2P73A

Crystal structure of a glycosyltransferase involved in the glycosylation of the major capsid of pbcv-1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
TPCITILSGHFPKETIYARKTKELVEEYCSIHGYNFYYEESEPLETEEHALHFRRSWIIQQAAEKFPSTEWFLWLDSDVYVNPKNKNKPITSFIDLSDPNILYHTFHEAPWGSYPINTGVKFVHKDALEIEKIVWSLRNEAPWNTFPYEQKTVYEYVFPRIPGRYIVHDPYTLNCIVKAYPEHVKDALFVHMCGTSRAERDEHMEMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glycosyltransferase (Mannosyltransferase) involved
publication title Structure and function of a chlorella virus-encoded glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 67
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2p73A00
2O1HA 4NAIA 1S4OA 4DE7A 3U2TA 3LW6A 2D7IA 1QGQA 1LL0A 1ZJ2A 5CMHA 4B2WA 4FRBA 4KPXA 5C38A 2FY7A 1K4VA 1VGTA 3F1CA 3V0QA 3JUKA 5C47A 3HL3A 3OH3A 3SX3A 1H3MA 1W55A 3OGZA 4LW6A 3DUVA 4XWIA 2XWNA 3OC9A 2Y4LA 2I5EA 1ZIZA 2AM4A 1VZXA 2ZU9A 2DPWA 2JCOA 3JTJA 3OH0A 4Y7TA 1NWGB 2OEGA 2QH5A 3U2WA 4KC1A 4HO3A 3PKPA 5CMJA 4D11C 2PGYA 4B2XA 2V0IA 1NKHB 5EJ1A 4BMAA 2WGZA 3R2WA 3CKNA 4ASYA 2AM5A 1OMZA 4IRPA 4Y7UA 2JCKA 1FG5N 2RJ1A 1O23B 4ZDQA 3F1YA 4P02A 1XZ6A 2BO6A 3CKVA 2VS3A 1JVGA 3U2XA 1NHEB 1FO8A 1G8OA 3IOIA 1H7TA 3OH4A 4EE5A 1G2VA 4MNDA 4D48A 4AYLA 3OAMA 1ON6A 1ZHJA 5C1GA 4JD0A 1R7UA 4EVWA 3I0CA 2O1GA 5IDSA 5J49A 4HO6A 1H7HA 3PNNA 4YS8A 4G87A 2O1FA 1VGUA 2YQJA 1G95A 3NGWA 4CVHA 2OI5A 4D0TA 1ZI5A 1VH3A 4FRQA 1JV3A 1S4NA 3T7OA 4ARWA 1FZWA 2AH9A 1H5SC 3OKRA 3I0IX 1ZJ3A 4KRVA 1JV1A 3SPTA 4HO4A 3K8DA 3V0PA 4Y7FA 2FYCB 1H7LA 1ZCTA 1FGGA 4MYBA 5CQPA 2RJ6A 1OMXA 3N9WA 3FWWA 4D11A 1HJLA 5HS2A 2A8WA 4NANA 4Y63A 2PA4A 1LVWA 1HM0A 5EJZA 1GX0A 1ZI3A 1E5KA 4HG6A 3Q7UA 1H7GA 2JCJA 3ZGFA 2Y6PA 3CU0A 1G93A 5C36A 4HO9A 2ICXA 2ZU8A 4LW3A 4Y6NA 1NQIB 2RJ9A 5CQNX 1IIMA 1FR8A 3V0OA 1VGZA 5FUHA 2FYDB 4B4BA 1ZCVA 3T7NA 3ZGGA 2V0JA 1H4EA 1HM8A 5CMIA 4EEMA 3ZF8A 2P72A 1TW5A 3OH2A 2OI7A 1G1LA 2I5KA 1MP5A 1ZDGA 3RSBA 4HOCA 3DJ4A 1ZJ1A 1S4PA 2FYAA 3SXCA 1R7XA 3U2UA 2AE7A 2YC5A 1H5SA 2XWLA 2X60A 2Y4MA 3I0LA 3IOJA 4R7PA 3V90A 3V91A 4C2SA 2WVLA 3I0GA 1G3LA 5FU8A 1O0RA 1MC3A 1R7YA 1TVYA 5AJOA 3V0NA 5C49A 4Y7GA 1ZCYA 2XWMA 1H5TA 5CMFX 3POLA 1FRWA 4FCEA 1SS9A 5BXCA 4Y6UA 4EEOA 1JYLA 2OI6A 2ZU7A 4EEAA 1Z90A 4BQHA 4IRQA 3K8EA 2YQHA 2Z87A 1ZCUA 4NAKA 2YQSA 3ZLKA 1WT0A 5L6SA 2VFZA 2VS5A 4B4MA 3SX7A 4B42A 3DK5A 5I1FA 4FRAA 5FTVA 1MP3A 3JUJA 2XMHA 3TQDA 3KIAA 3BRKX 1H5RA 1H7QA 1INJA 1WT2A 4EEGA 1LZ7A 1V82A 3ZLLA 1GQ9A 1FXJA 1G23A 2WAWA 3D8VA 3U2VA 2FFVA 2Q4JA 4HO2A 2GGOA 1GA8A 3D98A 1O7OA 3I0KA 5CMGX 5FTSA 1GX4A 2D7RA 2YC3A 2E8BA 1FO9A 1H7EA 5C3DA 2Y7AA 4G3QA 4UEGA 4B4GA 4DDZA 3FOQA 1FOAA 2P6WA 3PKQA 1OQMB 2MZBA 1W77A 2RJ8A 2X65A 1FXOA 3QVBA 2ICYA 1KWSA 2RIYA 5C4EA 5C48A 2WVKA 3I0EA 4ECMA 1VM8A 2V0LA 3I0DA 4M4KA 3TZTA 2Y4KA 2WEEA 4GBPA 2X5SA 1NF5B 4HO5A 1FWYA 2AECA 4G3SA 4HO8A 5C3AA 1LL2A 2I7BA 3I0JA 4DECA 1HJJA 1R81A 2RJ7A 5C8RA 5L6VA 5DDVA 2QKXA 1VGWA 3CKJA 5AJPA 3CKQA 4CJCA 1YP3A 1IINA 1GQCA 4FRMA 3OH1A 3GUEA 1NMMB 5DDTA 1HV9A 3SXDA 1VZUA 4FRLA 1TW1A 2D0JA 1QG8A 4ASJA 1HM9A 3V0LA 3Q80A 4M2BA 3RMVA 1H5SB 1GWVA 2AM3A 1G0RA 2PGVA 1ZJ0A 1VH1A 3SXBA 2UX8A 4HO0A 2CU2A 4FREA 4AYJA 1QWJA 1H5TB 1ZI4A 4Y62A 1ZJPA 4KXOA 5FV9A 1QGSA 4D0ZA 1FGXA 1R80A 2JCLA 4FCUA 5C4BA 1JYKA 1I52A 4HCQA 4P00A 3V8YA 4L41C 5IFYA 5FYEA 4M2AA 5CQMX 5CQLX 1R7VA 2E3DA 1GWWA 2RJ5A 5AJNA 4E1KA 3U0YA 4JISA 1PZTA 1LZ0A 1R82A 4EE3A 1INIA 1R7TA 2VSHA 4B5BA 5JQQA 2RJ0A 1G97A 4FRPA 1H5RB 1H4CA 3EE5A 1G9RA 2PX7A 2YCMA 2V0HA 3USRA 3D5NA 2Z86A 2A8UA 4FRHA 4CJ8A 2APCA 3SX5A 