 4FRQA 4FCUA 3ST8A 1W77A 4EE5A 4HO9A 5C4EA 4KXOA 2YC5A 5FUHA 1EZIA 3CKOA 5I1FA 4D0ZA 5EIYA 2JCKA 1ON6A 4KNXA 5C4FA 4CJ8A 3OH3A 3V90A 1G97A 1IINA 1G3LA 2FFUA 4Y6UA 2VS4A 1H7LA 2QGIA 4FRMA 1FO8A 2Y7AA 5CMJA 4FROA 1O23B 3OC9A 1JVDA 3U0YA 4L41C 3CKJA 1FO9A 4LW3A 1H5SC 3R2WA 3CKQA 2RJ9A 5C36A 1MP3A 1ZDGA 5C47A 2FYCB 2VS5A 2ICYA 1R7XA 2FFVA 3V0PA 1FGXA 1HM9A 4Y64A 4FREA 3JUJA 4FRDA 1H7FA 2W0VA 1R7YA 1GX4A 1ZI4A 5AJOA 3Q4SA 2RJ0A 3CKNA 1WT2A 2Y4LA 1LL2A 5C3AA 1KWSA 4EEMA 1FR8A 1S4PA 2PA4A 2X65A 4G87A 4ASYA 2A8WA 3V91A 3OH2A 3SXCA 2PGYA 2ZU9A 1XZ6A 1TW5A 2DPWA 2PGVA 3I0HA 4KPZA 1HM0A 3U0XA 1WVCA 1QGQA 1NQIB 2UX8A 3PKQA 3SPTA 2RIXA 1MC3A 3CKVA 4R7PA 3RMVA 1HM8A 2X5ZA 3I0KA 2AM5A 4B42A 3E26A 3R3IA 2RITA 2O1GA 1FXJA 3SXAA 5C1HA 2D7RA 4LW6A 5C4CA 4EEGA 1H7QA 1S4NA 5EJZA 5CMHA 3I0JA 4EEAA 4Y7VA 1YROB 1ZCYA 3Q80A 4M28A 1ZHJA 1OMZA 3OAMA 5IDSA 1PZYB 2V0HA 5C4BA 4NAIA 1ZDFA 4NANA 4HOCA 4JD0A 1G8OA 4D0TA 2AESA 3SXGA 4HG6A 2Q4JA 3TZTA 5CQMX 4G3QA 3RMWA 1H5SB 1Z90A 4HO8A 2JCOA 2QKXA 5JQQA 3USRA 2Y6PA 4AC3A 3SXDA 5C3BA 5C48A 1VGWA 2BO4A 3SX5A 2XMHA 4JISA 4NAKA 4E1KA 3FOQA 3U2XA 1ZI1A 1ZJOA 3V0OA 4HO5A 1FWYA 3JUKA 5C4DA 2AM3A 1V83A 3U2UA 3K8EA 2QH5A 2AGDA 3SX3A 3U2WA 3I0LA 3T7MA 3I0IX 4FCEA 4FQWA 5CMIA 3OKRA 1H4EA 2OEFA 1H7TA 4BQHA 1H5TB 4HO3A 2OI7A 1OMXA 3I0FA 4M2BA 2ICXA 1WT0A 4KC1A 2V0JA 1R80A 2WGZA 2XMEA 4ARWA 5FV9A 3ZF8A 1NF5B 1YP2A 2BO6A 3F1YA 1PZTA 4D11C 1FZWA 2ZU8A 1LVWA 4AAWA 2VSHA 2WVMA 1FGGA 2NXVA 2XWLA 2OI5A 1H5SD 2AM4A 1H3MA 1JYLA 1QGSA 1W55A 1H5SA 5C38A 2V0IA 1GX0A 2WEEA 3PNNA 4ECMA 2YCMA 2P73A 3HL3A 3IOIA 1TVYA 1VZXA 1ON8A 4B3UA 3ZGFA 2Y4JA 1QWJA 1TW1A 4P00A 1R82A 1OQMB 3DJ4A 4P02A 1JVGA 4EVWA 5CMGX 2RJ5A 3SXEA 2VXMA 2I7BA 2O1FA 1QG8A 1GA8A 4AYJA 1G0RA 2D0JA 1G23A 2FY7A 2X60A 1R81A 5CQPA 2RJ8A 1ZCUA 4KC2A 1HJJA 5AJPA 4HO0A 1FR9A 4KC4A 4B4BA 4BMAA 4CJCA 2YC3A 2FYDB 3V0QA 2GGOA 2YQSA 1H5TA 3ZLLA 1LZJA 4MNDA 3OH1A 4IRQA
chains in the Genus database with same CATH superfamily
1R7TA 4G3SA 4KRVA 4O6MA 1G2VA 1HV9A 4KQLA 1XHBA 5C49A 2FYAA 4FRHA 3RSBA 2W0WA 2XWNA 3V0NA 3T7NA 4DECA 2RIYA 2GGQA 1VGZA 4AYLA 5FTVA 1K4VA 1LZ7A 1ZI5A 4C2SA 4GBPA 5C1GA 3ZLKA 3SXBA 3K8DA 2YQHA 2AE7A 3EE5A 2OI6A 4MYBA 1IIMA 1FG5N 2PX7A 3CGXA 1VGTA 3I0DA 4K6RA 2AH9A 1G1LA 3POLA 5FYEA 4HO4A 4FRAA 4CJBA 1FXOA 4Y7GA 1SS9A 3IOHA 3OH0A 2APCA 3DK5A 1WT1A 3JTJA 2E8BA 4UEGA 2O1HA 5IFYA 1FRWA 4DDZA 5C3DA 4ASJA 3OGZA 4G3PA 3U2TA 1EYRA 4Y7UA 1VZUA 3ZGGA 2RJ7A 5DDVA 1R7UA 4YS8A 1WSZA 2YQCA 1VGUA 1H4DA 2RIZA 1TZFA 1H5RB 1HJLA 5IDTA 3V8ZA 1H7EA 3TQDA 3OH4A 3LW6A 2RJ4A 2AECA 4Y9XA 5C8RA 3O3PA 2E3DA 1S4OA 2VD4A 3QVBA 3D98A 4J18A 2Z87A 2WVLA 2WVKA 4B5BA 1GQCA 2Y4MA 2P72A 4D11A 3DUVA 1WT3A 5FU8A 1GWVA 1ZCVA 3PKPA 4Y7FA 1FOAA 2WAWA 4EEOA 1ZIZA 2YESA 5J49A 1JV1A 2CU2A 3NGWA 4FRBA 4M2AA 1NHEB 3V8YA 1JV3A 3KIAA 3IOJA 3I0EA 3BCVA 4KNRA 5L6VA 3BRKX 1MP4A 2ZU7A 1NMMB 4DE7A 1LL3A 2Z86A 5CQOA 3USQA 1H4CA 4Y62A 3F1CA 1O7QA 1G93A 5L6SA 4Y7TA 1VPAA 4HO2A 4IRPA 4EE4A 1VM8A 1ZCTA 3I0GA 1VZTA 2VS3A 4B4GA 5BXCA 1GQ9A 5CQNX 3CU0A 2I5KA 1I52A 2RJ6A 1H5RA 2V0LA 3SX8A 3V0LA 3N9WA 3V0MA 3D5NA 4B2XA 1V84A 3I0CA 4CVHA 2JCLA 5HS2A 1O7OA 2I5EA 4D48A 1H7HA 2X5SA 4FIYA 1V82A 5CMFX 3SX7A 1G95A 5AJNA 5FTSA 3Q7UA 1YP3A 4ZDQA 1LL0A 2BO8A 1VICA 