5C1GA

Crystal structure of abba + udp + di
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
292
structure length
291
Chain Sequence
GEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 291
sequence length 292
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c1gA00
4Y63A 2FYCB 3JUJA 3DK5A 5IFYA 1OMZA 4K6RA 3I0EA 5I1FA 5C36A 5CMGX 1V82A 2P6WA 1TW5A 3V0QA 1JYKA 2FYDB 1LL3A 1FR8A 4HO4A 4NAKA 5FTVA 1INIA 4KQLA 1H7LA 2YQHA 2RJ4A 5FYEA 4EVWA 3K8EA 4MNDA 2O1FA 4CJCA 1LZJA 1FOAA 4DE7A 2RIZA 3IOJA 5C1GA 5FU0A 4FRAA 4DECA 1WVCA 5CMHA 1WT0A 5C4EA 2X5SA 1FO9A 4B2XA 4KC4A 1FZWA 1H7FA 1JV1A 1ZJ2A 2YC5A 1VH3A 1R7XA 2NXVA 1TZFA 2WVKA 1Z90A 4EEMA 4D0ZA 2WAWA 1VGTA 1GX4A 1S4OA 3ZGFA 4AYJA 2QKXA 1YP4A 3FWWA 1QG8A 3CGXA 3V8YA 4ECMA 5L6VA 2VS4A 3ST8A 3IOIA 4P02A 4B4GA 5FU8A 5JQQA 5CQOA 3RMWA 2YQSA 2A8WA 1HJJA 1I52A 4Y6UA 4BQHA 1ZJ0A 5IDTA 2OI5A 3SXEA 3V0OA 2FFVA 4HO9A 3CU0A 1VGUA 3Q80A 2VFZA 1O0RA 4D11A 5L6SA 2V0LA 1LZ0A 3I0HA 1LVWA 2XWLA 1EZIA 1H7GA 1R7YA 4R7PA 3QVBA 5CQNX 1ZI4A 4B4MA 1ZDFA 4J18A 3R2WA 2YQCA 2RJ8A 1YROB 1MP3A 3V8ZA 4IRPA 4XWIA 1R80A 3K8DA 5AJOA 3F1YA 2GGQA 3JTJA 4B3UA 3ZLKA 3D5NA 5FTSA 4AC3A 3CKQA 1OQMB 1O7OA 4ASJA 5FUHA 4EE3A 3BRKX 3LW6A 1KWSA 1H5SC 4HO0A 1H5RA 4LW6A 5AJNA 4CJ8A 5C38A 2Z86A 3U2XA 3RSBA 5CMFX 1FXOA 3OH0A 4G3QA 4LW3A 1VM8A 2AESA 4Y7TA 1IINA 4D48A 3T7MA 4M2AA 1NF5B 1G9RA 1INJA 2VXMA 2RJ1A 3PKQA 4ZDQA 3TQDA 3T7OA 2VXLA 4FRLA 1JYLA 1K4VA 4HO5A 1QGQA 2RJ0A 5C47A 2Y4JA 1JV3A 4FCEA 2AECA 2DPWA 3D8VA 2Z87A 3NGWA 2X65A 3OKRA 2YC3A 5C4CA 4EEGA 4Y7GA 1ON8A 3SX8A 4GBPA 3R3IA 2RITA 4KC1A 3V0PA 4D0TA 3Q7UA 2RIYA 3I0DA 4FRDA 5CMJA 2VSIA 1XZ6A 2OEFA 4EEOA 1S4NA 2O1HA 4JD0A 5EIYA 4FROA 4B4BA 4AYLA 1VH1A 1VGZA 2BO7A 5C3AA 3SPTA 2E8BA 1H4EA 1NMMB 1FRWA 4Y62A 4Y7VA 4HCQA 2P72A 1ZHJA 2XMHA 1NHEB 1H5TA 1WT1A 5IDSA 3I0KA 4FRMA 4KPZA 2P73A 2RJ5A 4UEGA 3SX3A 1G95A 1ZI1A 4Y64A 2I5EA 2VD4A 4FQWA 2D7RA 4NAIA 2BO4A 2A8UA 4G3PA 3SXCA 3HL3A 2D0JA 4CVHA 3OH3A 4M4KA 1GWVA 1G97A 2AM3A 3V0NA 2ICYA 1ZJPA 2Y4KA 3O3PA 4FCUA 4M28A 5C4FA 1FG5N 3GUEA 4B42A 4FREA 3I0LA 1VZTA 2PX7A 3TZTA 3D98A 1XHBA 3OH4A 4G87A 3U0YA 4FRPA 4KNRA 5CQLX 2V0KA 2YCMA 1YP3A 3E26A 2AE7A 1G3LA 3FOQA 3I0JA 3CKJA 1NWGB 3U0XA 1W57A 4NALA 1H7TA 1O7QA 5HS2A 1ZCYA 2RJ7A 1QWJA 5BXCA 1FWYA 1LZIA 1OMXA 1R7TA 2JCJA 2CU2A 4Y7FA 4JISA 1GQ9A 1WT2A 5EJ1A 1TVYA 3KIAA 1FGXA 1HM8A 1R7UA 3OH2A 5DDTA 2V0IA 2PGYA 4HOCA 4KXOA 3SXGA 4D11C 1ZJOA 1ZI5A 1O23B 1VZXA 2APCA 1HM9A 4M2BA 4ASYA 4KC2A 4L41C 2BO6A 4YS8A 2FYBA 1MP5A 2XWNA 1H5SB 4KPXA 3V90A 1H4DA 1MC3A 1R81A 1VICA 2MZBA 5CQPA 3U2TA 1G2VA 2QGIA 4KNXA 3SX5A 1V84A 2W0VA 2AM5A 3I0GA 4HO6A 3IOHA 4HG6A 2ZU7A 1FO8A 1WSZA 4DDZA 1WT3A 3U2UA 1LL2A 4AAWA 1G93A 1IIMA 1GWWA 2W0WA 3E25A 2OI7A 2ZU9A 2UX8A 3USRA 4HO8A 1NQIB 3SXBA 2WVMA 1JVGA 2Y4LA 3SX7A 1H7QA 1JVDA 1ON6A 1QGSA 3USQA 1HJLA 3F1CA 2I7BA 4BMAA 3CKVA 4E1KA 1GA8A 1GQCA 4Y9XA 3RMVA 5C49A 1H5RB 4EE4A 5C3DA 1GX0A 5EJZA 5C1HA 3DJ4A 5J49A 1H7EA 3SXAA 5DDVA 4Y6NA 1HM0A 1VPAA 3PKPA 3ZGGA 1PZYB 1ZCUA 1ZI3A 3V91A 3JUKA 1HV9A 1ZCVA 4FRQA 3T7NA 3I0FA 2AH9A 2PGVA 5AJPA 2FFUA 2WE9A 3EE5A 2ICXA 1E5KA 3PNNA 4KRVA 2YQJA 3I0IX 1H4CA 1ZJ3A 1V83A 3V0LA 1R82A 2E3DA 1VGWA 2D7IA 2V0JA 2Y7AA 1H7HA 4FRHA 4HO2A 1W77A 4G3SA 2I5KA 5C8RA 4ARWA 4HO3A 3BCVA 3OGZA 1NKHB 3SXDA 1YP2A 1ZDGA 1MP4A 5C4DA 4IRQA 3V0MA 1FGGA 1FR9A 5FV9A 3I0CA 1ZJ1A 2RIXA 5C3BA 2X5ZA 1VZUA 2OI6A 1G23A 4C2SA 1TW1A 1FXJA 1H5SA 1H5TB 1W55A 2AGDA 4P00A 3OAMA 2VS5A 2Q4JA 5CQMX 1G8OA 1EYRA 2O1GA 5CMIA 5C48A 2WVLA 3POLA 1H5SD 3OH1A 1SS9A 4NANA 4B5BA 3ZLLA 2VSHA 2VS3A 2JCKA 3CKOA 1R7VA 1G1LA 1S4PA 5C1LA 2WEEA 3DUVA 2JCOA 2XWMA 2QH5A 4Y7UA 5C4BA 2YESA 2XMEA 2ZU8A 4FRBA 2Y4MA 1G0RA 1LZ7A 4KT7A 2RJ6A 2RJ9A 4MYBA 2V0HA 1ZIZA 3ZF8A 1ZCTA 2GGOA 2Y6PA 4EE5A 2X60A 4EEAA 2FYAA 3CKNA 3OC9A 3U2WA 2PA4A 1PZTA 2JCLA 1LL0A 2OEGA 2BO8A 2FY7A 2WGZA 3N9WA 3Q4SA 2AM4A 4B2WA 3U2VA 1H3MA 4CJBA