1V84A 1LL3A 3R3IA 4KQLA 5EIYA 2X5ZA 1EZIA 4KPZA 1TZFA 2FYBA 2RIXA 1WT1A 1H4DA 1YROB 2VXMA 3V8ZA 1ZDFA 3USQA 2NXVA 3SXEA 4FQWA 5C1HA 4Y9XA 3T7MA 3O3PA 5IDTA 5C4DA 3ST8A 2BO4A 2RJ4A 1PZYB 3BCVA 3RMWA 1VPAA 4KNRA 1VZTA 4B3UA 3V0MA 2QGIA 2YESA 2W0WA 2P73A 2W0VA 5FU0A 1LZJA 4EE4A 4AC3A 4KNXA 4KC2A 5C4CA 3SXAA 1WVCA 1VICA 4G3PA 3CKOA 1FR9A 1LZIA 1H7FA 2VSIA 2YQCA 3Q4SA 4KC4A 4FRDA 2Y4JA 4J18A 2BO8A 2AGDA 2FFUA 4M28A 1MP4A 2V0KA 4CJBA 5C1LA 5C3BA 1ON8A 2OEFA 2GGQA 2WE9A 1EYRA 2VD4A 1WT3A 3E25A 1YP4A 2AESA 1YP2A 3IOHA 5C4FA 3I0FA 4AAWA 1ZJOA 2RIZA 2WVMA 3CGXA 2RITA 1H5SD 2VS4A 1WSZA 2VXLA 3E26A 3I0HA 2BO7A 1XHBA 1JVDA 5CQOA 3U0XA 1O7QA 4KT7A 4FROA 4NALA 3SX8A 1ZI1A 4Y7VA 4Y64A 3SXGA 1V83A 1W57A 4K6RA 2XMEA
chains in the Genus database with same CATH superfamily
2O1HA 4NAIA 1S4OA 4DE7A 3U2TA 3LW6A 2D7IA 1QGQA 1LL0A 1ZJ2A 5CMHA 4B2WA 4FRBA 4KPXA 5C38A 2FY7A 1K4VA 1VGTA 3F1CA 3V0QA 3JUKA 5C47A 3HL3A 3OH3A 3SX3A 1H3MA 1W55A 3OGZA 4LW6A 3DUVA 4XWIA 2XWNA 3OC9A 2Y4LA 2I5EA 1ZIZA 2AM4A 1VZXA 2ZU9A 2DPWA 2JCOA 3JTJA 3OH0A 4Y7TA 1NWGB 2OEGA 2QH5A 3U2WA 4KC1A 4HO3A 3PKPA 5CMJA 4D11C 2PGYA 4B2XA 2V0IA 1NKHB 5EJ1A 4BMAA 2WGZA 3R2WA 3CKNA 4ASYA 2AM5A 1OMZA 4IRPA 4Y7UA 2JCKA 1FG5N 2RJ1A 1O23B 4ZDQA 3F1YA 4P02A 1XZ6A 2BO6A 3CKVA 2VS3A 1JVGA 3U2XA 1NHEB 1FO8A 1G8OA 3IOIA 1H7TA 3OH4A 4EE5A 1G2VA 4MNDA 4D48A 4AYLA 3OAMA 1ON6A 1ZHJA 5C1GA 4JD0A 1R7UA 4EVWA 3I0CA 2O1GA 5IDSA 5J49A 4HO6A 1H7HA 3PNNA 4YS8A 4G87A 2O1FA 1VGUA 2YQJA 1G95A 3NGWA 4CVHA 2OI5A 4D0TA 1ZI5A 1VH3A 4FRQA 1JV3A 1S4NA 3T7OA 4ARWA 1FZWA 2AH9A 1H5SC 3OKRA 3I0IX 1ZJ3A 4KRVA 1JV1A 3SPTA 4HO4A 3K8DA 3V0PA 4Y7FA 2FYCB 1H7LA 1ZCTA 1FGGA 4MYBA 5CQPA 2RJ6A 1OMXA 3N9WA 3FWWA 4D11A 1HJLA 5HS2A 2A8WA 4NANA 4Y63A 2PA4A 1LVWA 1HM0A 5EJZA 1GX0A 1ZI3A 1E5KA 4HG6A 3Q7UA 1H7GA 2JCJA 3ZGFA 2Y6PA 3CU0A 1G93A 5C36A 4HO9A 2ICXA 2ZU8A 5D91A 4LW3A 4Y6NA 1NQIB 2RJ9A 5CQNX 1IIMA 1FR8A 3V0OA 1VGZA 5FUHA 2FYDB 4B4BA 1ZCVA 3T7NA 3ZGGA 2V0JA 1H4EA 1HM8A 5CMIA 4EEMA 3ZF8A 2P72A 1TW5A 3OH2A 2OI7A 1G1LA 2I5KA 1MP5A 1ZDGA 3RSBA 4HOCA 3DJ4A 1ZJ1A 1S4PA 2FYAA 4FIXA 3SXCA 1R7XA 3U2UA 2AE7A 2YC5A 1H5SA 2XWLA 2X60A 2Y4MA 3I0LA 3IOJA 4R7PA 3V90A 3V91A 4C2SA 2WVLA 3I0GA 1G3LA 5FU8A 1O0RA 1MC3A 1R7YA 1TVYA 5AJOA 3V0NA 5C49A 4Y7GA 1ZCYA 2XWMA 1H5TA 5CMFX 3POLA 1FRWA 4FCEA 1SS9A 5BXCA 4Y6UA 4MIXA 4EEOA 1JYLA 2OI6A 2ZU7A 4EEAA 1Z90A 4BQHA 4IRQA 3K8EA 2YQHA 2Z87A 1ZCUA 4NAKA 5D92A 2YQSA 3ZLKA 1WT0A 5L6SA 2VFZA 2VS5A 4B4MA 3SX7A 4B42A 3DK5A 5I1FA 4FRAA 5FTVA 1MP3A 3JUJA 2XMHA 3TQDA 3KIAA 3BRKX 1H5RA 1H7QA 1INJA 1WT2A 4EEGA 1LZ7A 1V82A 3ZLLA 1GQ9A 1FXJA 1G23A 2WAWA 3D8VA 3U2VA 2FFVA 2Q4JA 4HO2A 2GGOA 1GA8A 3D98A 1O7OA 3I0KA 5CMGX 5FTSA 1GX4A 2D7RA 2YC3A 2E8BA 1FO9A 1H7EA 5C3DA 2Y7AA 4G3QA 4UEGA 4B4GA 4DDZA 3FOQA 1FOAA 2P6WA 3PKQA 1OQMB 2MZBA 1W77A 2RJ8A 2X65A 1FXOA 3QVBA 2ICYA 1KWSA 2RIYA 5C4EA 5C48A 2WVKA 3I0EA 4ECMA 1VM8A 2V0LA 3I0DA 4M4KA 3TZTA 2Y4KA 2WEEA 4GBPA 2X5SA 1NF5B 4HO5A 1FWYA 2AECA 4G3SA 4HO8A 5C3AA 1LL2A 2I7BA 3I0JA 4DECA 1HJJA 1R81A 2RJ7A 5C8RA 5L6VA 5DDVA 2QKXA 1VGWA 3CKJA 5AJPA 3CKQA 4CJCA 1YP3A 1IINA 1GQCA 4FRMA 3OH1A 3GUEA 1NMMB 5DDTA 1HV9A 3SXDA 1VZUA 4FRLA 1TW1A 2D0JA 1QG8A 4ASJA 1HM9A 3V0LA 3Q80A 4M2BA 3RMVA 1H5SB 1GWVA 2AM3A 1G0RA 2PGVA 1ZJ0A 1VH1A 3SXBA 2UX8A 4HO0A 2CU2A 4FREA 4AYJA 1QWJA 1H5TB 1ZI4A 4Y62A 1ZJPA 4KXOA 5FV9A 1QGSA 4D0ZA 1FGXA 1R80A 2JCLA 4FCUA 5C4BA 1JYKA 1I52A 4HCQA 2J0BA 4P00A 3V8YA 4L41C 5IFYA 5FYEA 4M2AA 5CQMX 5CQLX 1R7VA 2E3DA 1GWWA 2RJ5A 5AJNA 4E1KA 3U0YA 4JISA 1PZTA 1LZ0A 1R82A 4EE3A 