2RJ1A 2V0KA 1G9RA 1JYKA 3U2VA 1NWGB 1H7GA 2VFZA 2JCJA 1INJA 3E25A 3D8VA 1R7VA 1YP4A 2VXLA 2BO7A 4B2WA 2D7IA 1VH1A 1MP5A 1LZ0A 4NALA 1ZJ2A 2VSIA 1W57A 4EE3A 4KPXA 2FYBA 4M4KA 4XWIA 2J0AA 1ZJ1A 4KT7A 1LZIA 5FU0A 1ZJ3A 1ZJPA 4HO6A 5D92A 4Y6NA 1INIA 5C1LA 1VH3A 4HCQA 2XWMA 3FWWA 4Y63A 1GWWA 2MZBA 5EJ1A 1O0RA 2A8UA 1ZJ0A 3T7OA 1E5KA 2P6WA 2YQJA 4FRPA 5CQLX 4B4MA 1NKHB 2Y4KA 4FRLA 3GUEA 2OEGA 2WE9A 1ZI3A 5DDTA 4FRQA 4FCUA 3ST8A 1W77A 4EE5A 4HO9A 5C4EA 4KXOA 2YC5A 5FUHA 1EZIA 3CKOA 5I1FA 4D0ZA 5EIYA 2JCKA 1ON6A 4KNXA 5C4FA 4CJ8A 3OH3A 3V90A 1G97A 1IINA 1G3LA 2FFUA 4Y6UA 2VS4A 1H7LA 2QGIA 4FRMA 1FO8A 2Y7AA 5CMJA 4FROA 1O23B 3OC9A 1JVDA 3U0YA 4L41C 3CKJA 1FO9A 4LW3A 1H5SC 3R2WA 3CKQA 2RJ9A 5C36A 1MP3A 1ZDGA 5C47A 2FYCB 2VS5A 2ICYA 1R7XA 2FFVA 3V0PA 1FGXA 1HM9A 4Y64A 4FREA 3JUJA 4FRDA 1H7FA 2W0VA 1R7YA 1GX4A 1ZI4A 5AJOA 3Q4SA 2RJ0A 3CKNA 1WT2A 2Y4LA 1LL2A 5C3AA 1KWSA 4EEMA 1FR8A 2C0NA 1S4PA 2PA4A 2X65A 4G87A 4ASYA 2A8WA 3V91A 3OH2A 3SXCA 4O6NA 2PGYA 2ZU9A 1XZ6A 1TW5A 2DPWA 2PGVA 3I0HA 4KPZA 1HM0A 3U0XA 1WVCA 1QGQA 1NQIB 2UX8A 3PKQA 3SPTA 2RIXA 1MC3A 3CKVA 4R7PA 3RMVA 1HM8A 2X5ZA 3I0KA 2AM5A 4B42A 3E26A 3R3IA 2RITA 2O1GA 1FXJA 3SXAA 4Q7CA 5C1HA 2D7RA 4LW6A 5C4CA 4EEGA 1H7QA 1S4NA 5EJZA 5CMHA 3I0JA 4EEAA 4Y7VA 1YROB 1ZCYA 3Q80A 4M28A 1ZHJA 1OMZA 3OAMA 5IDSA 1PZYB 2V0HA 5C4BA 4NAIA 1ZDFA 4NANA 4HOCA 4JD0A 1G8OA 4D0TA 2AESA 3SXGA 4HG6A 2Q4JA 2J0BA 3TZTA 5CQMX 4G3QA 3RMWA 1H5SB 1Z90A 4HO8A 2JCOA 2QKXA 5JQQA 3USRA 2Y6PA 4AC3A 3SXDA 5C3BA 5C48A 1VGWA 2BO4A 3SX5A 2XMHA 4JISA 4NAKA 4E1KA 3FOQA 3U2XA 1ZI1A 1ZJOA 3V0OA 4HO5A 1FWYA 3JUKA 5C4DA 2AM3A 1V83A 3U2UA 3K8EA 2QH5A 2AGDA 3SX3A 3U2WA 3I0LA 5D91A 3I0IX 3T7MA 4FCEA 4FQWA 5CMIA 3OKRA 1H4EA 2OEFA 4FIXA 1H7TA 4BQHA 1H5TB 4HO3A 2OI7A 1OMXA 3I0FA 4M2BA 2ICXA 1WT0A 4KC1A 2V0JA 1R80A 2WGZA 2XMEA 4ARWA 5FV9A 3ZF8A 1NF5B 1YP2A 2BO6A 3F1YA 1PZTA 4D11C 1FZWA 2ZU8A 1LVWA 4AAWA 2VSHA 2WVMA 1FGGA 2NXVA 2XWLA 2OI5A 1H5SD 2AM4A 1H3MA 1JYLA 1QGSA 1W55A 1H5SA 5C38A 2V0IA 1GX0A 2WEEA 3PNNA 4ECMA 2YCMA 2P73A 3HL3A 3IOIA 1TVYA 1VZXA 1ON8A 4B3UA 3ZGFA 2Y4JA 1QWJA 1TW1A 4P00A 1R82A 1OQMB 3DJ4A 4P02A 1JVGA 4EVWA 5CMGX 2RJ5A 3SXEA 2VXMA 2I7BA 2O1FA 1QG8A 4MIXA 1GA8A 4AYJA 1G0RA 2D0JA 1G23A 2FY7A 2VK9A 2X60A 1R81A 5CQPA 2RJ8A 1ZCUA 4KC2A 1HJJA 5AJPA 4HO0A 1FR9A 4KC4A 4B4BA 4BMAA 4CJCA 2YC3A 2FYDB 3V0QA 2GGOA 2YQSA 1H5TA 3ZLLA 1LZJA 4MNDA 3OH1A 4IRQA
chains in the Genus database with same CATH topology
1R7TA 4G3SA 4KRVA 4O6MA 1G2VA 1HV9A 4KQLA 1XHBA 5C49A 2FYAA 4FRHA 3RSBA 2W0WA 2XWNA 3V0NA 3T7NA 4DECA 2RIYA 2GGQA 1VGZA 4AYLA 5FTVA 1K4VA 1LZ7A 1ZI5A 4C2SA 4GBPA 5C1GA 3ZLKA 3SXBA 3K8DA 2YQHA 2AE7A 3EE5A 2OI6A 4MYBA 1IIMA 1FG5N 2PX7A 3CGXA 1VGTA 3I0DA 4K6RA 2AH9A 1G1LA 3POLA 5FYEA 4HO4A 4FRAA 4CJBA 1FXOA 4Y7GA 1SS9A 3IOHA 3OH0A 2APCA 3DK5A 1WT1A 3JTJA 2E8BA 4UEGA 2O1HA 5IFYA 1FRWA 4DDZA 5C3DA 4ASJA 3OGZA 4G3PA 3U2TA 1EYRA 4Y7UA 1VZUA 3ZGGA 2RJ7A 5DDVA 1R7UA 4YS8A 1WSZA 2YQCA 1VGUA 1H4DA 2RIZA 1TZFA 1H5RB 1HJLA 5IDTA 3V8ZA 1H7EA 3TQDA 3OH4A 3LW6A 2RJ4A 2AECA 4Y9XA 5C8RA 3O3PA 2E3DA 1S4OA 2VD4A 3QVBA 3D98A 4J18A 2Z87A 2WVLA 2WVKA 4B5BA 1GQCA 2Y4MA 2P72A 4D11A 3DUVA 1WT3A 5FU8A 1GWVA 1ZCVA 3PKPA 4Y7FA 1FOAA 2WAWA 4EEOA 1ZIZA 2YESA 5J49A 1JV1A 2CU2A 