chains in the Genus database with same CATH superfamily
4Y63A 2FYCB 3JUJA 3DK5A 5IFYA 1OMZA 4K6RA 3I0EA 5I1FA 5C36A 5CMGX 1V82A 2P6WA 1TW5A 3V0QA 1JYKA 2FYDB 1LL3A 1FR8A 4HO4A 4NAKA 5FTVA 1INIA 4KQLA 1H7LA 2YQHA 2RJ4A 5FYEA 4EVWA 3K8EA 4MNDA 2O1FA 4CJCA 1LZJA 1FOAA 4MIXA 4DE7A 2RIZA 3IOJA 5C1GA 5FU0A 4FRAA 4DECA 1WVCA 5CMHA 1WT0A 5C4EA 2X5SA 2J0BA 1FO9A 4B2XA 4KC4A 1FZWA 1H7FA 1JV1A 1ZJ2A 2YC5A 1VH3A 1R7XA 2NXVA 1TZFA 2WVKA 1Z90A 4EEMA 4D0ZA 2WAWA 1VGTA 1GX4A 1S4OA 3ZGFA 4AYJA 2QKXA 1YP4A 3FWWA 1QG8A 3CGXA 3V8YA 4O6MA 4ECMA 5L6VA 2VS4A 3ST8A 3IOIA 5D91A 4P02A 4B4GA 4FIYA 5FU8A 5JQQA 5CQOA 3RMWA 2YQSA 2A8WA 1HJJA 1I52A 4Y6UA 4BQHA 1ZJ0A 5IDTA 2OI5A 3SXEA 3V0OA 2FFVA 4HO9A 3CU0A 1VGUA 3Q80A 2VFZA 1O0RA 4D11A 5L6SA 2V0LA 1LZ0A 3I0HA 1LVWA 2XWLA 1EZIA 1H7GA 1R7YA 4R7PA 3QVBA 5CQNX 1ZI4A 4B4MA 1ZDFA 4J18A 3R2WA 2YQCA 2RJ8A 1YROB 1MP3A 3V8ZA 4IRPA 4XWIA 1R80A 3K8DA 5AJOA 3F1YA 2GGQA 3JTJA 4B3UA 3ZLKA 3D5NA 5FTSA 4O6NA 4AC3A 3CKQA 1OQMB 1O7OA 4ASJA 5FUHA 4EE3A 3BRKX 3LW6A 1KWSA 1H5SC 4HO0A 1H5RA 4LW6A 5AJNA 4CJ8A 5C38A 2Z86A 3U2XA 3RSBA 5CMFX 1FXOA 3OH0A 4G3QA 4LW3A 1VM8A 2AESA 4Y7TA 1IINA 4D48A 3T7MA 4M2AA 1NF5B 1G9RA 1INJA 2VXMA 2RJ1A 3PKQA 4ZDQA 3TQDA 3T7OA 2VXLA 4FRLA 1JYLA 1K4VA 4HO5A 1QGQA 2RJ0A 5C47A 2C0NA 2Y4JA 1JV3A 4FCEA 2AECA 5D92A 2DPWA 3D8VA 2Z87A 3NGWA 2X65A 3OKRA 2YC3A 5C4CA 4EEGA 4Y7GA 1ON8A 3SX8A 4GBPA 3R3IA 2RITA 4KC1A 3V0PA 4D0TA 3Q7UA 2RIYA 3I0DA 4FRDA 5CMJA 2VSIA 1XZ6A 2OEFA 4EEOA 1S4NA 2O1HA 4JD0A 5EIYA 4FROA 4B4BA 4AYLA 1VH1A 1VGZA 2BO7A 5C3AA 3SPTA 2E8BA 1H4EA 1NMMB 1FRWA 4Y62A 4Y7VA 4HCQA 2P72A 1ZHJA 2XMHA 1NHEB 1H5TA 1WT1A 5IDSA 3I0KA 4FRMA 4KPZA 2P73A 2RJ5A 4UEGA 3SX3A 1G95A 1ZI1A 4Y64A 2I5EA 2VD4A 4FQWA 2D7RA 4NAIA 2BO4A 2A8UA 4G3PA 3SXCA 3HL3A 2D0JA 4CVHA 3OH3A 4M4KA 1GWVA 1G97A 2AM3A 3V0NA 2ICYA 1ZJPA 2Y4KA 3O3PA 4FCUA 4M28A 5C4FA 1FG5N 3GUEA 4B42A 4FREA 3I0LA 1VZTA 2PX7A 3TZTA 3D98A 1XHBA 3OH4A 4G87A 3U0YA 4FRPA 4KNRA 5CQLX 2V0KA 2YCMA 1YP3A 3E26A 2AE7A 1G3LA 3FOQA 3I0JA 3CKJA 1NWGB 4FIXA 3U0XA 4Q7CA 1W57A 4NALA 1H7TA 1O7QA 5HS2A 1ZCYA 2RJ7A 1QWJA 5BXCA 1FWYA 1LZIA 1OMXA 1R7TA 2JCJA 2CU2A 4Y7FA 4JISA 2VK9A 1GQ9A 1WT2A 5EJ1A 1TVYA 3KIAA 1FGXA 1HM8A 1R7UA 3OH2A 5DDTA 2V0IA 2PGYA 4HOCA 4KXOA 3SXGA 4D11C 1ZJOA 1ZI5A 1O23B 1VZXA 2APCA 1HM9A 4M2BA 4ASYA 4KC2A 4L41C 2BO6A 4YS8A 2FYBA 1MP5A 2XWNA 1H5SB 4KPXA 3V90A 1H4DA 1MC3A 1R81A 1VICA 2MZBA 5CQPA 3U2TA 1G2VA 2QGIA 4KNXA 3SX5A 1V84A 2W0VA 2AM5A 3I0GA 4HO6A 3IOHA 4HG6A 2ZU7A 1FO8A 1WSZA 4DDZA 1WT3A 3U2UA 1LL2A 4AAWA 1G93A 1IIMA 1GWWA 2W0WA 3E25A 2OI7A 2ZU9A 2UX8A 3USRA 4HO8A 1NQIB 3SXBA 2WVMA 1JVGA 2Y4LA 3SX7A 1H7QA 1JVDA 1ON6A 1QGSA 3USQA 1HJLA 3F1CA 2I7BA 4BMAA 3CKVA 4E1KA 1GA8A 1GQCA 4Y9XA 3RMVA 5C49A 1H5RB 4EE4A 5C3DA 1GX0A 5EJZA 5C1HA 3DJ4A 5J49A 1H7EA 3SXAA 5DDVA 4Y6NA 1HM0A 1VPAA 3PKPA 3ZGGA 1PZYB 1ZCUA 1ZI3A 3V91A 3JUKA 1HV9A 1ZCVA 4FRQA 3T7NA 3I0FA 2AH9A 2PGVA 5AJPA 2FFUA 2WE9A 3EE5A 2ICXA 1E5KA 3PNNA 4KRVA 2YQJA 3I0IX 1H4CA 1ZJ3A 1V83A 3V0LA 1R82A 2E3DA 1VGWA 2D7IA 2V0JA 2Y7AA 1H7HA 4FRHA 4HO2A 1W77A 4G3SA 2I5KA 5C8RA 4ARWA 4HO3A 3BCVA 3OGZA 