1INIA 1R7TA 2VSHA 4B5BA 5JQQA 2RJ0A 1G97A 2C0NA 4FRPA 4Q7CA 1H5RB 1H4CA 3EE5A 1G9RA 2PX7A 2YCMA 2V0HA 3USRA 3D5NA 2Z86A 2A8UA 4FRHA 4CJ8A 2APCA 3SX5A 1V84A 1LL3A 3R3IA 4KQLA 5EIYA 2X5ZA 1EZIA 4KPZA 1TZFA 2FYBA 2RIXA 1WT1A 1H4DA 1YROB 2VXMA 3V8ZA 1ZDFA 3USQA 2NXVA 3SXEA 4FQWA 5C1HA 4Y9XA 3T7MA 3O3PA 5IDTA 5C4DA 3ST8A 2BO4A 2RJ4A 1PZYB 3BCVA 3RMWA 1VPAA 4KNRA 1VZTA 4B3UA 3V0MA 2QGIA 4FIYA 2YESA 2VK9A 2W0WA 2P73A 2W0VA 5FU0A 1LZJA 4EE4A 2J0AA 4O6NA 4AC3A 4KNXA 4KC2A 5C4CA 3SXAA 1WVCA 1VICA 4G3PA 3CKOA 1FR9A 1LZIA 1H7FA 2VSIA 2YQCA 3Q4SA 4KC4A 4FRDA 2Y4JA 4J18A 2BO8A 2AGDA 2FFUA 4M28A 1MP4A 2V0KA 4CJBA 5C1LA 5C3BA 1ON8A 2OEFA 2GGQA 2WE9A 1EYRA 2VD4A 1WT3A 3E25A 1YP4A 4O6MA 2AESA 1YP2A 3IOHA 5C4FA 3I0FA 4AAWA 1ZJOA 2RIZA 2WVMA 3CGXA 2RITA 1H5SD 2VS4A 1WSZA 2VXLA 3E26A 3I0HA 2BO7A 1XHBA 1JVDA 5CQOA 3U0XA 1O7QA 4KT7A 4FROA 4NALA 3SX8A 1ZI1A 4Y7VA 4Y64A 3SXGA 1V83A 1W57A 4K6RA 2XMEA
chains in the Genus database with same CATH topology
2O1HA 4NAIA 1S4OA 4DE7A 3U2TA 3LW6A 2D7IA 1QGQA 1LL0A 1ZJ2A 5CMHA 4B2WA 4FRBA 4KPXA 5C38A 2FY7A 1K4VA 1VGTA 3F1CA 3V0QA 3JUKA 5C47A 3HL3A 3OH3A 3SX3A 1H3MA 1W55A 3OGZA 4LW6A 3DUVA 4XWIA 2XWNA 3OC9A 2Y4LA 2I5EA 1ZIZA 2AM4A 1VZXA 2ZU9A 2DPWA 2JCOA 3JTJA 3OH0A 4Y7TA 1NWGB 2OEGA 2QH5A 3U2WA 4KC1A 4HO3A 3PKPA 5CMJA 4D11C 2PGYA 4B2XA 2V0IA 1NKHB 5EJ1A 4BMAA 2WGZA 3R2WA 3CKNA 4ASYA 2AM5A 1OMZA 4IRPA 4Y7UA 2JCKA 1FG5N 2RJ1A 1O23B 4ZDQA 3F1YA 4P02A 1XZ6A 2BO6A 3CKVA 2VS3A 1JVGA 3U2XA 1NHEB 1FO8A 1G8OA 3IOIA 1H7TA 3OH4A 4EE5A 1G2VA 4MNDA 4D48A 4AYLA 3OAMA 1ON6A 1ZHJA 5C1GA 4JD0A 1R7UA 4EVWA 3I0CA 2O1GA 5IDSA 5J49A 4HO6A 1H7HA 3PNNA 4YS8A 4G87A 2O1FA 1VGUA 2YQJA 1G95A 3NGWA 4CVHA 2OI5A 4D0TA 1ZI5A 1VH3A 4FRQA 1JV3A 1S4NA 3T7OA 4ARWA 1FZWA 2AH9A 1H5SC 3OKRA 3I0IX 1ZJ3A 4KRVA 1JV1A 3SPTA 4HO4A 3K8DA 3V0PA 4Y7FA 2FYCB 1H7LA 1ZCTA 1FGGA 4MYBA 5CQPA 2RJ6A 1OMXA 3N9WA 3FWWA 4D11A 1HJLA 5HS2A 2A8WA 4NANA 4Y63A 2PA4A 1LVWA 1HM0A 5EJZA 1GX0A 1ZI3A 1E5KA 4HG6A 3Q7UA 1H7GA 2JCJA 3ZGFA 2Y6PA 3CU0A 1G93A 5C36A 4HO9A 2ICXA 2ZU8A 5D91A 4LW3A 4Y6NA 1NQIB 2RJ9A 5CQNX 1IIMA 1FR8A 3V0OA 1VGZA 5FUHA 2FYDB 4B4BA 1ZCVA 3T7NA 3ZGGA 2V0JA 1H4EA 1HM8A 5CMIA 4EEMA 3ZF8A 2P72A 1TW5A 3OH2A 2OI7A 1G1LA 2I5KA 1MP5A 1ZDGA 3RSBA 4HOCA 3DJ4A 1ZJ1A 1S4PA 2FYAA 4FIXA 3SXCA 1R7XA 3U2UA 2AE7A 2YC5A 1H5SA 2XWLA 2X60A 2Y4MA 3I0LA 3IOJA 4R7PA 3V90A 3V91A 4C2SA 2WVLA 3I0GA 1G3LA 5FU8A 1O0RA 1MC3A 1R7YA 1TVYA 5AJOA 3V0NA 5C49A 4Y7GA 1ZCYA 2XWMA 1H5TA 5CMFX 3POLA 1FRWA 4FCEA 1SS9A 5BXCA 4Y6UA 4MIXA 4EEOA 1JYLA 2OI6A 2ZU7A 4EEAA 1Z90A 4BQHA 4IRQA 3K8EA 2YQHA 2Z87A 1ZCUA 4NAKA 5D92A 2YQSA 3ZLKA 1WT0A 5L6SA 2VFZA 2VS5A 4B4MA 3SX7A 4B42A 3DK5A 5I1FA 4FRAA 5FTVA 1MP3A 3JUJA 2XMHA 3TQDA 3KIAA 3BRKX 1H5RA 1H7QA 1INJA 1WT2A 4EEGA 1LZ7A 1V82A 3ZLLA 1GQ9A 1FXJA 1G23A 2WAWA 3D8VA 3U2VA 2FFVA 2Q4JA 4HO2A 2GGOA 1GA8A 3D98A 1O7OA 3I0KA 5CMGX 5FTSA 1GX4A 2D7RA 2YC3A 2E8BA 1FO9A 1H7EA 5C3DA 2Y7AA 4G3QA 4UEGA 4B4GA 4DDZA 3FOQA 1FOAA 2P6WA 3PKQA 1OQMB 2MZBA 1W77A 2RJ8A 2X65A 1FXOA 3QVBA 2ICYA 1KWSA 2RIYA 5C4EA 5C48A 2WVKA 3I0EA 4ECMA 1VM8A 2V0LA 3I0DA 4M4KA 3TZTA 2Y4KA 2WEEA 4GBPA 2X5SA 1NF5B 4HO5A 1FWYA 2AECA 4G3SA 4HO8A 5C3AA 1LL2A 2I7BA 3I0JA 4DECA 1HJJA 1R81A 2RJ7A 5C8RA 5L6VA 5DDVA 2QKXA 1VGWA 3CKJA 5AJPA 3CKQA 4CJCA 1YP3A 1IINA 1GQCA 4FRMA 3OH1A 3GUEA 1NMMB 5DDTA 1HV9A 3SXDA 1VZUA 4FRLA 1TW1A 2D0JA 1QG8A 4ASJA 1HM9A 3V0LA 3Q80A 4M2BA 3RMVA 1H5SB 1GWVA 2AM3A 1G0RA 2PGVA 1ZJ0A 1VH1A 3SXBA 2UX8A 4HO0A 2CU2A 4FREA 4AYJA 1QWJA 1H5TB 1ZI4A 4Y62A 1ZJPA 4KXOA 5FV9A 1QGSA 4D0ZA 1FGXA 