3NGWA 4FRBA 4M2AA 1NHEB 3V8YA 1JV3A 3KIAA 3IOJA 3I0EA 3BCVA 4KNRA 5L6VA 3BRKX 1MP4A 2ZU7A 1NMMB 4DE7A 1LL3A 2Z86A 5CQOA 3USQA 1H4CA 4Y62A 3F1CA 1O7QA 1G93A 5L6SA 4Y7TA 1VPAA 4HO2A 4IRPA 4EE4A 1VM8A 1ZCTA 3I0GA 1VZTA 2VS3A 4B4GA 5BXCA 1GQ9A 5CQNX 3CU0A 2I5KA 1I52A 2RJ6A 1H5RA 2V0LA 3SX8A 3V0LA 3N9WA 3V0MA 3D5NA 4B2XA 1V84A 3I0CA 4CVHA 2JCLA 5HS2A 1O7OA 2I5EA 4D48A 1H7HA 2X5SA 4FIYA 1V82A 5CMFX 3SX7A 1G95A 5AJNA 5FTSA 3Q7UA 1YP3A 4ZDQA 1LL0A 2BO8A 1VICA 2RJ1A 2V0KA 1G9RA 1JYKA 3U2VA 1NWGB 1H7GA 2VFZA 2JCJA 1INJA 3E25A 3D8VA 1R7VA 1YP4A 2VXLA 2BO7A 4B2WA 2D7IA 1VH1A 1MP5A 1LZ0A 4NALA 1ZJ2A 2VSIA 1W57A 4EE3A 4KPXA 2FYBA 4M4KA 4XWIA 2J0AA 1ZJ1A 4KT7A 1LZIA 5FU0A 1ZJ3A 1ZJPA 4HO6A 5D92A 4Y6NA 1INIA 5C1LA 1VH3A 4HCQA 2XWMA 3FWWA 4Y63A 1GWWA 2MZBA 5EJ1A 1O0RA 2A8UA 1ZJ0A 3T7OA 1E5KA 2P6WA 2YQJA 4FRPA 5CQLX 4B4MA 1NKHB 2Y4KA 4FRLA 3GUEA 2OEGA 2WE9A 1ZI3A 5DDTA 4FRQA 4FCUA 3ST8A 1W77A 4EE5A 4HO9A 5C4EA 4KXOA 2YC5A 5FUHA 1EZIA 3CKOA 5I1FA 4D0ZA 5EIYA 2JCKA 1ON6A 4KNXA 5C4FA 4CJ8A 3OH3A 3V90A 1G97A 1IINA 1G3LA 2FFUA 4Y6UA 2VS4A 1H7LA 2QGIA 4FRMA 1FO8A 2Y7AA 5CMJA 4FROA 1O23B 3OC9A 1JVDA 3U0YA 4L41C 3CKJA 1FO9A 4LW3A 1H5SC 3R2WA 3CKQA 2RJ9A 5C36A 1MP3A 1ZDGA 5C47A 2FYCB 2VS5A 2ICYA 1R7XA 2FFVA 3V0PA 1FGXA 1HM9A 4Y64A 4FREA 3JUJA 4FRDA 1H7FA 2W0VA 1R7YA 1GX4A 1ZI4A 5AJOA 3Q4SA 2RJ0A 3CKNA 1WT2A 2Y4LA 1LL2A 5C3AA 1KWSA 4EEMA 1FR8A 2C0NA 1S4PA 2PA4A 2X65A 4G87A 4ASYA 2A8WA 3V91A 3OH2A 3SXCA 4O6NA 2PGYA 2ZU9A 1XZ6A 1TW5A 2DPWA 2PGVA 3I0HA 4KPZA 1HM0A 3U0XA 1WVCA 1QGQA 1NQIB 2UX8A 3PKQA 3SPTA 2RIXA 1MC3A 3CKVA 4R7PA 3RMVA 1HM8A 2X5ZA 3I0KA 2AM5A 4B42A 3E26A 3R3IA 2RITA 2O1GA 1FXJA 3SXAA 4Q7CA 5C1HA 2D7RA 4LW6A 5C4CA 4EEGA 1H7QA 1S4NA 5EJZA 5CMHA 3I0JA 4EEAA 4Y7VA 1YROB 1ZCYA 3Q80A 4M28A 1ZHJA 1OMZA 3OAMA 5IDSA 1PZYB 2V0HA 5C4BA 4NAIA 1ZDFA 4NANA 4HOCA 4JD0A 1G8OA 4D0TA 2AESA 3SXGA 4HG6A 2Q4JA 2J0BA 3TZTA 5CQMX 4G3QA 3RMWA 1H5SB 1Z90A 4HO8A 2JCOA 2QKXA 5JQQA 3USRA 2Y6PA 4AC3A 3SXDA 5C3BA 5C48A 1VGWA 2BO4A 3SX5A 2XMHA 4JISA 4NAKA 4E1KA 3FOQA 3U2XA 1ZI1A 1ZJOA 3V0OA 4HO5A 1FWYA 3JUKA 5C4DA 2AM3A 1V83A 3U2UA 3K8EA 2QH5A 2AGDA 3SX3A 3U2WA 3I0LA 5D91A 3I0IX 3T7MA 4FCEA 4FQWA 5CMIA 3OKRA 1H4EA 2OEFA 4FIXA 1H7TA 4BQHA 1H5TB 4HO3A 2OI7A 1OMXA 3I0FA 4M2BA 2ICXA 1WT0A 4KC1A 2V0JA 1R80A 2WGZA 2XMEA 4ARWA 5FV9A 3ZF8A 1NF5B 1YP2A 2BO6A 3F1YA 1PZTA 4D11C 1FZWA 2ZU8A 1LVWA 4AAWA 2VSHA 2WVMA 1FGGA 2NXVA 2XWLA 2OI5A 1H5SD 2AM4A 1H3MA 1JYLA 1QGSA 1W55A 1H5SA 5C38A 2V0IA 1GX0A 2WEEA 3PNNA 4ECMA 2YCMA 2P73A 3HL3A 3IOIA 1TVYA 1VZXA 1ON8A 4B3UA 3ZGFA 2Y4JA 1QWJA 1TW1A 4P00A 1R82A 1OQMB 3DJ4A 4P02A 1JVGA 4EVWA 5CMGX 2RJ5A 3SXEA 2VXMA 2I7BA 2O1FA 1QG8A 4MIXA 1GA8A 4AYJA 1G0RA 2D0JA 1G23A 2FY7A 2VK9A 2X60A 1R81A 5CQPA 2RJ8A 1ZCUA 4KC2A 1HJJA 5AJPA 4HO0A 1FR9A 4KC4A 4B4BA 4BMAA 4CJCA 2YC3A 2FYDB 3V0QA 2GGOA 2YQSA 1H5TA 3ZLLA 1LZJA 4MNDA 3OH1A 4IRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7T A;  4G3S A;  4KRV A;  1G2V A;  1HV9 A;  4KQL A;  1XHB A;  5C49 A;  2FYA A;  4FRH A;  3RSB A;  2W0W A;  2XWN A;  3V0N A;  3T7N A;  4DEC A;  2RIY A;  2GGQ A;  1VGZ A;  4AYL A;  5FTV A;  1K4V A;  1LZ7 A;  1ZI5 A;  4C2S A;  4GBP A;  5C1G A;  3ZLK A;  3SXB A;  3K8D A;  2YQH A;  2AE7 A;  3EE5 A;  2OI6 A;  