1G93A

Crystal structure of the bovine catalytic domain of alpha-1,3-galactosyltransferase in the presence of udp-galactose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
277
structure length
277
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Bovine alpha1,3-galactosyltransferase catalytic domain structure and its relationship with ABO histo-blood group and glycosphingolipid glycosyltransferases.
pubmed doi rcsb
source organism Bos taurus
total genus 100
structure length 277
sequence length 277
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2000-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g93A00
2VXLA 4EEOA 3CGXA 2XMEA 1PZYB 1WT1A 3V0QA 2XWLA 1VH3A 2I7BA 2RITA 5C49A 5BXCA 4EE4A 4KPXA 4UEGA 1VGTA 2I5KA 5CQPA 4Y7TA 1LL2A 3E26A 2AM5A 4BMAA 1R81A 3N9WA 1GWWA 3CKQA 2A8UA 4KNXA 4EE5A 3OKRA 1TZFA 4J18A 1NMMB 2XWMA 1ZHJA 1ZI3A 4EE3A 2W0VA 4AC3A 3V0NA 3U0XA 1H7HA 1ZCYA 3GUEA 3V8YA 4CJ8A 3BRKX 3OH0A 4HG6A 1MC3A 3IOHA 3U2TA 4G87A 1VGZA 2XWNA 1MP5A 3OH2A 4DDZA 3JUKA 1GX4A 4M2AA 2X65A 2MZBA 4EVWA 1WT0A 3EE5A 1INIA 1EZIA 1GQCA 3ST8A 3DK5A 5FV9A 3D5NA 3SXAA 5CMFX 5JQQA 3JUJA 1G2VA 4M2BA 5C4BA 1ON6A 4FRDA 1H7GA 4M4KA 5J49A 4D0ZA 1WT2A 1OMXA 2ZU9A 4ASJA 2V0IA 2GGOA 1JYLA 1TVYA 1ZDGA 3SXBA 2WVLA 2YQCA 3HL3A 4Y64A 3V90A 3V0LA 5IFYA 2QH5A 5FTSA 3U2UA 3R3IA 1GX0A 3T7NA 1H4EA 1FGGA 3FWWA 4KPZA 3SXCA 4EEMA 5HS2A 1H7QA 1E5KA 2WGZA 4R7PA 5CMJA 1VGUA 1LL0A 5C8RA 3I0KA 1G23A 4B2WA 2AM4A 1H4CA 4FCEA 4C2SA 1K4VA 1ZJ2A 2X5SA 3I0FA 2PX7A 5C1LA 1WT3A 1Z90A 4E1KA 3OH4A 1VZTA 2W0WA 4Y6NA 1VGWA 1XZ6A 3CKVA 1EYRA 2ZU7A 3DUVA 3I0EA 2OEGA 2PGVA 1ZJ0A 2RJ4A 2RJ8A 4Y9XA 4YS8A 1ON8A 4JISA 1V82A 3SXEA 1VH1A 2NXVA 2Y4LA 2WVKA 3OGZA 2E8BA 4GBPA 4B2XA 3ZF8A 2FY7A 2D7IA 1FRWA 4Y7UA 2FYAA 3E25A 4KRVA 2P73A 3ZLLA 2FYCB 5FUHA 2ZU8A 4FQWA 4AYJA 1PZTA 1H7FA 3D98A 3NGWA 4Y63A 3I0IX 3K8EA 2VD4A 1OQMB 5C3BA 2X60A 2O1FA 3CKNA 1H7LA 1ZJ1A 1ZDFA 1R82A 4D48A 1MP4A 2YQSA 2RJ7A 3T7MA 1IINA 3ZLKA 1QWJA 3SX3A 2AECA 1TW5A 2JCLA 1ZJ3A 2Y6PA 1H7TA 3TQDA 4IRQA 2ICXA 3SX5A 1FWYA 1H5SD 3CKJA 1YP3A 2GGQA 2RJ5A 2P72A 5AJPA 1ZI1A 3PKPA 4NAKA 5CQLX 4FRMA 4EEGA 4CJCA 5C38A 1HM9A 2VXMA 4CVHA 