1R80A 2JCLA 4FCUA 5C4BA 1JYKA 1I52A 4HCQA 2J0BA 4P00A 3V8YA 4L41C 5IFYA 5FYEA 4M2AA 5CQMX 5CQLX 1R7VA 2E3DA 1GWWA 2RJ5A 5AJNA 4E1KA 3U0YA 4JISA 1PZTA 1LZ0A 1R82A 4EE3A 1INIA 1R7TA 2VSHA 4B5BA 5JQQA 2RJ0A 1G97A 2C0NA 4FRPA 4Q7CA 1H5RB 1H4CA 3EE5A 1G9RA 2PX7A 2YCMA 2V0HA 3USRA 3D5NA 2Z86A 2A8UA 4FRHA 4CJ8A 2APCA 3SX5A 1V84A 1LL3A 3R3IA 4KQLA 5EIYA 2X5ZA 1EZIA 4KPZA 1TZFA 2FYBA 2RIXA 1WT1A 1H4DA 1YROB 2VXMA 3V8ZA 1ZDFA 3USQA 2NXVA 3SXEA 4FQWA 5C1HA 4Y9XA 3T7MA 3O3PA 5IDTA 5C4DA 3ST8A 2BO4A 2RJ4A 1PZYB 3BCVA 3RMWA 1VPAA 4KNRA 1VZTA 4B3UA 3V0MA 2QGIA 4FIYA 2YESA 2VK9A 2W0WA 2P73A 2W0VA 5FU0A 1LZJA 4EE4A 2J0AA 4O6NA 4AC3A 4KNXA 4KC2A 5C4CA 3SXAA 1WVCA 1VICA 4G3PA 3CKOA 1FR9A 1LZIA 1H7FA 2VSIA 2YQCA 3Q4SA 4KC4A 4FRDA 2Y4JA 4J18A 2BO8A 2AGDA 2FFUA 4M28A 1MP4A 2V0KA 4CJBA 5C1LA 5C3BA 1ON8A 2OEFA 2GGQA 2WE9A 1EYRA 2VD4A 1WT3A 3E25A 1YP4A 4O6MA 2AESA 1YP2A 3IOHA 5C4FA 3I0FA 4AAWA 1ZJOA 2RIZA 2WVMA 3CGXA 2RITA 1H5SD 2VS4A 1WSZA 2VXLA 3E26A 3I0HA 2BO7A 1XHBA 1JVDA 5CQOA 3U0XA 1O7QA 4KT7A 4FROA 4NALA 3SX8A 1ZI1A 4Y7VA 4Y64A 3SXGA 1V83A 1W57A 4K6RA 2XMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1H A;  4NAI A;  1S4O A;  4DE7 A;  3U2T A;  3LW6 A;  2D7I A;  1QGQ A;  1LL0 A;  1ZJ2 A;  5CMH A;  4B2W A;  4FRB A;  4KPX A;  5C38 A;  2FY7 A;  1K4V A;  1VGT A;  3F1C A;  3V0Q A;  3JUK A;  5C47 A;  3HL3 A;  3OH3 A;  3SX3 A;  1H3M A;  1W55 A;  3OGZ A;  4LW6 A;  3DUV A;  4XWI A;  2XWN A;  3OC9 A;  2Y4L A;  2I5E A;  1ZIZ A;  2AM4 A;  1VZX A;  2ZU9 A;  2DPW A;  2JCO A;  3JTJ A;  3OH0 A;  4Y7T A;  1NWG B;  2OEG A;  2QH5 A;  3U2W A;  4KC1 A;  4HO3 A;  3PKP A;  5CMJ A;  4D11 C;  2PGY A;  4B2X A;  2V0I A;  1NKH B;  5EJ1 A;  4BMA A;  2WGZ A;  3R2W A;  3CKN A;  4ASY A;  2AM5 A;  1OMZ A;  4IRP A;  4Y7U A;  2JCK A;  1FG5 N;  2RJ1 A;  1O23 B;  4ZDQ A;  3F1Y A;  4P02 A;  1XZ6 A;  2BO6 A;  3CKV A;  2VS3 A;  1JVG A;  3U2X A;  1NHE B;  1FO8 A;  1G8O A;  3IOI A;  1H7T A;  3OH4 A;  4EE5 A;  1G2V A;  4MND A;  4D48 A;  4AYL A;  3OAM A;  1ON6 A;  1ZHJ A;  5C1G A;  4JD0 A;  1R7U A;  4EVW A;  3I0C A;  2O1G A;  5IDS A;  5J49 A;  4HO6 A;  1H7H A;  3PNN A;  4YS8 A;  4G87 A;  2O1F A;  1VGU A;  2YQJ A;  1G95 A;  3NGW A;  4CVH A;  2OI5 A;  4D0T A;  1ZI5 A;  1VH3 A;  4FRQ A;  1JV3 A;  1S4N A;  3T7O A;  4ARW A;  1FZW A;  2AH9 A;  1H5S C;  3OKR A;  3I0I X;  1ZJ3 A;  4KRV A;  1JV1 A;  3SPT A;  4HO4 A;  3K8D A;  3V0P A;  4Y7F A;  2FYC B;  1H7L A;  1ZCT A;  1FGG A;  4MYB A;  5CQP A;  2RJ6 A;  1OMX A;  3N9W A;  3FWW A;  4D11 A;  1HJL A;  5HS2 A;  2A8W A;  4NAN A;  4Y63 A;  2PA4 A;  1LVW A;  1HM0 A;  5EJZ A;  1GX0 A;  1ZI3 A;  1E5K A;  4HG6 A;  3Q7U A;  1H7G A;  2JCJ A;  3ZGF A;  2Y6P A;  3CU0 A;  1G93 A;  5C36 A;  4HO9 A;  2ICX A;  2ZU8 A;  4LW3 A;  4Y6N A;  1NQI B;  2RJ9 A;  5CQN X;  1IIM A;  1FR8 A;  3V0O A;  1VGZ A;  5FUH A;  2FYD B;  4B4B A;  1ZCV A;  3T7N A;  3ZGG A;  2V0J A;  1H4E A;  1HM8 A;  5CMI A;  4EEM A;  3ZF8 A;  2P72 A;  1TW5 A;  3OH2 A;  2OI7 A;  1G1L A;  2I5K A;  1MP5 A;  1ZDG A;  3RSB A;  4HOC A;  3DJ4 A;  1ZJ1 A;  1S4P A;  2FYA A;  3SXC A;  1R7X A;  3U2U A;  2AE7 A;  2YC5 A;  1H5S A;  2XWL A;  2X60 A;  2Y4M A;  3I0L A;  3IOJ A;  4R7P A;  3V90 A;  3V91 A;  4C2S A;  2WVL A;  3I0G A;  1G3L A;  5FU8 A;  1O0R A;  1MC3 A;  1R7Y A;  1TVY A;  5AJO A;  3V0N A;  5C49 A;  4Y7G A;  1ZCY A;  2XWM A;  1H5T A;  5CMF X;  3POL A;  1FRW A;  4FCE A;  1SS9 A;  5BXC A;  4Y6U A;  4EEO A;  1JYL A;  2OI6 A;  2ZU7 A;  4EEA A;  1Z90 A;  4BQH A;  4IRQ A;  3K8E A;  2YQH A;  2Z87 A;  1ZCU A;  