4MYB A;  1IIM A;  1FG5 N;  2PX7 A;  3CGX A;  1VGT A;  3I0D A;  4K6R A;  2AH9 A;  1G1L A;  3POL A;  5FYE A;  4HO4 A;  4FRA A;  4CJB A;  1FXO A;  4Y7G A;  1SS9 A;  3IOH A;  3OH0 A;  2APC A;  3DK5 A;  1WT1 A;  3JTJ A;  2E8B A;  4UEG A;  2O1H A;  5IFY A;  1FRW A;  4DDZ A;  5C3D A;  4ASJ A;  3OGZ A;  4G3P A;  3U2T A;  1EYR A;  4Y7U A;  1VZU A;  3ZGG A;  2RJ7 A;  5DDV A;  1R7U A;  4YS8 A;  1WSZ A;  2YQC A;  1VGU A;  1H4D A;  2RIZ A;  1TZF A;  1H5R B;  1HJL A;  5IDT A;  3V8Z A;  1H7E A;  3TQD A;  3OH4 A;  3LW6 A;  2RJ4 A;  2AEC A;  4Y9X A;  5C8R A;  3O3P A;  2E3D A;  1S4O A;  2VD4 A;  3QVB A;  3D98 A;  4J18 A;  2Z87 A;  2WVL A;  2WVK A;  4B5B A;  1GQC A;  2Y4M A;  2P72 A;  4D11 A;  3DUV A;  1WT3 A;  5FU8 A;  1GWV A;  1ZCV A;  3PKP A;  4Y7F A;  1FOA A;  2WAW A;  4EEO A;  1ZIZ A;  2YES A;  5J49 A;  1JV1 A;  2CU2 A;  3NGW A;  4FRB A;  4M2A A;  1NHE B;  3V8Y A;  1JV3 A;  3KIA A;  3IOJ A;  3I0E A;  3BCV A;  4KNR A;  5L6V A;  3BRK X;  1MP4 A;  2ZU7 A;  1NMM B;  4DE7 A;  1LL3 A;  2Z86 A;  5CQO A;  3USQ A;  1H4C A;  4Y62 A;  3F1C A;  1O7Q A;  1G93 A;  5L6S A;  4Y7T A;  1VPA A;  4HO2 A;  4IRP A;  4EE4 A;  1VM8 A;  1ZCT A;  3I0G A;  1VZT A;  2VS3 A;  4B4G A;  5BXC A;  1GQ9 A;  5CQN X;  3CU0 A;  2I5K A;  1I52 A;  2RJ6 A;  1H5R A;  2V0L A;  3SX8 A;  3V0L A;  3N9W A;  3V0M A;  3D5N A;  4B2X A;  1V84 A;  3I0C A;  4CVH A;  2JCL A;  5HS2 A;  1O7O A;  2I5E A;  4D48 A;  1H7H A;  2X5S A;  1V82 A;  5CMF X;  3SX7 A;  1G95 A;  5AJN A;  5FTS A;  3Q7U A;  1YP3 A;  4ZDQ A;  1LL0 A;  2BO8 A;  1VIC A;  2RJ1 A;  2V0K A;  1G9R A;  1JYK A;  3U2V A;  1NWG B;  1H7G A;  2VFZ A;  2JCJ A;  1INJ A;  3E25 A;  3D8V A;  1R7V A;  1YP4 A;  2VXL A;  2BO7 A;  4B2W A;  2D7I A;  1VH1 A;  1MP5 A;  1LZ0 A;  4NAL A;  1ZJ2 A;  2VSI A;  1W57 A;  4EE3 A;  4KPX A;  2FYB A;  4M4K A;  4XWI A;  1ZJ1 A;  4KT7 A;  1LZI A;  5FU0 A;  1ZJ3 A;  1ZJP A;  4HO6 A;  4Y6N A;  1INI A;  5C1L A;  1VH3 A;  4HCQ A;  2XWM A;  3FWW A;  4Y63 A;  1GWW A;  2MZB A;  5EJ1 A;  1O0R A;  2A8U A;  1ZJ0 A;  3T7O A;  1E5K A;  2P6W A;  2YQJ A;  4FRP A;  5CQL X;  4B4M A;  1NKH B;  2Y4K A;  4FRL A;  3GUE A;  2OEG A;  2WE9 A;  1ZI3 A;  5DDT A;  4FRQ A;  4FCU A;  3ST8 A;  1W77 A;  4EE5 A;  4HO9 A;  5C4E A;  4KXO A;  2YC5 A;  5FUH A;  1EZI A;  3CKO A;  5I1F A;  4D0Z A;  5EIY A;  2JCK A;  1ON6 A;  4KNX A;  5C4F A;  4CJ8 A;  3OH3 A;  3V90 A;  1G97 A;  1IIN A;  1G3L A;  2FFU A;  4Y6U A;  2VS4 A;  1H7L A;  2QGI A;  4FRM A;  1FO8 A;  2Y7A A;  5CMJ A;  4FRO A;  1O23 B;  3OC9 A;  1JVD A;  3U0Y A;  4L41 C;  3CKJ A;  1FO9 A;  4LW3 A;  1H5S C;  3R2W A;  3CKQ A;  2RJ9 A;  5C36 A;  1MP3 A;  1ZDG A;  5C47 A;  2FYC B;  2VS5 A;  2ICY A;  1R7X A;  2FFV A;  3V0P A;  1FGX A;  1HM9 A;  4Y64 A;  4FRE A;  3JUJ A;  4FRD A;  1H7F A;  2W0V A;  1R7Y A;  1GX4 A;  1ZI4 A;  5AJO A;  3Q4S A;  2RJ0 A;  3CKN A;  1WT2 A;  2Y4L A;  1LL2 A;  5C3A A;  1KWS A;  4EEM A;  1FR8 A;  1S4P A;  2PA4 A;  2X65 A;  4G87 A;  4ASY A;  2A8W A;  3V91 A;  3OH2 A;  3SXC A;  2PGY A;  2ZU9 A;  1XZ6 A;  1TW5 A;  2DPW A;  2PGV A;  3I0H A;  4KPZ A;  1HM0 A;  3U0X A;  1WVC A;  1QGQ A;  1NQI B;  2UX8 A;  3PKQ A;  3SPT A;  2RIX A;  1MC3 A;  3CKV A;  4R7P A;  3RMV A;  1HM8 A;  2X5Z A;  3I0K A;  2AM5 A;  