1NKHB 3SXDA 1YP2A 1ZDGA 1MP4A 5C4DA 4IRQA 3V0MA 1FGGA 1FR9A 5FV9A 3I0CA 1ZJ1A 2RIXA 5C3BA 2X5ZA 1VZUA 2OI6A 1G23A 4C2SA 1TW1A 1FXJA 1H5SA 1H5TB 1W55A 2AGDA 4P00A 3OAMA 2VS5A 2Q4JA 5CQMX 1G8OA 1EYRA 2O1GA 5CMIA 5C48A 2WVLA 3POLA 1H5SD 3OH1A 1SS9A 4NANA 4B5BA 3ZLLA 2VSHA 2VS3A 2JCKA 3CKOA 1R7VA 1G1LA 1S4PA 5C1LA 2WEEA 3DUVA 2JCOA 2XWMA 2QH5A 4Y7UA 5C4BA 2YESA 2XMEA 2ZU8A 4FRBA 2Y4MA 1G0RA 1LZ7A 4KT7A 2RJ6A 2RJ9A 2J0AA 4MYBA 2V0HA 1ZIZA 3ZF8A 1ZCTA 2GGOA 2Y6PA 4EE5A 2X60A 4EEAA 2FYAA 3CKNA 3OC9A 3U2WA 2PA4A 1PZTA 2JCLA 1LL0A 2OEGA 2BO8A 2FY7A 2WGZA 3N9WA 3Q4SA 2AM4A 4B2WA 3U2VA 1H3MA 4CJBA
chains in the Genus database with same CATH topology
4Y63A 2FYCB 3JUJA 3DK5A 5IFYA 1OMZA 4K6RA 3I0EA 5I1FA 5C36A 5CMGX 1V82A 2P6WA 1TW5A 3V0QA 1JYKA 2FYDB 1LL3A 1FR8A 4HO4A 4NAKA 5FTVA 1INIA 4KQLA 1H7LA 2YQHA 2RJ4A 5FYEA 4EVWA 3K8EA 4MNDA 2O1FA 4CJCA 1LZJA 1FOAA 4MIXA 4DE7A 2RIZA 3IOJA 5C1GA 5FU0A 4FRAA 4DECA 1WVCA 5CMHA 1WT0A 5C4EA 2X5SA 2J0BA 1FO9A 4B2XA 4KC4A 1FZWA 1H7FA 1JV1A 1ZJ2A 2YC5A 1VH3A 1R7XA 2NXVA 1TZFA 2WVKA 1Z90A 4EEMA 4D0ZA 2WAWA 1VGTA 1GX4A 1S4OA 3ZGFA 4AYJA 2QKXA 1YP4A 3FWWA 1QG8A 3CGXA 3V8YA 4O6MA 4ECMA 5L6VA 2VS4A 3ST8A 3IOIA 5D91A 4P02A 4B4GA 4FIYA 5FU8A 5JQQA 5CQOA 3RMWA 2YQSA 2A8WA 1HJJA 1I52A 4Y6UA 4BQHA 1ZJ0A 5IDTA 2OI5A 3SXEA 3V0OA 2FFVA 4HO9A 3CU0A 1VGUA 3Q80A 2VFZA 1O0RA 4D11A 5L6SA 2V0LA 1LZ0A 3I0HA 1LVWA 2XWLA 1EZIA 1H7GA 1R7YA 4R7PA 3QVBA 5CQNX 1ZI4A 4B4MA 1ZDFA 4J18A 3R2WA 2YQCA 2RJ8A 1YROB 1MP3A 3V8ZA 4IRPA 4XWIA 1R80A 3K8DA 5AJOA 3F1YA 2GGQA 3JTJA 4B3UA 3ZLKA 3D5NA 5FTSA 4O6NA 4AC3A 3CKQA 1OQMB 1O7OA 4ASJA 5FUHA 4EE3A 3BRKX 3LW6A 1KWSA 1H5SC 4HO0A 1H5RA 4LW6A 5AJNA 4CJ8A 5C38A 2Z86A 3U2XA 3RSBA 5CMFX 1FXOA 3OH0A 4G3QA 4LW3A 1VM8A 2AESA 4Y7TA 1IINA 4D48A 3T7MA 4M2AA 1NF5B 1G9RA 1INJA 2VXMA 2RJ1A 3PKQA 4ZDQA 3TQDA 3T7OA 2VXLA 4FRLA 1JYLA 1K4VA 4HO5A 1QGQA 2RJ0A 5C47A 2C0NA 2Y4JA 1JV3A 4FCEA 2AECA 5D92A 2DPWA 3D8VA 2Z87A 3NGWA 2X65A 3OKRA 2YC3A 5C4CA 4EEGA 4Y7GA 1ON8A 3SX8A 4GBPA 3R3IA 2RITA 4KC1A 3V0PA 4D0TA 3Q7UA 2RIYA 3I0DA 4FRDA 5CMJA 2VSIA 1XZ6A 2OEFA 4EEOA 1S4NA 2O1HA 4JD0A 5EIYA 4FROA 4B4BA 4AYLA 1VH1A 1VGZA 2BO7A 5C3AA 3SPTA 2E8BA 1H4EA 1NMMB 1FRWA 4Y62A 4Y7VA 4HCQA 2P72A 1ZHJA 2XMHA 1NHEB 1H5TA 1WT1A 5IDSA 3I0KA 4FRMA 4KPZA 2P73A 2RJ5A 4UEGA 3SX3A 1G95A 1ZI1A 4Y64A 2I5EA 2VD4A 4FQWA 2D7RA 4NAIA 2BO4A 2A8UA 4G3PA 3SXCA 3HL3A 2D0JA 4CVHA 3OH3A 4M4KA 1GWVA 1G97A 2AM3A 3V0NA 2ICYA 1ZJPA 2Y4KA 3O3PA 4FCUA 4M28A 5C4FA 1FG5N 3GUEA 4B42A 4FREA 3I0LA 1VZTA 2PX7A 3TZTA 3D98A 1XHBA 3OH4A 4G87A 3U0YA 4FRPA 4KNRA 5CQLX 2V0KA 2YCMA 1YP3A 3E26A 2AE7A 1G3LA 3FOQA 3I0JA 3CKJA 1NWGB 4FIXA 3U0XA 4Q7CA 1W57A 4NALA 1H7TA 1O7QA 5HS2A 1ZCYA 2RJ7A 1QWJA 5BXCA 1FWYA 1LZIA 1OMXA 1R7TA 2JCJA 2CU2A 4Y7FA 4JISA 2VK9A 1GQ9A 1WT2A 5EJ1A 1TVYA 3KIAA 1FGXA 1HM8A 1R7UA 3OH2A 5DDTA 2V0IA 2PGYA 4HOCA 4KXOA 3SXGA 4D11C 1ZJOA 1ZI5A 1O23B 1VZXA 2APCA 1HM9A 4M2BA 4ASYA 4KC2A 4L41C 2BO6A 4YS8A 2FYBA 1MP5A 2XWNA 1H5SB 4KPXA 3V90A 1H4DA 1MC3A 1R81A 1VICA 2MZBA 5CQPA 3U2TA 1G2VA 2QGIA 4KNXA 3SX5A 1V84A 2W0VA 2AM5A 3I0GA 4HO6A 3IOHA 4HG6A 2ZU7A 1FO8A 1WSZA 4DDZA 1WT3A 3U2UA 1LL2A 4AAWA 1G93A 1IIMA 1GWWA 2W0WA 3E25A 2OI7A 2ZU9A 2UX8A 3USRA 4HO8A 1NQIB 3SXBA 2WVMA 1JVGA 2Y4LA 3SX7A 1H7QA 1JVDA 1ON6A 1QGSA 3USQA 1HJLA 3F1CA 2I7BA 4BMAA 3CKVA 4E1KA 1GA8A 1GQCA 4Y9XA 3RMVA 5C49A 1H5RB 4EE4A 5C3DA 1GX0A 5EJZA 5C1HA 3DJ4A 5J49A 1H7EA 3SXAA 5DDVA 4Y6NA 1HM0A 1VPAA 3PKPA 3ZGGA 1PZYB 1ZCUA 1ZI3A 3V91A 3JUKA 1HV9A 