4NAK A;  2YQS A;  3ZLK A;  1WT0 A;  5L6S A;  2VFZ A;  2VS5 A;  4B4M A;  3SX7 A;  4B42 A;  3DK5 A;  5I1F A;  4FRA A;  5FTV A;  1MP3 A;  3JUJ A;  2XMH A;  3TQD A;  3KIA A;  3BRK X;  1H5R A;  1H7Q A;  1INJ A;  1WT2 A;  4EEG A;  1LZ7 A;  1V82 A;  3ZLL A;  1GQ9 A;  1FXJ A;  1G23 A;  2WAW A;  3D8V A;  3U2V A;  2FFV A;  2Q4J A;  4HO2 A;  2GGO A;  1GA8 A;  3D98 A;  1O7O A;  3I0K A;  5CMG X;  5FTS A;  1GX4 A;  2D7R A;  2YC3 A;  2E8B A;  1FO9 A;  1H7E A;  5C3D A;  2Y7A A;  4G3Q A;  4UEG A;  4B4G A;  4DDZ A;  3FOQ A;  1FOA A;  2P6W A;  3PKQ A;  1OQM B;  2MZB A;  1W77 A;  2RJ8 A;  2X65 A;  1FXO A;  3QVB A;  2ICY A;  1KWS A;  2RIY A;  5C4E A;  5C48 A;  2WVK A;  3I0E A;  4ECM A;  1VM8 A;  2V0L A;  3I0D A;  4M4K A;  3TZT A;  2Y4K A;  2WEE A;  4GBP A;  2X5S A;  1NF5 B;  4HO5 A;  1FWY A;  2AEC A;  4G3S A;  4HO8 A;  5C3A A;  1LL2 A;  2I7B A;  3I0J A;  4DEC A;  1HJJ A;  1R81 A;  2RJ7 A;  5C8R A;  5L6V A;  5DDV A;  2QKX A;  1VGW A;  3CKJ A;  5AJP A;  3CKQ A;  4CJC A;  1YP3 A;  1IIN A;  1GQC A;  4FRM A;  3OH1 A;  3GUE A;  1NMM B;  5DDT A;  1HV9 A;  3SXD A;  1VZU A;  4FRL A;  1TW1 A;  2D0J A;  1QG8 A;  4ASJ A;  1HM9 A;  3V0L A;  3Q80 A;  4M2B A;  3RMV A;  1H5S B;  1GWV A;  2AM3 A;  1G0R A;  2PGV A;  1ZJ0 A;  1VH1 A;  3SXB A;  2UX8 A;  4HO0 A;  2CU2 A;  4FRE A;  4AYJ A;  1QWJ A;  1H5T B;  1ZI4 A;  4Y62 A;  1ZJP A;  4KXO A;  5FV9 A;  1QGS A;  4D0Z A;  1FGX A;  1R80 A;  2JCL A;  4FCU A;  5C4B A;  1JYK A;  1I52 A;  4HCQ A;  4P00 A;  3V8Y A;  4L41 C;  5IFY A;  5FYE A;  4M2A A;  5CQM X;  5CQL X;  1R7V A;  2E3D A;  1GWW A;  2RJ5 A;  5AJN A;  4E1K A;  3U0Y A;  4JIS A;  1PZT A;  1LZ0 A;  1R82 A;  4EE3 A;  1INI A;  1R7T A;  2VSH A;  4B5B A;  5JQQ A;  2RJ0 A;  1G97 A;  4FRP A;  1H5R B;  1H4C A;  3EE5 A;  1G9R A;  2PX7 A;  2YCM A;  2V0H A;  3USR A;  3D5N A;  2Z86 A;  2A8U A;  4FRH A;  4CJ8 A;  2APC A;  3SX5 A;  1V84 A;  1LL3 A;  3R3I A;  4KQL A;  5EIY A;  2X5Z A;  1EZI A;  4KPZ A;  1TZF A;  2FYB A;  2RIX A;  1WT1 A;  1H4D A;  1YRO B;  2VXM A;  3V8Z A;  1ZDF A;  3USQ A;  2NXV A;  3SXE A;  4FQW A;  5C1H A;  4Y9X A;  3T7M A;  3O3P A;  5IDT A;  5C4D A;  3ST8 A;  2BO4 A;  2RJ4 A;  1PZY B;  3BCV A;  3RMW A;  1VPA A;  4KNR A;  1VZT A;  4B3U A;  3V0M A;  2QGI A;  2YES A;  2W0W A;  2P73 A;  2W0V A;  5FU0 A;  1LZJ A;  4EE4 A;  4AC3 A;  4KNX A;  4KC2 A;  5C4C A;  3SXA A;  1WVC A;  1VIC A;  4G3P A;  3CKO A;  1FR9 A;  1LZI A;  1H7F A;  2VSI A;  2YQC A;  3Q4S A;  4KC4 A;  4FRD A;  2Y4J A;  4J18 A;  2BO8 A;  2AGD A;  2FFU A;  4M28 A;  1MP4 A;  2V0K A;  4CJB A;  5C1L A;  5C3B A;  1ON8 A;  2OEF A;  2GGQ A;  2WE9 A;  1EYR A;  2VD4 A;  1WT3 A;  3E25 A;  1YP4 A;  2AES A;  1YP2 A;  3IOH A;  5C4F A;  3I0F A;  4AAW A;  1ZJO A;  2RIZ A;  2WVM A;  3CGX A;  2RIT A;  1H5S D;  2VS4 A;  1WSZ A;  2VXL A;  3E26 A;  3I0H A;  2BO7 A;  1XHB A;  1JVD A;  5CQO A;  3U0X A;  1O7Q A;  4KT7 A;  4FRO A;  4NAL A;  3SX8 A;  1ZI1 A;  4Y7V A;  4Y64 A;  3SXG A;  1V83 A;  1W57 A;  4K6R A;  2XME A; 
#chains in the Genus database with same CATH topology