4B42 A;  3E26 A;  3R3I A;  2RIT A;  2O1G A;  1FXJ A;  3SXA A;  5C1H A;  2D7R A;  4LW6 A;  5C4C A;  4EEG A;  1H7Q A;  1S4N A;  5EJZ A;  5CMH A;  3I0J A;  4EEA A;  4Y7V A;  1YRO B;  1ZCY A;  3Q80 A;  4M28 A;  1ZHJ A;  1OMZ A;  3OAM A;  5IDS A;  1PZY B;  2V0H A;  5C4B A;  4NAI A;  1ZDF A;  4NAN A;  4HOC A;  4JD0 A;  1G8O A;  4D0T A;  2AES A;  3SXG A;  4HG6 A;  2Q4J A;  3TZT A;  5CQM X;  4G3Q A;  3RMW A;  1H5S B;  1Z90 A;  4HO8 A;  2JCO A;  2QKX A;  5JQQ A;  3USR A;  2Y6P A;  4AC3 A;  3SXD A;  5C3B A;  5C48 A;  1VGW A;  2BO4 A;  3SX5 A;  2XMH A;  4JIS A;  4NAK A;  4E1K A;  3FOQ A;  3U2X A;  1ZI1 A;  1ZJO A;  3V0O A;  4HO5 A;  1FWY A;  3JUK A;  5C4D A;  2AM3 A;  1V83 A;  3U2U A;  3K8E A;  2QH5 A;  2AGD A;  3SX3 A;  3U2W A;  3I0L A;  3T7M A;  3I0I X;  4FCE A;  4FQW A;  5CMI A;  3OKR A;  1H4E A;  2OEF A;  1H7T A;  4BQH A;  1H5T B;  4HO3 A;  2OI7 A;  1OMX A;  3I0F A;  4M2B A;  2ICX A;  1WT0 A;  4KC1 A;  2V0J A;  1R80 A;  2WGZ A;  2XME A;  4ARW A;  5FV9 A;  3ZF8 A;  1NF5 B;  1YP2 A;  2BO6 A;  3F1Y A;  1PZT A;  4D11 C;  1FZW A;  2ZU8 A;  1LVW A;  4AAW A;  2VSH A;  2WVM A;  1FGG A;  2NXV A;  2XWL A;  2OI5 A;  1H5S D;  2AM4 A;  1H3M A;  1JYL A;  1QGS A;  1W55 A;  1H5S A;  5C38 A;  2V0I A;  1GX0 A;  2WEE A;  3PNN A;  4ECM A;  2YCM A;  2P73 A;  3HL3 A;  3IOI A;  1TVY A;  1VZX A;  1ON8 A;  4B3U A;  3ZGF A;  2Y4J A;  1QWJ A;  1TW1 A;  4P00 A;  1R82 A;  1OQM B;  3DJ4 A;  4P02 A;  1JVG A;  4EVW A;  5CMG X;  2RJ5 A;  3SXE A;  2VXM A;  2I7B A;  2O1F A;  1QG8 A;  1GA8 A;  4AYJ A;  1G0R A;  2D0J A;  1G23 A;  2FY7 A;  2X60 A;  1R81 A;  5CQP A;  2RJ8 A;  1ZCU A;  4KC2 A;  1HJJ A;  5AJP A;  4HO0 A;  1FR9 A;  4KC4 A;  4B4B A;  4BMA A;  4CJC A;  2YC3 A;  2FYD B;  3V0Q A;  2GGO A;  2YQS A;  1H5T A;  3ZLL A;  1LZJ A;  4MND A;  3OH1 A;  4IRQ A; 
#chains in the Genus database with same CATH topology
 1R7T A;  4G3S A;  4KRV A;  4O6M A;  1G2V A;  1HV9 A;  4KQL A;  1XHB A;  5C49 A;  2FYA A;  4FRH A;  3RSB A;  2W0W A;  2XWN A;  3V0N A;  3T7N A;  4DEC A;  2RIY A;  2GGQ A;  1VGZ A;  4AYL A;  5FTV A;  1K4V A;  1LZ7 A;  1ZI5 A;  4C2S A;  4GBP A;  5C1G A;  3ZLK A;  3SXB A;  3K8D A;  2YQH A;  2AE7 A;  3EE5 A;  2OI6 A;  4MYB A;  1IIM A;  1FG5 N;  2PX7 A;  3CGX A;  1VGT A;  3I0D A;  4K6R A;  2AH9 A;  1G1L A;  3POL A;  5FYE A;  4HO4 A;  4FRA A;  4CJB A;  1FXO A;  4Y7G A;  1SS9 A;  3IOH A;  3OH0 A;  2APC A;  3DK5 A;  1WT1 A;  3JTJ A;  2E8B A;  4UEG A;  2O1H A;  5IFY A;  1FRW A;  4DDZ A;  5C3D A;  4ASJ A;  3OGZ A;  4G3P A;  3U2T A;  1EYR A;  4Y7U A;  1VZU A;  3ZGG A;  2RJ7 A;  5DDV A;  1R7U A;  4YS8 A;  1WSZ A;  2YQC A;  1VGU A;  1H4D A;  2RIZ A;  1TZF A;  1H5R B;  1HJL A;  5IDT A;  3V8Z A;  1H7E A;  3TQD A;  3OH4 A;  3LW6 A;  2RJ4 A;  2AEC A;  4Y9X A;  5C8R A;  3O3P A;  2E3D A;  1S4O A;  2VD4 A;  3QVB A;  3D98 A;  4J18 A;  2Z87 A;  2WVL A;  2WVK A;  4B5B A;  1GQC A;  2Y4M A;  2P72 A;  4D11 A;  3DUV A;  1WT3 A;  5FU8 A;  1GWV A;  1ZCV A;  3PKP A;  4Y7F A;  1FOA A;  2WAW A;  4EEO A;  1ZIZ A;  2YES A;  5J49 A;  1JV1 A;  2CU2 A;  3NGW A;  4FRB A;  4M2A A;  1NHE B;  3V8Y A;  1JV3 A;  3KIA A;  3IOJ A;  3I0E A;  3BCV A;  4KNR A;  5L6V A;  3BRK X;  1MP4 A;  2ZU7 A;  1NMM B;  4DE7 A;  1LL3 A;  2Z86 A;  5CQO