1ZCVA 4FRQA 3T7NA 3I0FA 2AH9A 2PGVA 5AJPA 2FFUA 2WE9A 3EE5A 2ICXA 1E5KA 3PNNA 4KRVA 2YQJA 3I0IX 1H4CA 1ZJ3A 1V83A 3V0LA 1R82A 2E3DA 1VGWA 2D7IA 2V0JA 2Y7AA 1H7HA 4FRHA 4HO2A 1W77A 4G3SA 2I5KA 5C8RA 4ARWA 4HO3A 3BCVA 3OGZA 1NKHB 3SXDA 1YP2A 1ZDGA 1MP4A 5C4DA 4IRQA 3V0MA 1FGGA 1FR9A 5FV9A 3I0CA 1ZJ1A 2RIXA 5C3BA 2X5ZA 1VZUA 2OI6A 1G23A 4C2SA 1TW1A 1FXJA 1H5SA 1H5TB 1W55A 2AGDA 4P00A 3OAMA 2VS5A 2Q4JA 5CQMX 1G8OA 1EYRA 2O1GA 5CMIA 5C48A 2WVLA 3POLA 1H5SD 3OH1A 1SS9A 4NANA 4B5BA 3ZLLA 2VSHA 2VS3A 2JCKA 3CKOA 1R7VA 1G1LA 1S4PA 5C1LA 2WEEA 3DUVA 2JCOA 2XWMA 2QH5A 4Y7UA 5C4BA 2YESA 2XMEA 2ZU8A 4FRBA 2Y4MA 1G0RA 1LZ7A 4KT7A 2RJ6A 2RJ9A 2J0AA 4MYBA 2V0HA 1ZIZA 3ZF8A 1ZCTA 2GGOA 2Y6PA 4EE5A 2X60A 4EEAA 2FYAA 3CKNA 3OC9A 3U2WA 2PA4A 1PZTA 2JCLA 1LL0A 2OEGA 2BO8A 2FY7A 2WGZA 3N9WA 3Q4SA 2AM4A 4B2WA 3U2VA 1H3MA 4CJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y63 A;  2FYC B;  3JUJ A;  3DK5 A;  5IFY A;  1OMZ A;  4K6R A;  3I0E A;  5I1F A;  5C36 A;  5CMG X;  1V82 A;  2P6W A;  1TW5 A;  3V0Q A;  1JYK A;  2FYD B;  1LL3 A;  1FR8 A;  4HO4 A;  4NAK A;  5FTV A;  1INI A;  4KQL A;  1H7L A;  2YQH A;  2RJ4 A;  5FYE A;  4EVW A;  3K8E A;  4MND A;  2O1F A;  4CJC A;  1LZJ A;  1FOA A;  4DE7 A;  2RIZ A;  3IOJ A;  5C1G A;  5FU0 A;  4FRA A;  4DEC A;  1WVC A;  5CMH A;  1WT0 A;  5C4E A;  2X5S A;  1FO9 A;  4B2X A;  4KC4 A;  1FZW A;  1H7F A;  1JV1 A;  1ZJ2 A;  2YC5 A;  1VH3 A;  1R7X A;  2NXV A;  1TZF A;  2WVK A;  1Z90 A;  4EEM A;  4D0Z A;  2WAW A;  1VGT A;  1GX4 A;  1S4O A;  3ZGF A;  4AYJ A;  2QKX A;  1YP4 A;  3FWW A;  1QG8 A;  3CGX A;  3V8Y A;  4ECM A;  5L6V A;  2VS4 A;  3ST8 A;  3IOI A;  4P02 A;  4B4G A;  5FU8 A;  5JQQ A;  5CQO A;  3RMW A;  2YQS A;  2A8W A;  1HJJ A;  1I52 A;  4Y6U A;  4BQH A;  1ZJ0 A;  5IDT A;  2OI5 A;  3SXE A;  3V0O A;  2FFV A;  4HO9 A;  3CU0 A;  1VGU A;  3Q80 A;  2VFZ A;  1O0R A;  4D11 A;  5L6S A;  2V0L A;  1LZ0 A;  3I0H A;  1LVW A;  2XWL A;  1EZI A;  1H7G A;  1R7Y A;  4R7P A;  3QVB A;  5CQN X;  1ZI4 A;  4B4M A;  1ZDF A;  4J18 A;  3R2W A;  2YQC A;  2RJ8 A;  1YRO B;  1MP3 A;  3V8Z A;  4IRP A;  4XWI A;  1R80 A;  3K8D A;  5AJO A;  3F1Y A;  2GGQ A;  3JTJ A;  4B3U A;  3ZLK A;  3D5N A;  5FTS A;  4AC3 A;  3CKQ A;  1OQM B;  1O7O A;  4ASJ A;  5FUH A;  4EE3 A;  3BRK X;  3LW6 A;  1KWS A;  1H5S C;  4HO0 A;  1H5R A;  4LW6 A;  5AJN A;  4CJ8 A;  5C38 A;  2Z86 A;  3U2X A;  3RSB A;  5CMF X;  1FXO A;  3OH0 A;  4G3Q A;  4LW3 A;  1VM8 A;  2AES A;  4Y7T A;  1IIN A;  4D48 A;  3T7M A;  4M2A A;  1NF5 B;  1G9R A;  1INJ A;  2VXM A;  2RJ1 A;  3PKQ A;  4ZDQ A;  3TQD A;  3T7O A;  2VXL A;  4FRL A;  1JYL A;  1K4V A;  4HO5 A;  1QGQ A;  2RJ0 A;  5C47 A;  2Y4J A;  1JV3 A;  4FCE A;  2AEC A;  2DPW A;  3D8V A;  2Z87 A;  3NGW A;  2X65 A;  3OKR A;  2YC3 A;  5C4C A;  4EEG A;  4Y7G A;  1ON8 A;  3SX8 A;  4GBP A;  3R3I A;  2RIT A;  4KC1 A;  3V0P A;  4D0T A;  3Q7U A;  2RIY A;  3I0D A;  4FRD A;  5CMJ A;  2VSI A;  1XZ6 A;  2OEF A;  4EEO A;  1S4N A;  2O1H A;  4JD0 A;  5EIY A;  4FRO A;  4B4B A;  4AYL A;  1VH1 A;  1VGZ A;  2BO7 A;  5C3A A;  3SPT A;  2E8B A;  1H4E A;  1NMM B;  1FRW A;  4Y62 A;  4Y7V A;  4HCQ A;  2P72 A;  1ZHJ A;  2XMH A;  1NHE B;  1H5T A;  1WT1 A;  5IDS A;  3I0K A;  4FRM A;  4KPZ A;  2P73 A;  2RJ5 A;  4UEG A;  3SX3 A;  1G95 A;  1ZI1 A;  4Y64 A;  2I5E A;  2VD4 A;  4FQW A;  2D7R A;  4NAI A;  2BO4 A;  2A8U A;  4G3P A;  3SXC A;  3HL3 A;  2D0J A;  4CVH A;  3OH3 A;  4M4K A;  1GWV A;  1G97 A;  2AM3 A;  3V0N A;  2ICY A;  1ZJP A;  