 2O1H A;  4NAI A;  1S4O A;  4DE7 A;  3U2T A;  3LW6 A;  2D7I A;  1QGQ A;  1LL0 A;  1ZJ2 A;  5CMH A;  4B2W A;  4FRB A;  4KPX A;  5C38 A;  2FY7 A;  1K4V A;  1VGT A;  3F1C A;  3V0Q A;  3JUK A;  5C47 A;  3HL3 A;  3OH3 A;  3SX3 A;  1H3M A;  1W55 A;  3OGZ A;  4LW6 A;  3DUV A;  4XWI A;  2XWN A;  3OC9 A;  2Y4L A;  2I5E A;  1ZIZ A;  2AM4 A;  1VZX A;  2ZU9 A;  2DPW A;  2JCO A;  3JTJ A;  3OH0 A;  4Y7T A;  1NWG B;  2OEG A;  2QH5 A;  3U2W A;  4KC1 A;  4HO3 A;  3PKP A;  5CMJ A;  4D11 C;  2PGY A;  4B2X A;  2V0I A;  1NKH B;  5EJ1 A;  4BMA A;  2WGZ A;  3R2W A;  3CKN A;  4ASY A;  2AM5 A;  1OMZ A;  4IRP A;  4Y7U A;  2JCK A;  1FG5 N;  2RJ1 A;  1O23 B;  4ZDQ A;  3F1Y A;  4P02 A;  1XZ6 A;  2BO6 A;  3CKV A;  2VS3 A;  1JVG A;  3U2X A;  1NHE B;  1FO8 A;  1G8O A;  3IOI A;  1H7T A;  3OH4 A;  4EE5 A;  1G2V A;  4MND A;  4D48 A;  4AYL A;  3OAM A;  1ON6 A;  1ZHJ A;  5C1G A;  4JD0 A;  1R7U A;  4EVW A;  3I0C A;  2O1G A;  5IDS A;  5J49 A;  4HO6 A;  1H7H A;  3PNN A;  4YS8 A;  4G87 A;  2O1F A;  1VGU A;  2YQJ A;  1G95 A;  3NGW A;  4CVH A;  2OI5 A;  4D0T A;  1ZI5 A;  1VH3 A;  4FRQ A;  1JV3 A;  1S4N A;  3T7O A;  4ARW A;  1FZW A;  2AH9 A;  1H5S C;  3OKR A;  3I0I X;  1ZJ3 A;  4KRV A;  1JV1 A;  3SPT A;  4HO4 A;  3K8D A;  3V0P A;  4Y7F A;  2FYC B;  1H7L A;  1ZCT A;  1FGG A;  4MYB A;  5CQP A;  2RJ6 A;  1OMX A;  3N9W A;  3FWW A;  4D11 A;  1HJL A;  5HS2 A;  2A8W A;  4NAN A;  4Y63 A;  2PA4 A;  1LVW A;  1HM0 A;  5EJZ A;  1GX0 A;  1ZI3 A;  1E5K A;  4HG6 A;  3Q7U A;  1H7G A;  2JCJ A;  3ZGF A;  2Y6P A;  3CU0 A;  1G93 A;  5C36 A;  4HO9 A;  2ICX A;  2ZU8 A;  5D91 A;  4LW3 A;  4Y6N A;  1NQI B;  2RJ9 A;  5CQN X;  1IIM A;  1FR8 A;  3V0O A;  1VGZ A;  5FUH A;  2FYD B;  4B4B A;  1ZCV A;  3T7N A;  3ZGG A;  2V0J A;  1H4E A;  1HM8 A;  5CMI A;  4EEM A;  3ZF8 A;  2P72 A;  1TW5 A;  3OH2 A;  2OI7 A;  1G1L A;  2I5K A;  1MP5 A;  1ZDG A;  3RSB A;  4HOC A;  3DJ4 A;  1ZJ1 A;  1S4P A;  2FYA A;  4FIX A;  3SXC A;  1R7X A;  3U2U A;  2AE7 A;  2YC5 A;  1H5S A;  2XWL A;  2X60 A;  2Y4M A;  3I0L A;  3IOJ A;  4R7P A;  3V90 A;  3V91 A;  4C2S A;  2WVL A;  3I0G A;  1G3L A;  5FU8 A;  1O0R A;  1MC3 A;  1R7Y A;  1TVY A;  5AJO A;  3V0N A;  5C49 A;  4Y7G A;  1ZCY A;  2XWM A;  1H5T A;  5CMF X;  3POL A;  1FRW A;  4FCE A;  1SS9 A;  5BXC A;  4Y6U A;  4MIX A;  4EEO A;  1JYL A;  2OI6 A;  2ZU7 A;  4EEA A;  1Z90 A;  4BQH A;  4IRQ A;  3K8E A;  2YQH A;  2Z87 A;  1ZCU A;  4NAK A;  5D92 A;  2YQS A;  3ZLK A;  1WT0 A;  5L6S A;  2VFZ A;  2VS5 A;  4B4M A;  3SX7 A;  4B42 A;  3DK5 A;  5I1F A;  4FRA A;  5FTV A;  1MP3 A;  3JUJ A;  2XMH A;  3TQD A;  3KIA A;  3BRK X;  1H5R A;  1H7Q A;  1INJ A;  1WT2 A;  4EEG A;  1LZ7 A;  1V82 A;  3ZLL A;  1GQ9 A;  1FXJ A;  1G23 A;  2WAW A;  3D8V A;  3U2V A;  2FFV A;  2Q4J A;  4HO2 A;  2GGO A;  1GA8 A;  3D98 A;  1O7O A;  3I0K A;  5CMG X;  5FTS A;  1GX4 A;  2D7R A;  2YC3 A;  2E8B A;  1FO9 A;  1H7E A;  5C3D A;  2Y7A A;  4G3Q A;  4UEG A;  4B4G A;  4DDZ A;  3FOQ A;  1FOA A;  2P6W A;  3PKQ A;  1OQM B;  2MZB A;  1W77 A;  2RJ8 A;  2X65 A;  1FXO A;  3QVB A;  2ICY A;  1KWS A;  2RIY A;  5C4E A;  5C48 A;  2WVK A;  3I0E A;  4ECM A;  1VM8 A;  2V0L A;  3I0D A;  4M4K A;  3TZT A;  2Y4K A;  2WEE A;  4GBP A;  2X5S A;  1NF5 B;  4HO5 A;  1FWY A;  2AEC A;  4G3S A;  4HO8 A;  5C3A A;  1LL2 A;  2I7B A;  3I0J A;  4DEC A;  1HJJ A;  1R81 A;  2RJ7 A;  5C8R A;  5L6V A;  5DDV A;  2QKX A;  1VGW A;  3CKJ A;  5AJP A;  3CKQ A;  4CJC A;  1YP3 A;  1IIN A;  1GQC A;  4FRM A;  3OH1 A;  3GUE A;  1NMM B;  5DDT A;  1HV9 A;  3SXD A;  1VZU A;  4FRL A;  1TW1 A;  2D0J A;  1QG8 A;  4ASJ A;  1HM9 A;  3V0L A;  3Q80 A;  4M2B A;  3RMV A;  1H5S B;  1GWV A;  2AM3 A;  1G0R A;  2PGV A;  1ZJ0 A;  1VH1 A;  3SXB A;  2UX8 A;  4HO0 A;  2CU2 A;  4FRE A;  4AYJ A;  1QWJ A;  1H5T B;  1ZI4 A;  4Y62 A;  1ZJP A;  4KXO A;  5FV9 A;  1QGS A;  4D0Z A;  1FGX A;  1R80 A;  2JCL A;  4FCU A;  5C4B A;  1JYK A;  1I52 A;  4HCQ A;  2J0B A;  4P00 A;  3V8Y A;  4L41 C;  5IFY A;  5FYE A;  4M2A A;  5CQM X;  5CQL X;  1R7V A;  2E3D A;  1GWW A;  