A;  3USQ A;  1H4C A;  4Y62 A;  3F1C A;  1O7Q A;  1G93 A;  5L6S A;  4Y7T A;  1VPA A;  4HO2 A;  4IRP A;  4EE4 A;  1VM8 A;  1ZCT A;  3I0G A;  1VZT A;  2VS3 A;  4B4G A;  5BXC A;  1GQ9 A;  5CQN X;  3CU0 A;  2I5K A;  1I52 A;  2RJ6 A;  1H5R A;  2V0L A;  3SX8 A;  3V0L A;  3N9W A;  3V0M A;  3D5N A;  4B2X A;  1V84 A;  3I0C A;  4CVH A;  2JCL A;  5HS2 A;  1O7O A;  2I5E A;  4D48 A;  1H7H A;  2X5S A;  4FIY A;  1V82 A;  5CMF X;  3SX7 A;  1G95 A;  5AJN A;  5FTS A;  3Q7U A;  1YP3 A;  4ZDQ A;  1LL0 A;  2BO8 A;  1VIC A;  2RJ1 A;  2V0K A;  1G9R A;  1JYK A;  3U2V A;  1NWG B;  1H7G A;  2VFZ A;  2JCJ A;  1INJ A;  3E25 A;  3D8V A;  1R7V A;  1YP4 A;  2VXL A;  2BO7 A;  4B2W A;  2D7I A;  1VH1 A;  1MP5 A;  1LZ0 A;  4NAL A;  1ZJ2 A;  2VSI A;  1W57 A;  4EE3 A;  4KPX A;  2FYB A;  4M4K A;  4XWI A;  2J0A A;  1ZJ1 A;  4KT7 A;  1LZI A;  5FU0 A;  1ZJ3 A;  1ZJP A;  4HO6 A;  5D92 A;  4Y6N A;  1INI A;  5C1L A;  1VH3 A;  4HCQ A;  2XWM A;  3FWW A;  4Y63 A;  1GWW A;  2MZB A;  5EJ1 A;  1O0R A;  2A8U A;  1ZJ0 A;  3T7O A;  1E5K A;  2P6W A;  2YQJ A;  4FRP A;  5CQL X;  4B4M A;  1NKH B;  2Y4K A;  4FRL A;  3GUE A;  2OEG A;  2WE9 A;  1ZI3 A;  5DDT A;  4FRQ A;  4FCU A;  3ST8 A;  1W77 A;  4EE5 A;  4HO9 A;  5C4E A;  4KXO A;  2YC5 A;  5FUH A;  1EZI A;  3CKO A;  5I1F A;  4D0Z A;  5EIY A;  2JCK A;  1ON6 A;  4KNX A;  5C4F A;  4CJ8 A;  3OH3 A;  3V90 A;  1G97 A;  1IIN A;  1G3L A;  2FFU A;  4Y6U A;  2VS4 A;  1H7L A;  2QGI A;  4FRM A;  1FO8 A;  2Y7A A;  5CMJ A;  4FRO A;  1O23 B;  3OC9 A;  1JVD A;  3U0Y A;  4L41 C;  3CKJ A;  1FO9 A;  4LW3 A;  1H5S C;  3R2W A;  3CKQ A;  2RJ9 A;  5C36 A;  1MP3 A;  1ZDG A;  5C47 A;  2FYC B;  2VS5 A;  2ICY A;  1R7X A;  2FFV A;  3V0P A;  1FGX A;  1HM9 A;  4Y64 A;  4FRE A;  3JUJ A;  4FRD A;  1H7F A;  2W0V A;  1R7Y A;  1GX4 A;  1ZI4 A;  5AJO A;  3Q4S A;  2RJ0 A;  3CKN A;  1WT2 A;  2Y4L A;  1LL2 A;  5C3A A;  1KWS A;  4EEM A;  1FR8 A;  2C0N A;  1S4P A;  2PA4 A;  2X65 A;  4G87 A;  4ASY A;  2A8W A;  3V91 A;  3OH2 A;  3SXC A;  4O6N A;  2PGY A;  2ZU9 A;  1XZ6 A;  1TW5 A;  2DPW A;  2PGV A;  3I0H A;  4KPZ A;  1HM0 A;  3U0X A;  1WVC A;  1QGQ A;  1NQI B;  2UX8 A;  3PKQ A;  3SPT A;  2RIX A;  1MC3 A;  3CKV A;  4R7P A;  3RMV A;  1HM8 A;  2X5Z A;  3I0K A;  2AM5 A;  4B42 A;  3E26 A;  3R3I A;  2RIT A;  2O1G A;  1FXJ A;  3SXA A;  4Q7C A;  5C1H A;  2D7R A;  4LW6 A;  5C4C A;  4EEG A;  1H7Q A;  1S4N A;  5EJZ A;  5CMH A;  3I0J A;  4EEA A;  4Y7V A;  1YRO B;  1ZCY A;  3Q80 A;  4M28 A;  1ZHJ A;  1OMZ A;  3OAM A;  5IDS A;  1PZY B;  2V0H A;  5C4B A;  4NAI A;  1ZDF A;  4NAN A;  4HOC A;  4JD0 A;  1G8O A;  4D0T A;  2AES A;  3SXG A;  4HG6 A;  2Q4J A;  2J0B A;  3TZT A;  5CQM X;  4G3Q A;  3RMW A;  1H5S B;  1Z90 A;  4HO8 A;  2JCO A;  2QKX A;  5JQQ A;  3USR A;  2Y6P A;  4AC3 A;  3SXD A;  5C3B A;  5C48 A;  1VGW A;  2BO4 A;  3SX5 A;  2XMH A;  4JIS A;  4NAK A;  4E1K A;  3FOQ A;  3U2X A;  1ZI1 A;  1ZJO A;  3V0O A;  4HO5 A;  1FWY A;  3JUK A;  5C4D A;  2AM3 A;  1V83 A;  3U2U A;  3K8E A;  2QH5 A;  2AGD A;  3SX3 A;  3U2W A;  3I0L A;  5D91 A;  3I0I X;  3T7M A;  4FCE A;  4FQW A;  5CMI A;  3OKR A;  1H4E A;  2OEF A;  4FIX A;  1H7T A;  4BQH A;  1H5T B;  4HO3 A;  2OI7 A;  1OMX A;  3I0F A;  4M2B A;  2ICX A;  1WT0 A;  4KC1 A;  2V0J A;  