2Y4K A;  3O3P A;  4FCU A;  4M28 A;  5C4F A;  1FG5 N;  3GUE A;  4B42 A;  4FRE A;  3I0L A;  1VZT A;  2PX7 A;  3TZT A;  3D98 A;  1XHB A;  3OH4 A;  4G87 A;  3U0Y A;  4FRP A;  4KNR A;  5CQL X;  2V0K A;  2YCM A;  1YP3 A;  3E26 A;  2AE7 A;  1G3L A;  3FOQ A;  3I0J A;  3CKJ A;  1NWG B;  3U0X A;  1W57 A;  4NAL A;  1H7T A;  1O7Q A;  5HS2 A;  1ZCY A;  2RJ7 A;  1QWJ A;  5BXC A;  1FWY A;  1LZI A;  1OMX A;  1R7T A;  2JCJ A;  2CU2 A;  4Y7F A;  4JIS A;  1GQ9 A;  1WT2 A;  5EJ1 A;  1TVY A;  3KIA A;  1FGX A;  1HM8 A;  1R7U A;  3OH2 A;  5DDT A;  2V0I A;  2PGY A;  4HOC A;  4KXO A;  3SXG A;  4D11 C;  1ZJO A;  1ZI5 A;  1O23 B;  1VZX A;  2APC A;  1HM9 A;  4M2B A;  4ASY A;  4KC2 A;  4L41 C;  2BO6 A;  4YS8 A;  2FYB A;  1MP5 A;  2XWN A;  1H5S B;  4KPX A;  3V90 A;  1H4D A;  1MC3 A;  1R81 A;  1VIC A;  2MZB A;  5CQP A;  3U2T A;  1G2V A;  2QGI A;  4KNX A;  3SX5 A;  1V84 A;  2W0V A;  2AM5 A;  3I0G A;  4HO6 A;  3IOH A;  4HG6 A;  2ZU7 A;  1FO8 A;  1WSZ A;  4DDZ A;  1WT3 A;  3U2U A;  1LL2 A;  4AAW A;  1G93 A;  1IIM A;  1GWW A;  2W0W A;  3E25 A;  2OI7 A;  2ZU9 A;  2UX8 A;  3USR A;  4HO8 A;  1NQI B;  3SXB A;  2WVM A;  1JVG A;  2Y4L A;  3SX7 A;  1H7Q A;  1JVD A;  1ON6 A;  1QGS A;  3USQ A;  1HJL A;  3F1C A;  2I7B A;  4BMA A;  3CKV A;  4E1K A;  1GA8 A;  1GQC A;  4Y9X A;  3RMV A;  5C49 A;  1H5R B;  4EE4 A;  5C3D A;  1GX0 A;  5EJZ A;  5C1H A;  3DJ4 A;  5J49 A;  1H7E A;  3SXA A;  5DDV A;  4Y6N A;  1HM0 A;  1VPA A;  3PKP A;  3ZGG A;  1PZY B;  1ZCU A;  1ZI3 A;  3V91 A;  3JUK A;  1HV9 A;  1ZCV A;  4FRQ A;  3T7N A;  3I0F A;  2AH9 A;  2PGV A;  5AJP A;  2FFU A;  2WE9 A;  3EE5 A;  2ICX A;  1E5K A;  3PNN A;  4KRV A;  2YQJ A;  3I0I X;  1H4C A;  1ZJ3 A;  1V83 A;  3V0L A;  1R82 A;  2E3D A;  1VGW A;  2D7I A;  2V0J A;  2Y7A A;  1H7H A;  4FRH A;  4HO2 A;  1W77 A;  4G3S A;  2I5K A;  5C8R A;  4ARW A;  4HO3 A;  3BCV A;  3OGZ A;  1NKH B;  3SXD A;  1YP2 A;  1ZDG A;  1MP4 A;  5C4D A;  4IRQ A;  3V0M A;  1FGG A;  1FR9 A;  5FV9 A;  3I0C A;  1ZJ1 A;  2RIX A;  5C3B A;  2X5Z A;  1VZU A;  2OI6 A;  1G23 A;  4C2S A;  1TW1 A;  1FXJ A;  1H5S A;  1H5T B;  1W55 A;  2AGD A;  4P00 A;  3OAM A;  2VS5 A;  2Q4J A;  5CQM X;  1G8O A;  1EYR A;  2O1G A;  5CMI A;  5C48 A;  2WVL A;  3POL A;  1H5S D;  3OH1 A;  1SS9 A;  4NAN A;  4B5B A;  3ZLL A;  2VSH A;  2VS3 A;  2JCK A;  3CKO A;  1R7V A;  1G1L A;  1S4P A;  5C1L A;  2WEE A;  3DUV A;  2JCO A;  2XWM A;  2QH5 A;  4Y7U A;  5C4B A;  2YES A;  2XME A;  2ZU8 A;  4FRB A;  2Y4M A;  1G0R A;  1LZ7 A;  4KT7 A;  2RJ6 A;  2RJ9 A;  4MYB A;  2V0H A;  1ZIZ A;  3ZF8 A;  1ZCT A;  2GGO A;  2Y6P A;  4EE5 A;  2X60 A;  4EEA A;  2FYA A;  3CKN A;  3OC9 A;  3U2W A;  2PA4 A;  1PZT A;  2JCL A;  1LL0 A;  2OEG A;  2BO8 A;  2FY7 A;  2WGZ A;  3N9W A;  3Q4S A;  2AM4 A;  4B2W A;  3U2V A;  1H3M A;  4CJB A; 
#chains in the Genus database with same CATH topology
 4Y63 A;  2FYC B;  3JUJ A;  3DK5 A;  5IFY A;  1OMZ A;  4K6R A;  3I0E A;  5I1F A;  5C36 A;  5CMG X;  1V82 A;  2P6W A;  1TW5 A;  3V0Q A;  1JYK A;  2FYD B;  1LL3 A;  1FR8 A;  4HO4 A;  4NAK A;  5FTV A;  1INI A;  4KQL A;  1H7L A;  2YQH A;  2RJ4 A;  5FYE A;  4EVW A;  3K8E A;  4MND A;  2O1F A;  4CJC A;  1LZJ A;  1FOA A;  4MIX A;  4DE7 A;  2RIZ A;  3IOJ A;  5C1G A;  5FU0 A;  4FRA A;  4DEC A;  1WVC A;  5CMH A;  1WT0 A;  5C4E A;  2X5S A;  2J0B A;  1FO9 A;  4B2X A;  4KC4 A;  1FZW A;  1H7F A;  1JV1 A;  1ZJ2 A;  2YC5 A;  1VH3 A;  1R7X A;  2NXV A;  1TZF A;  2WVK A;  1Z90 A;  4EEM A;  4D0Z A;  2WAW A;  1VGT A;  1GX4 