2RJ5 A;  5AJN A;  4E1K A;  3U0Y A;  4JIS A;  1PZT A;  1LZ0 A;  1R82 A;  4EE3 A;  1INI A;  1R7T A;  2VSH A;  4B5B A;  5JQQ A;  2RJ0 A;  1G97 A;  2C0N A;  4FRP A;  4Q7C A;  1H5R B;  1H4C A;  3EE5 A;  1G9R A;  2PX7 A;  2YCM A;  2V0H A;  3USR A;  3D5N A;  2Z86 A;  2A8U A;  4FRH A;  4CJ8 A;  2APC A;  3SX5 A;  1V84 A;  1LL3 A;  3R3I A;  4KQL A;  5EIY A;  2X5Z A;  1EZI A;  4KPZ A;  1TZF A;  2FYB A;  2RIX A;  1WT1 A;  1H4D A;  1YRO B;  2VXM A;  3V8Z A;  1ZDF A;  3USQ A;  2NXV A;  3SXE A;  4FQW A;  5C1H A;  4Y9X A;  3T7M A;  3O3P A;  5IDT A;  5C4D A;  3ST8 A;  2BO4 A;  2RJ4 A;  1PZY B;  3BCV A;  3RMW A;  1VPA A;  4KNR A;  1VZT A;  4B3U A;  3V0M A;  2QGI A;  4FIY A;  2YES A;  2VK9 A;  2W0W A;  2P73 A;  2W0V A;  5FU0 A;  1LZJ A;  4EE4 A;  2J0A A;  4O6N A;  4AC3 A;  4KNX A;  4KC2 A;  5C4C A;  3SXA A;  1WVC A;  1VIC A;  4G3P A;  3CKO A;  1FR9 A;  1LZI A;  1H7F A;  2VSI A;  2YQC A;  3Q4S A;  4KC4 A;  4FRD A;  2Y4J A;  4J18 A;  2BO8 A;  2AGD A;  2FFU A;  4M28 A;  1MP4 A;  2V0K A;  4CJB A;  5C1L A;  5C3B A;  1ON8 A;  2OEF A;  2GGQ A;  2WE9 A;  1EYR A;  2VD4 A;  1WT3 A;  3E25 A;  1YP4 A;  4O6M A;  2AES A;  1YP2 A;  3IOH A;  5C4F A;  3I0F A;  4AAW A;  1ZJO A;  2RIZ A;  2WVM A;  3CGX A;  2RIT A;  1H5S D;  2VS4 A;  1WSZ A;  2VXL A;  3E26 A;  3I0H A;  2BO7 A;  1XHB A;  1JVD A;  5CQO A;  3U0X A;  1O7Q A;  4KT7 A;  4FRO A;  4NAL A;  3SX8 A;  1ZI1 A;  4Y7V A;  4Y64 A;  3SXG A;  1V83 A;  1W57 A;  4K6R A;  2XME A; 
#chains in the Genus database with same CATH homology
 2O1H A;  4NAI A;  1S4O A;  4DE7 A;  3U2T A;  3LW6 A;  2D7I A;  1QGQ A;  1LL0 A;  1ZJ2 A;  5CMH A;  4B2W A;  4FRB A;  4KPX A;  5C38 A;  2FY7 A;  1K4V A;  1VGT A;  3F1C A;  3V0Q A;  3JUK A;  5C47 A;  3HL3 A;  3OH3 A;  3SX3 A;  1H3M A;  1W55 A;  3OGZ A;  4LW6 A;  3DUV A;  4XWI A;  2XWN A;  3OC9 A;  2Y4L A;  2I5E A;  1ZIZ A;  2AM4 A;  1VZX A;  2ZU9 A;  2DPW A;  2JCO A;  3JTJ A;  3OH0 A;  4Y7T A;  1NWG B;  2OEG A;  2QH5 A;  3U2W A;  4KC1 A;  4HO3 A;  3PKP A;  5CMJ A;  4D11 C;  2PGY A;  4B2X A;  2V0I A;  1NKH B;  5EJ1 A;  4BMA A;  2WGZ A;  3R2W A;  3CKN A;  4ASY A;  2AM5 A;  1OMZ A;  4IRP A;  4Y7U A;  2JCK A;  1FG5 N;  2RJ1 A;  1O23 B;  4ZDQ A;  3F1Y A;  4P02 A;  1XZ6 A;  2BO6 A;  3CKV A;  2VS3 A;  1JVG A;  3U2X A;  1NHE B;  1FO8 A;  1G8O A;  3IOI A;  1H7T A;  3OH4 A;  4EE5 A;  1G2V A;  4MND A;  4D48 A;  4AYL A;  3OAM A;  1ON6 A;  1ZHJ A;  5C1G A;  4JD0 A;  1R7U A;  4EVW A;  3I0C A;  2O1G A;  5IDS A;  5J49 A;  4HO6 A;  1H7H A;  3PNN A;  4YS8 A;  4G87 A;  2O1F A;  1VGU A;  2YQJ A;  1G95 A;  3NGW A;  4CVH A;  2OI5 A;  4D0T A;  1ZI5 A;  1VH3 A;  4FRQ A;  1JV3 A;  1S4N A;  3T7O A;  4ARW A;  1FZW A;  2AH9 A;  1H5S C;  3OKR A;  3I0I X;  1ZJ3 A;  4KRV A;  1JV1 A;  3SPT A;  4HO4 A;  3K8D A;  3V0P A;  4Y7F A;  2FYC B;  1H7L A;  1ZCT A;  1FGG A;  4MYB A;  5CQP A;  2RJ6 A;  1OMX A;  3N9W A;  3FWW A;  4D11 A;  1HJL A;  5HS2 A;  2A8W A;  4NAN A;  4Y63 A;  2PA4 A;  1LVW A;  1HM0 A;  5EJZ A;  1GX0 A;  1ZI3 A;  1E5K A;  4HG6 A;  3Q7U A;  1H7G A;  2JCJ A;  3ZGF A;  2Y6P A;  3CU0 A;  1G93 A;  5C36 A;  4HO9 A;  2ICX A;  2ZU8 A;  5D91 A;  4LW3 A;  4Y6N A;  1NQI B;  2RJ9 A;  5CQN X;  1IIM A;  1FR8 A;  3V0O A;  1VGZ A;  5FUH A;  2FYD B;  4B4B A;  1ZCV A;  3T7N A;  3ZGG A;  2V0J A;  1H4E A;  1HM8 A;  5CMI A;  4EEM A;  3ZF8 A;  2P72 A;  1TW5 A;  3OH2 A;  2OI7 A;  1G1L A;  2I5K A;  1MP5 A;  1ZDG A;  3RSB A;  4HOC A;  3DJ4 A;  1ZJ1 A;  1S4P A;  2FYA A;  4FIX A;  3SXC A;  1R7X A;  3U2U A;  2AE7 A;  2YC5 A;  1H5S A;  2XWL A;  