1R80 A;  2WGZ A;  2XME A;  4ARW A;  5FV9 A;  3ZF8 A;  1NF5 B;  1YP2 A;  2BO6 A;  3F1Y A;  1PZT A;  4D11 C;  1FZW A;  2ZU8 A;  1LVW A;  4AAW A;  2VSH A;  2WVM A;  1FGG A;  2NXV A;  2XWL A;  2OI5 A;  1H5S D;  2AM4 A;  1H3M A;  1JYL A;  1QGS A;  1W55 A;  1H5S A;  5C38 A;  2V0I A;  1GX0 A;  2WEE A;  3PNN A;  4ECM A;  2YCM A;  2P73 A;  3HL3 A;  3IOI A;  1TVY A;  1VZX A;  1ON8 A;  4B3U A;  3ZGF A;  2Y4J A;  1QWJ A;  1TW1 A;  4P00 A;  1R82 A;  1OQM B;  3DJ4 A;  4P02 A;  1JVG A;  4EVW A;  5CMG X;  2RJ5 A;  3SXE A;  2VXM A;  2I7B A;  2O1F A;  1QG8 A;  4MIX A;  1GA8 A;  4AYJ A;  1G0R A;  2D0J A;  1G23 A;  2FY7 A;  2VK9 A;  2X60 A;  1R81 A;  5CQP A;  2RJ8 A;  1ZCU A;  4KC2 A;  1HJJ A;  5AJP A;  4HO0 A;  1FR9 A;  4KC4 A;  4B4B A;  4BMA A;  4CJC A;  2YC3 A;  2FYD B;  3V0Q A;  2GGO A;  2YQS A;  1H5T A;  3ZLL A;  1LZJ A;  4MND A;  3OH1 A;  4IRQ A; 
#chains in the Genus database with same CATH homology
 1R7T A;  4G3S A;  4KRV A;  4O6M A;  1G2V A;  1HV9 A;  4KQL A;  1XHB A;  5C49 A;  2FYA A;  4FRH A;  3RSB A;  2W0W A;  2XWN A;  3V0N A;  3T7N A;  4DEC A;  2RIY A;  2GGQ A;  1VGZ A;  4AYL A;  5FTV A;  1K4V A;  1LZ7 A;  1ZI5 A;  4C2S A;  4GBP A;  5C1G A;  3ZLK A;  3SXB A;  3K8D A;  2YQH A;  2AE7 A;  3EE5 A;  2OI6 A;  4MYB A;  1IIM A;  1FG5 N;  2PX7 A;  3CGX A;  1VGT A;  3I0D A;  4K6R A;  2AH9 A;  1G1L A;  3POL A;  5FYE A;  4HO4 A;  4FRA A;  4CJB A;  1FXO A;  4Y7G A;  1SS9 A;  3IOH A;  3OH0 A;  2APC A;  3DK5 A;  1WT1 A;  3JTJ A;  2E8B A;  4UEG A;  2O1H A;  5IFY A;  1FRW A;  4DDZ A;  5C3D A;  4ASJ A;  3OGZ A;  4G3P A;  3U2T A;  1EYR A;  4Y7U A;  1VZU A;  3ZGG A;  2RJ7 A;  5DDV A;  1R7U A;  4YS8 A;  1WSZ A;  2YQC A;  1VGU A;  1H4D A;  2RIZ A;  1TZF A;  1H5R B;  1HJL A;  5IDT A;  3V8Z A;  1H7E A;  3TQD A;  3OH4 A;  3LW6 A;  2RJ4 A;  2AEC A;  4Y9X A;  5C8R A;  3O3P A;  2E3D A;  1S4O A;  2VD4 A;  3QVB A;  3D98 A;  4J18 A;  2Z87 A;  2WVL A;  2WVK A;  4B5B A;  1GQC A;  2Y4M A;  2P72 A;  4D11 A;  3DUV A;  1WT3 A;  5FU8 A;  1GWV A;  1ZCV A;  3PKP A;  4Y7F A;  1FOA A;  2WAW A;  4EEO A;  1ZIZ A;  2YES A;  5J49 A;  1JV1 A;  2CU2 A;  3NGW A;  4FRB A;  4M2A A;  1NHE B;  3V8Y A;  1JV3 A;  3KIA A;  3IOJ A;  3I0E A;  3BCV A;  4KNR A;  5L6V A;  3BRK X;  1MP4 A;  2ZU7 A;  1NMM B;  4DE7 A;  1LL3 A;  2Z86 A;  5CQO A;  3USQ A;  1H4C A;  4Y62 A;  3F1C A;  1O7Q A;  1G93 A;  5L6S A;  4Y7T A;  1VPA A;  4HO2 A;  4IRP A;  4EE4 A;  1VM8 A;  1ZCT A;  3I0G A;  1VZT A;  2VS3 A;  4B4G A;  5BXC A;  1GQ9 A;  5CQN X;  3CU0 A;  2I5K A;  1I52 A;  2RJ6 A;  1H5R A;  2V0L A;  3SX8 A;  3V0L A;  3N9W A;  3V0M A;  3D5N A;  4B2X A;  1V84 A;  3I0C A;  4CVH A;  2JCL A;  5HS2 A;  1O7O A;  2I5E A;  4D48 A;  1H7H A;  2X5S A;  4FIY A;  1V82 A;  5CMF X;  3SX7 A;  1G95 A;  5AJN A;  5FTS A;  3Q7U A;  1YP3 A;  4ZDQ A;  1LL0 A;  2BO8 A;  1VIC A;  2RJ1 A;  2V0K A;  1G9R A;  1JYK A;  3U2V A;  1NWG B;  1H7G A;  2VFZ A;  2JCJ A;  1INJ A;  3E25 A;  3D8V A;  1R7V A;  1YP4 A;  2VXL A;  2BO7 A;  4B2W A;  2D7I A;  1VH1 A;  1MP5 A;  1LZ0 A;  4NAL A;  1ZJ2 A;  2VSI A;  1W57 A;  4EE3 A;  4KPX A;  2FYB A;  4M4K A;  4XWI A;  2J0A A;  1ZJ1 A;  4KT7 A;  1LZI A;  5FU0 A;  1ZJ3 A;  1ZJP A;  4HO6 A;  5D92 A;  4Y6N A;  1INI A;  5C1L A;  1VH3 A;  