A;  1S4O A;  3ZGF A;  4AYJ A;  2QKX A;  1YP4 A;  3FWW A;  1QG8 A;  3CGX A;  3V8Y A;  4O6M A;  4ECM A;  5L6V A;  2VS4 A;  3ST8 A;  3IOI A;  5D91 A;  4P02 A;  4B4G A;  4FIY A;  5FU8 A;  5JQQ A;  5CQO A;  3RMW A;  2YQS A;  2A8W A;  1HJJ A;  1I52 A;  4Y6U A;  4BQH A;  1ZJ0 A;  5IDT A;  2OI5 A;  3SXE A;  3V0O A;  2FFV A;  4HO9 A;  3CU0 A;  1VGU A;  3Q80 A;  2VFZ A;  1O0R A;  4D11 A;  5L6S A;  2V0L A;  1LZ0 A;  3I0H A;  1LVW A;  2XWL A;  1EZI A;  1H7G A;  1R7Y A;  4R7P A;  3QVB A;  5CQN X;  1ZI4 A;  4B4M A;  1ZDF A;  4J18 A;  3R2W A;  2YQC A;  2RJ8 A;  1YRO B;  1MP3 A;  3V8Z A;  4IRP A;  4XWI A;  1R80 A;  3K8D A;  5AJO A;  3F1Y A;  2GGQ A;  3JTJ A;  4B3U A;  3ZLK A;  3D5N A;  5FTS A;  4O6N A;  4AC3 A;  3CKQ A;  1OQM B;  1O7O A;  4ASJ A;  5FUH A;  4EE3 A;  3BRK X;  3LW6 A;  1KWS A;  1H5S C;  4HO0 A;  1H5R A;  4LW6 A;  5AJN A;  4CJ8 A;  5C38 A;  2Z86 A;  3U2X A;  3RSB A;  5CMF X;  1FXO A;  3OH0 A;  4G3Q A;  4LW3 A;  1VM8 A;  2AES A;  4Y7T A;  1IIN A;  4D48 A;  3T7M A;  4M2A A;  1NF5 B;  1G9R A;  1INJ A;  2VXM A;  2RJ1 A;  3PKQ A;  4ZDQ A;  3TQD A;  3T7O A;  2VXL A;  4FRL A;  1JYL A;  1K4V A;  4HO5 A;  1QGQ A;  2RJ0 A;  5C47 A;  2C0N A;  2Y4J A;  1JV3 A;  4FCE A;  2AEC A;  5D92 A;  2DPW A;  3D8V A;  2Z87 A;  3NGW A;  2X65 A;  3OKR A;  2YC3 A;  5C4C A;  4EEG A;  4Y7G A;  1ON8 A;  3SX8 A;  4GBP A;  3R3I A;  2RIT A;  4KC1 A;  3V0P A;  4D0T A;  3Q7U A;  2RIY A;  3I0D A;  4FRD A;  5CMJ A;  2VSI A;  1XZ6 A;  2OEF A;  4EEO A;  1S4N A;  2O1H A;  4JD0 A;  5EIY A;  4FRO A;  4B4B A;  4AYL A;  1VH1 A;  1VGZ A;  2BO7 A;  5C3A A;  3SPT A;  2E8B A;  1H4E A;  1NMM B;  1FRW A;  4Y62 A;  4Y7V A;  4HCQ A;  2P72 A;  1ZHJ A;  2XMH A;  1NHE B;  1H5T A;  1WT1 A;  5IDS A;  3I0K A;  4FRM A;  4KPZ A;  2P73 A;  2RJ5 A;  4UEG A;  3SX3 A;  1G95 A;  1ZI1 A;  4Y64 A;  2I5E A;  2VD4 A;  4FQW A;  2D7R A;  4NAI A;  2BO4 A;  2A8U A;  4G3P A;  3SXC A;  3HL3 A;  2D0J A;  4CVH A;  3OH3 A;  4M4K A;  1GWV A;  1G97 A;  2AM3 A;  3V0N A;  2ICY A;  1ZJP A;  2Y4K A;  3O3P A;  4FCU A;  4M28 A;  5C4F A;  1FG5 N;  3GUE A;  4B42 A;  4FRE A;  3I0L A;  1VZT A;  2PX7 A;  3TZT A;  3D98 A;  1XHB A;  3OH4 A;  4G87 A;  3U0Y A;  4FRP A;  4KNR A;  5CQL X;  2V0K A;  2YCM A;  1YP3 A;  3E26 A;  2AE7 A;  1G3L A;  3FOQ A;  3I0J A;  3CKJ A;  1NWG B;  4FIX A;  3U0X A;  4Q7C A;  1W57 A;  4NAL A;  1H7T A;  1O7Q A;  5HS2 A;  1ZCY A;  2RJ7 A;  1QWJ A;  5BXC A;  1FWY A;  1LZI A;  1OMX A;  1R7T A;  2JCJ A;  2CU2 A;  4Y7F A;  4JIS A;  2VK9 A;  1GQ9 A;  1WT2 A;  5EJ1 A;  1TVY A;  3KIA A;  1FGX A;  1HM8 A;  1R7U A;  3OH2 A;  5DDT A;  2V0I A;  2PGY A;  4HOC A;  4KXO A;  3SXG A;  4D11 C;  1ZJO A;  1ZI5 A;  1O23 B;  1VZX A;  2APC A;  1HM9 A;  4M2B A;  4ASY A;  4KC2 A;  4L41 C;  2BO6 A;  4YS8 A;  2FYB A;  1MP5 A;  2XWN A;  1H5S B;  4KPX A;  3V90 A;  1H4D A;  1MC3 A;  1R81 A;  1VIC A;  2MZB A;  5CQP A;  3U2T A;  1G2V A;  2QGI A;  4KNX A;  3SX5 A;  1V84 A;  2W0V A;  2AM5 A;  3I0G A;  4HO6 A;  3IOH A;  4HG6 A;  2ZU7 A;  1FO8 A;  1WSZ A;  4DDZ A;  1WT3 A;  3U2U A;  1LL2 A;  4AAW A;  1G93 A;  1IIM A;  1GWW A;  2W0W A;  3E25 A;  2OI7 A;  2ZU9 A;  2UX8 A;  3USR A;  4HO8 A;  1NQI B;  3SXB A;  2WVM A;  1JVG A;  2Y4L A;  3SX7 A;  1H7Q A;  1JVD A;  1ON6 A;  1QGS A;  3USQ A;  1HJL A;  3F1C A;  2I7B A;  4BMA A;  3CKV A;  4E1K A;  1GA8 A;  1GQC A;  4Y9X A;  3RMV A;  5C49 A;  1H5R B;  4EE4 A;  5C3D A;  1GX0 A;  5EJZ A;  5C1H A;  3DJ4 A;  5J49 A;  1H7E A;  3SXA A;  5DDV A;  4Y6N A;  