2X60 A;  2Y4M A;  3I0L A;  3IOJ A;  4R7P A;  3V90 A;  3V91 A;  4C2S A;  2WVL A;  3I0G A;  1G3L A;  5FU8 A;  1O0R A;  1MC3 A;  1R7Y A;  1TVY A;  5AJO A;  3V0N A;  5C49 A;  4Y7G A;  1ZCY A;  2XWM A;  1H5T A;  5CMF X;  3POL A;  1FRW A;  4FCE A;  1SS9 A;  5BXC A;  4Y6U A;  4MIX A;  4EEO A;  1JYL A;  2OI6 A;  2ZU7 A;  4EEA A;  1Z90 A;  4BQH A;  4IRQ A;  3K8E A;  2YQH A;  2Z87 A;  1ZCU A;  4NAK A;  5D92 A;  2YQS A;  3ZLK A;  1WT0 A;  5L6S A;  2VFZ A;  2VS5 A;  4B4M A;  3SX7 A;  4B42 A;  3DK5 A;  5I1F A;  4FRA A;  5FTV A;  1MP3 A;  3JUJ A;  2XMH A;  3TQD A;  3KIA A;  3BRK X;  1H5R A;  1H7Q A;  1INJ A;  1WT2 A;  4EEG A;  1LZ7 A;  1V82 A;  3ZLL A;  1GQ9 A;  1FXJ A;  1G23 A;  2WAW A;  3D8V A;  3U2V A;  2FFV A;  2Q4J A;  4HO2 A;  2GGO A;  1GA8 A;  3D98 A;  1O7O A;  3I0K A;  5CMG X;  5FTS A;  1GX4 A;  2D7R A;  2YC3 A;  2E8B A;  1FO9 A;  1H7E A;  5C3D A;  2Y7A A;  4G3Q A;  4UEG A;  4B4G A;  4DDZ A;  3FOQ A;  1FOA A;  2P6W A;  3PKQ A;  1OQM B;  2MZB A;  1W77 A;  2RJ8 A;  2X65 A;  1FXO A;  3QVB A;  2ICY A;  1KWS A;  2RIY A;  5C4E A;  5C48 A;  2WVK A;  3I0E A;  4ECM A;  1VM8 A;  2V0L A;  3I0D A;  4M4K A;  3TZT A;  2Y4K A;  2WEE A;  4GBP A;  2X5S A;  1NF5 B;  4HO5 A;  1FWY A;  2AEC A;  4G3S A;  4HO8 A;  5C3A A;  1LL2 A;  2I7B A;  3I0J A;  4DEC A;  1HJJ A;  1R81 A;  2RJ7 A;  5C8R A;  5L6V A;  5DDV A;  2QKX A;  1VGW A;  3CKJ A;  5AJP A;  3CKQ A;  4CJC A;  1YP3 A;  1IIN A;  1GQC A;  4FRM A;  3OH1 A;  3GUE A;  1NMM B;  5DDT A;  1HV9 A;  3SXD A;  1VZU A;  4FRL A;  1TW1 A;  2D0J A;  1QG8 A;  4ASJ A;  1HM9 A;  3V0L A;  3Q80 A;  4M2B A;  3RMV A;  1H5S B;  1GWV A;  2AM3 A;  1G0R A;  2PGV A;  1ZJ0 A;  1VH1 A;  3SXB A;  2UX8 A;  4HO0 A;  2CU2 A;  4FRE A;  4AYJ A;  1QWJ A;  1H5T B;  1ZI4 A;  4Y62 A;  1ZJP A;  4KXO A;  5FV9 A;  1QGS A;  4D0Z A;  1FGX A;  1R80 A;  2JCL A;  4FCU A;  5C4B A;  1JYK A;  1I52 A;  4HCQ A;  2J0B A;  4P00 A;  3V8Y A;  4L41 C;  5IFY A;  5FYE A;  4M2A A;  5CQM X;  5CQL X;  1R7V A;  2E3D A;  1GWW A;  2RJ5 A;  5AJN A;  4E1K A;  3U0Y A;  4JIS A;  1PZT A;  1LZ0 A;  1R82 A;  4EE3 A;  1INI A;  1R7T A;  2VSH A;  4B5B A;  5JQQ A;  2RJ0 A;  1G97 A;  2C0N A;  4FRP A;  4Q7C A;  1H5R B;  1H4C A;  3EE5 A;  1G9R A;  2PX7 A;  2YCM A;  2V0H A;  3USR A;  3D5N A;  2Z86 A;  2A8U A;  4FRH A;  4CJ8 A;  2APC A;  3SX5 A;  1V84 A;  1LL3 A;  3R3I A;  4KQL A;  5EIY A;  2X5Z A;  1EZI A;  4KPZ A;  1TZF A;  2FYB A;  2RIX A;  1WT1 A;  1H4D A;  1YRO B;  2VXM A;  3V8Z A;  1ZDF A;  3USQ A;  2NXV A;  3SXE A;  4FQW A;  5C1H A;  4Y9X A;  3T7M A;  3O3P A;  5IDT A;  5C4D A;  3ST8 A;  2BO4 A;  2RJ4 A;  1PZY B;  3BCV A;  3RMW A;  1VPA A;  4KNR A;  1VZT A;  4B3U A;  3V0M A;  2QGI A;  4FIY A;  2YES A;  2VK9 A;  2W0W A;  2P73 A;  2W0V A;  5FU0 A;  1LZJ A;  4EE4 A;  2J0A A;  4O6N A;  4AC3 A;  4KNX A;  4KC2 A;  5C4C A;  3SXA A;  1WVC A;  1VIC A;  4G3P A;  3CKO A;  1FR9 A;  1LZI A;  1H7F A;  2VSI A;  2YQC A;  3Q4S A;  4KC4 A;  4FRD A;  2Y4J A;  4J18 A;  2BO8 A;  2AGD A;  2FFU A;  4M28 A;  1MP4 A;  2V0K A;  4CJB A;  5C1L A;  5C3B A;  1ON8 A;  2OEF A;  2GGQ A;  2WE9 A;  1EYR A;  2VD4 A;  1WT3 A;  3E25 A;  1YP4 A;  4O6M A;  2AES A;  1YP2 A;  3IOH A;  5C4F A;  3I0F A;  4AAW A;  1ZJO A;  2RIZ A;  2WVM A;  3CGX A;  2RIT A;  1H5S D;  2VS4 A;  1WSZ A;  2VXL A;  3E26 A;  3I0H A;  2BO7 A;  1XHB A;  1JVD A;  5CQO A;  3U0X A;  1O7Q A;  4KT7 A;  4FRO A;  4NAL A;  3SX8 A;  1ZI1 A;  4Y7V A;  4Y64 A;  3SXG A;  1V83 A;  1W57 A;  4K6R A;  2XME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...