4HCQ A;  2XWM A;  3FWW A;  4Y63 A;  1GWW A;  2MZB A;  5EJ1 A;  1O0R A;  2A8U A;  1ZJ0 A;  3T7O A;  1E5K A;  2P6W A;  2YQJ A;  4FRP A;  5CQL X;  4B4M A;  1NKH B;  2Y4K A;  4FRL A;  3GUE A;  2OEG A;  2WE9 A;  1ZI3 A;  5DDT A;  4FRQ A;  4FCU A;  3ST8 A;  1W77 A;  4EE5 A;  4HO9 A;  5C4E A;  4KXO A;  2YC5 A;  5FUH A;  1EZI A;  3CKO A;  5I1F A;  4D0Z A;  5EIY A;  2JCK A;  1ON6 A;  4KNX A;  5C4F A;  4CJ8 A;  3OH3 A;  3V90 A;  1G97 A;  1IIN A;  1G3L A;  2FFU A;  4Y6U A;  2VS4 A;  1H7L A;  2QGI A;  4FRM A;  1FO8 A;  2Y7A A;  5CMJ A;  4FRO A;  1O23 B;  3OC9 A;  1JVD A;  3U0Y A;  4L41 C;  3CKJ A;  1FO9 A;  4LW3 A;  1H5S C;  3R2W A;  3CKQ A;  2RJ9 A;  5C36 A;  1MP3 A;  1ZDG A;  5C47 A;  2FYC B;  2VS5 A;  2ICY A;  1R7X A;  2FFV A;  3V0P A;  1FGX A;  1HM9 A;  4Y64 A;  4FRE A;  3JUJ A;  4FRD A;  1H7F A;  2W0V A;  1R7Y A;  1GX4 A;  1ZI4 A;  5AJO A;  3Q4S A;  2RJ0 A;  3CKN A;  1WT2 A;  2Y4L A;  1LL2 A;  5C3A A;  1KWS A;  4EEM A;  1FR8 A;  2C0N A;  1S4P A;  2PA4 A;  2X65 A;  4G87 A;  4ASY A;  2A8W A;  3V91 A;  3OH2 A;  3SXC A;  4O6N A;  2PGY A;  2ZU9 A;  1XZ6 A;  1TW5 A;  2DPW A;  2PGV A;  3I0H A;  4KPZ A;  1HM0 A;  3U0X A;  1WVC A;  1QGQ A;  1NQI B;  2UX8 A;  3PKQ A;  3SPT A;  2RIX A;  1MC3 A;  3CKV A;  4R7P A;  3RMV A;  1HM8 A;  2X5Z A;  3I0K A;  2AM5 A;  4B42 A;  3E26 A;  3R3I A;  2RIT A;  2O1G A;  1FXJ A;  3SXA A;  4Q7C A;  5C1H A;  2D7R A;  4LW6 A;  5C4C A;  4EEG A;  1H7Q A;  1S4N A;  5EJZ A;  5CMH A;  3I0J A;  4EEA A;  4Y7V A;  1YRO B;  1ZCY A;  3Q80 A;  4M28 A;  1ZHJ A;  1OMZ A;  3OAM A;  5IDS A;  1PZY B;  2V0H A;  5C4B A;  4NAI A;  1ZDF A;  4NAN A;  4HOC A;  4JD0 A;  1G8O A;  4D0T A;  2AES A;  3SXG A;  4HG6 A;  2Q4J A;  2J0B A;  3TZT A;  5CQM X;  4G3Q A;  3RMW A;  1H5S B;  1Z90 A;  4HO8 A;  2JCO A;  2QKX A;  5JQQ A;  3USR A;  2Y6P A;  4AC3 A;  3SXD A;  5C3B A;  5C48 A;  1VGW A;  2BO4 A;  3SX5 A;  2XMH A;  4JIS A;  4NAK A;  4E1K A;  3FOQ A;  3U2X A;  1ZI1 A;  1ZJO A;  3V0O A;  4HO5 A;  1FWY A;  3JUK A;  5C4D A;  2AM3 A;  1V83 A;  3U2U A;  3K8E A;  2QH5 A;  2AGD A;  3SX3 A;  3U2W A;  3I0L A;  5D91 A;  3I0I X;  3T7M A;  4FCE A;  4FQW A;  5CMI A;  3OKR A;  1H4E A;  2OEF A;  4FIX A;  1H7T A;  4BQH A;  1H5T B;  4HO3 A;  2OI7 A;  1OMX A;  3I0F A;  4M2B A;  2ICX A;  1WT0 A;  4KC1 A;  2V0J A;  1R80 A;  2WGZ A;  2XME A;  4ARW A;  5FV9 A;  3ZF8 A;  1NF5 B;  1YP2 A;  2BO6 A;  3F1Y A;  1PZT A;  4D11 C;  1FZW A;  2ZU8 A;  1LVW A;  4AAW A;  2VSH A;  2WVM A;  1FGG A;  2NXV A;  2XWL A;  2OI5 A;  1H5S D;  2AM4 A;  1H3M A;  1JYL A;  1QGS A;  1W55 A;  1H5S A;  5C38 A;  2V0I A;  1GX0 A;  2WEE A;  3PNN A;  4ECM A;  2YCM A;  2P73 A;  3HL3 A;  3IOI A;  1TVY A;  1VZX A;  1ON8 A;  4B3U A;  3ZGF A;  2Y4J A;  1QWJ A;  1TW1 A;  4P00 A;  1R82 A;  1OQM B;  3DJ4 A;  4P02 A;  1JVG A;  4EVW A;  5CMG X;  2RJ5 A;  3SXE A;  2VXM A;  2I7B A;  2O1F A;  1QG8 A;  4MIX A;  1GA8 A;  4AYJ A;  1G0R A;  2D0J A;  1G23 A;  2FY7 A;  2VK9 A;  2X60 A;  1R81 A;  5CQP A;  2RJ8 A;  1ZCU A;  4KC2 A;  1HJJ A;  5AJP A;  4HO0 A;  1FR9 A;  4KC4 A;  4B4B A;  4BMA A;  4CJC A;  2YC3 A;  2FYD B;  3V0Q A;  2GGO A;  2YQS A;  1H5T A;  3ZLL A;  1LZJ A;  4MND A;  3OH1 A;  4IRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...