1HM0 A;  1VPA A;  3PKP A;  3ZGG A;  1PZY B;  1ZCU A;  1ZI3 A;  3V91 A;  3JUK A;  1HV9 A;  1ZCV A;  4FRQ A;  3T7N A;  3I0F A;  2AH9 A;  2PGV A;  5AJP A;  2FFU A;  2WE9 A;  3EE5 A;  2ICX A;  1E5K A;  3PNN A;  4KRV A;  2YQJ A;  3I0I X;  1H4C A;  1ZJ3 A;  1V83 A;  3V0L A;  1R82 A;  2E3D A;  1VGW A;  2D7I A;  2V0J A;  2Y7A A;  1H7H A;  4FRH A;  4HO2 A;  1W77 A;  4G3S A;  2I5K A;  5C8R A;  4ARW A;  4HO3 A;  3BCV A;  3OGZ A;  1NKH B;  3SXD A;  1YP2 A;  1ZDG A;  1MP4 A;  5C4D A;  4IRQ A;  3V0M A;  1FGG A;  1FR9 A;  5FV9 A;  3I0C A;  1ZJ1 A;  2RIX A;  5C3B A;  2X5Z A;  1VZU A;  2OI6 A;  1G23 A;  4C2S A;  1TW1 A;  1FXJ A;  1H5S A;  1H5T B;  1W55 A;  2AGD A;  4P00 A;  3OAM A;  2VS5 A;  2Q4J A;  5CQM X;  1G8O A;  1EYR A;  2O1G A;  5CMI A;  5C48 A;  2WVL A;  3POL A;  1H5S D;  3OH1 A;  1SS9 A;  4NAN A;  4B5B A;  3ZLL A;  2VSH A;  2VS3 A;  2JCK A;  3CKO A;  1R7V A;  1G1L A;  1S4P A;  5C1L A;  2WEE A;  3DUV A;  2JCO A;  2XWM A;  2QH5 A;  4Y7U A;  5C4B A;  2YES A;  2XME A;  2ZU8 A;  4FRB A;  2Y4M A;  1G0R A;  1LZ7 A;  4KT7 A;  2RJ6 A;  2RJ9 A;  2J0A A;  4MYB A;  2V0H A;  1ZIZ A;  3ZF8 A;  1ZCT A;  2GGO A;  2Y6P A;  4EE5 A;  2X60 A;  4EEA A;  2FYA A;  3CKN A;  3OC9 A;  3U2W A;  2PA4 A;  1PZT A;  2JCL A;  1LL0 A;  2OEG A;  2BO8 A;  2FY7 A;  2WGZ A;  3N9W A;  3Q4S A;  2AM4 A;  4B2W A;  3U2V A;  1H3M A;  4CJB A; 
#chains in the Genus database with same CATH homology
 4Y63 A;  2FYC B;  3JUJ A;  3DK5 A;  5IFY A;  1OMZ A;  4K6R A;  3I0E A;  5I1F A;  5C36 A;  5CMG X;  1V82 A;  2P6W A;  1TW5 A;  3V0Q A;  1JYK A;  2FYD B;  1LL3 A;  1FR8 A;  4HO4 A;  4NAK A;  5FTV A;  1INI A;  4KQL A;  1H7L A;  2YQH A;  2RJ4 A;  5FYE A;  4EVW A;  3K8E A;  4MND A;  2O1F A;  4CJC A;  1LZJ A;  1FOA A;  4MIX A;  4DE7 A;  2RIZ A;  3IOJ A;  5C1G A;  5FU0 A;  4FRA A;  4DEC A;  1WVC A;  5CMH A;  1WT0 A;  5C4E A;  2X5S A;  2J0B A;  1FO9 A;  4B2X A;  4KC4 A;  1FZW A;  1H7F A;  1JV1 A;  1ZJ2 A;  2YC5 A;  1VH3 A;  1R7X A;  2NXV A;  1TZF A;  2WVK A;  1Z90 A;  4EEM A;  4D0Z A;  2WAW A;  1VGT A;  1GX4 A;  1S4O A;  3ZGF A;  4AYJ A;  2QKX A;  1YP4 A;  3FWW A;  1QG8 A;  3CGX A;  3V8Y A;  4O6M A;  4ECM A;  5L6V A;  2VS4 A;  3ST8 A;  3IOI A;  5D91 A;  4P02 A;  4B4G A;  4FIY A;  5FU8 A;  5JQQ A;  5CQO A;  3RMW A;  2YQS A;  2A8W A;  1HJJ A;  1I52 A;  4Y6U A;  4BQH A;  1ZJ0 A;  5IDT A;  2OI5 A;  3SXE A;  3V0O A;  2FFV A;  4HO9 A;  3CU0 A;  1VGU A;  3Q80 A;  2VFZ A;  1O0R A;  4D11 A;  5L6S A;  2V0L A;  1LZ0 A;  3I0H A;  1LVW A;  2XWL A;  1EZI A;  1H7G A;  1R7Y A;  4R7P A;  3QVB A;  5CQN X;  1ZI4 A;  4B4M A;  1ZDF A;  4J18 A;  3R2W A;  2YQC A;  2RJ8 A;  1YRO B;  1MP3 A;  3V8Z A;  4IRP A;  4XWI A;  1R80 A;  3K8D A;  5AJO A;  3F1Y A;  2GGQ A;  3JTJ A;  4B3U A;  3ZLK A;  3D5N A;  5FTS A;  4O6N A;  4AC3 A;  3CKQ A;  1OQM B;  1O7O A;  4ASJ A;  5FUH A;  4EE3 A;  3BRK X;  3LW6 A;  1KWS A;  1H5S C;  4HO0 A;  1H5R A;  4LW6 A;  5AJN A;  4CJ8 A;  5C38 A;  2Z86 A;  3U2X A;  3RSB A;  5CMF X;  1FXO A;  3OH0 A;  4G3Q A;  4LW3 A;  1VM8 A;  2AES A;  4Y7T A;  1IIN A;  4D48 A;  3T7M A;  4M2A A;  1NF5 B;  1G9R A;  1INJ A;  2VXM A;  2RJ1 A;  3PKQ A;  4ZDQ A;  3TQD A;  3T7O A;  2VXL A;  4FRL A;  1JYL A;  1K4V A;  4HO5 A;  1QGQ A;  2RJ0 A;  5C47 A;  2C0N A;  2Y4J A;  1JV3 A;  4FCE A;  2AEC A;  5D92 A;  2DPW A;  3D8V A;  2Z87 A;  3NGW A;  2X65 A;  3OKR A;  2YC3 A;  5C4C A;  4EEG A;  4Y7G A;  1ON8 A;  3SX8 A;  4GBP A;  3R3I A;  2RIT A;  4KC1 A;  3V0P A;  4D0T A;  3Q7U A;  2RIY A;  3I0D A;  4FRD A;  5CMJ A;  2VSI A;  1XZ6 A;  2OEF A;  4EEO A;  1S4N A;  2O1H A;  4JD0 A;  5EIY A;  4FRO A;  4B4B A;  4AYL A;  1VH1 A;  1VGZ A;  2BO7 A;  5C3A A;  3SPT A;  2E8B A;  1H4E A;  1NMM B;  1FRW A;  4Y62 A;  4Y7V A;  4HCQ A;  2P72 A;  1ZHJ A;  2XMH A;  1NHE B;  1H5T A;  1WT1 A;  5IDS A;  3I0K A;  4FRM A;  4KPZ A;  2P73 A;  2RJ5 A;  4UEG A;  3SX3 A;  1G95 A;  1ZI1 A;  4Y64 A;  2I5E A;  2VD4 A;  4FQW A;  2D7R A;  4NAI A;  2BO4 A;  2A8U A;  4G3P A;  3SXC A;  3HL3 A;  2D0J A;  4CVH A;  3OH3 A;  4M4K A;  1GWV A;  1G97 A;  2AM3 A;  3V0N A;  2ICY A;  1ZJP A;  2Y4K A;  3O3P A;  4FCU A;  4M28 A;  5C4F A;  1FG5 N;  3GUE A;  4B42 A;  4FRE A;  3I0L A;  1VZT A;  2PX7 A;  3TZT A;  3D98 A;  1XHB A;  3OH4 A;  4G87 A;  3U0Y A;  4FRP A;  4KNR A;  5CQL X;  2V0K A;  2YCM A;  1YP3 A;  3E26 A;  2AE7 A;  1G3L A;  3FOQ A;  3I0J A;  3CKJ A;  1NWG B;  4FIX A;  3U0X A;  4Q7C A;  1W57 A;  4NAL A;  1H7T A;  1O7Q A;  5HS2 A;  1ZCY A;  2RJ7 A;  1QWJ A;  5BXC A;  1FWY A;  1LZI A;  1OMX A;  1R7T A;  2JCJ A;  2CU2 A;  4Y7F A;  4JIS A;  2VK9 A;  1GQ9 A;  1WT2 A;  5EJ1 A;  1TVY A;  3KIA A;  1FGX A;  1HM8 A;  1R7U A;  3OH2 A;  5DDT A;  2V0I A;  2PGY A;  4HOC A;  4KXO A;  3SXG A;  4D11 C;  1ZJO A;  1ZI5 A;  1O23 B;  1VZX A;  2APC A;  1HM9 A;  4M2B A;  4ASY A;  4KC2 A;  4L41 C;  2BO6 A;  4YS8 A;  2FYB A;  1MP5 A;  2XWN A;  1H5S B;  4KPX A;  3V90 A;  1H4D A;  1MC3 A;  1R81 A;  1VIC A;  2MZB A;  5CQP A;  3U2T A;  1G2V A;  2QGI A;  4KNX A;  3SX5 A;  1V84 A;  2W0V A;  2AM5 A;  3I0G A;  4HO6 A;  3IOH A;  4HG6 A;  2ZU7 A;  1FO8 A;  1WSZ A;  4DDZ A;  1WT3 A;  3U2U A;  1LL2 A;  4AAW A;  1G93 A;  1IIM A;  1GWW A;  2W0W A;  3E25 A;  2OI7 A;  2ZU9 A;  2UX8 A;  3USR A;  4HO8 A;  1NQI B;  3SXB A;  2WVM A;  1JVG A;  2Y4L A;  3SX7 A;  1H7Q A;  1JVD A;  1ON6 A;  1QGS A;  3USQ A;  1HJL A;  3F1C A;  2I7B A;  4BMA A;  3CKV A;  4E1K A;  1GA8 A;  1GQC A;  4Y9X A;  3RMV A;  5C49 A;  1H5R B;  4EE4 A;  5C3D A;  1GX0 A;  5EJZ A;  5C1H A;  3DJ4 A;  5J49 A;  1H7E A;  3SXA A;  5DDV A;  4Y6N A;  1HM0 A;  1VPA A;  3PKP A;  3ZGG A;  1PZY B;  1ZCU A;  1ZI3 A;  3V91 A;  3JUK A;  1HV9 A;  1ZCV A;  4FRQ A;  3T7N A;  3I0F A;  2AH9 A;  2PGV A;  5AJP A;  2FFU A;  2WE9 A;  3EE5 A;  2ICX A;  1E5K A;  3PNN A;  4KRV A;  2YQJ A;  3I0I X;  1H4C A;  1ZJ3 A;  1V83 A;  3V0L A;  1R82 A;  2E3D A;  1VGW A;  2D7I A;  2V0J A;  2Y7A A;  1H7H A;  4FRH A;  4HO2 A;  1W77 A;  4G3S A;  2I5K A;  5C8R A;  4ARW A;  4HO3 A;  3BCV A;  3OGZ A;  1NKH B;  3SXD A;  1YP2 A;  1ZDG A;  1MP4 A;  5C4D A;  4IRQ A;  3V0M A;  1FGG A;  1FR9 A;  5FV9 A;  3I0C A;  1ZJ1 A;  2RIX A;  5C3B A;  2X5Z A;  1VZU A;  2OI6 A;  1G23 A;  4C2S A;  1TW1 A;  1FXJ A;  1H5S A;  1H5T B;  1W55 A;  2AGD A;  4P00 A;  3OAM A;  2VS5 A;  2Q4J A;  5CQM X;  1G8O A;  1EYR A;  2O1G A;  5CMI A;  5C48 A;  2WVL A;  3POL A;  1H5S D;  3OH1 A;  1SS9 A;  4NAN A;  4B5B A;  3ZLL A;  2VSH A;  2VS3 A;  2JCK A;  3CKO A;  1R7V A;  1G1L A;  1S4P A;  5C1L A;  2WEE A;  3DUV A;  2JCO A;  2XWM A;  2QH5 A;  4Y7U A;  5C4B A;  2YES A;  2XME A;  2ZU8 A;  4FRB A;  2Y4M A;  1G0R A;  1LZ7 A;  4KT7 A;  2RJ6 A;  2RJ9 A;  2J0A A;  4MYB A;  2V0H A;  1ZIZ A;  3ZF8 A;  1ZCT A;  2GGO A;  2Y6P A;  4EE5 A;  2X60 A;  4EEA A;  2FYA A;  3CKN A;  3OC9 A;  3U2W A;  2PA4 A;  1PZT A;  2JCL A;  1LL0 A;  2OEG A;  2BO8 A;  2FY7 A;  2WGZ A;  3N9W A;  3Q4S A;  2AM4 A;  4B2W A;  3U2V A;  1H3M A;  4CJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...