3I0GA 1WVCA 1S4NA 4HO2A 1ZJPA 2Y4MA 1G8OA 2QKXA 5C4FA 2Y4KA 2Z87A 1FR8A 1VPAA 5CMGX 5EJ1A 1LZ7A 2YQHA 1R7XA 3T7OA 3V0MA 2CU2A 1S4OA 1YP4A 1YP2A 2VS5A 4B5BA 2JCJA 3OC9A 5C48A 4FRAA 3RMWA 1LZ0A 3OH3A 1FO9A 4KC1A 4ASYA 1FG5N 1INJA 2AM3A 1JVGA 4B42A 1ZCTA 4HO8A 1O23B 4B3UA 4HO0A 1JVDA 2WEEA 5DDTA 5FU8A 5C4DA 5L6VA 5IDTA 2OI6A 1NWGB 3I0DA 1LZJA 4DECA 3R2WA 4Y6UA 1JV3A 2OI5A 1JYKA 4XWIA 2YC5A 5FU0A 2AGDA 2I5EA 1I52A 3ZGGA 3V0OA 1R80A 5C4CA 1G95A 3ZGFA 2QGIA 1ZJOA 2A8WA 3JTJA 2FFUA 4HO3A 2RJ6A 3LW6A 1R7UA 2PA4A 1S4PA 3SX7A 4HO4A 4IRPA 3SXGA 1GA8A 2V0JA 1VM8A 4P00A 1H5TB 5DDVA 2YESA 2YC3A 3FOQA 4HO5A 4M28A 3USRA 1H5SB 3F1CA 1G97A 1W77A 1R7VA 1NF5B 5AJOA 2AH9A 3PKQA 4AAWA 1LL3A 1FZWA 2YCMA 3I0CA 1QGQA 1TW1A 3IOJA 1G1LA 5C36A 4ECMA 1O0RA 1R7YA 1H5RB 5C3DA 4JD0A 1LVWA 4KXOA 2Z86A 3BCVA 1GWVA 3PNNA 3U2VA 5L6SA 2JCKA 1QG8A 4D0TA 2AESA 4NANA 1FXJA 1KWSA 4FRLA 2RIYA 2X5ZA 5AJNA 3U0YA 3TZTA 4KT7A 3F1YA 4LW3A 2VSHA 1VICA 5FYEA 4K6RA 4AYLA 2RJ0A 5C1GA 1R7TA 2WAWA 2VSIA 1G0RA 4HOCA 2PGYA 2BO7A 2VFZA 1ZIZA 2YQJA 4P02A 5C47A 5IDSA 1FOAA 1W57A 4KNRA 2OI7A 4Y7VA 5CQMX 1IIMA 3I0JA 3KIAA 1HV9A 2APCA 1FGXA 1NQIB 4G3SA 1V84A 3RSBA 4B4BA 1HM8A 1G93A 2D7RA 1FR9A 5C3AA 1H4DA 1NKHB 2RJ9A 3DJ4A 1XHBA 4G3PA 3I0HA 1FO8A 5EJZA 1O7OA 4EEAA 4B4GA 5CQNX 1G3LA 2JCOA 2BO6A 3V8ZA 1YROB 1HM0A 3QVBA 4ZDQA 1ZI4A 1MP3A 2V0KA 4HCQA 3IOIA 2Y7AA 2WE9A 1LZIA 3SPTA 3Q80A 2XMHA 4D11A 2FFVA 2WVMA 3CU0A 3OAMA 4HO6A 4KC4A 1H7EA 3SXDA 1OMZA 3Q4SA 2D0JA 4KQLA 5CMHA 2OEFA 1QGSA 2ICYA 5EIYA 1SS9A 3U2XA 2V0HA 5C4EA 1W55A 4CJBA 1H3MA 1HJLA 2VS4A 4NALA 2O1HA 4D11C 2Q4JA 3OH1A 4ARWA 2VS3A 5FTVA 1V83A 4FRHA 1ZI5A 2Y4JA 2P6WA 2RIXA 5C1HA 2UX8A 2FYDB 2AE7A 4G3QA 3USQA 4Y7FA 2RJ1A 1HJJA 1H5TA 3POLA 1O7QA 3Q7UA 1JV1A 3D8VA 4NAIA 3SX8A 3V91A 2DPWA 4HO9A 4MYBA 4DE7A 4L41C 4FCUA 1H5SA 4FRBA 2RIZA 4FRQA 4LW6A 3U2WA 3K8DA 1VZXA 1WSZA 4MNDA 4Y7GA 1NHEB 1GQ9A 2V0LA 4FRPA 4BQHA 2BO8A 3V0PA 4B4MA 5CMIA 1VZUA 5CQOA 2BO4A 1ZCUA 2E3DA 4FREA 4FROA 1H5RA 3RMVA 2FYBA 1ZCVA 4Y62A 4KC2A 5I1FA 3CKOA 3I0LA 1G9RA 1FXOA 3O3PA 1H5SC 2O1GA
chains in the Genus database with same CATH superfamily
2VXLA 4EEOA 3CGXA 2XMEA 1PZYB 1WT1A 3V0QA 2XWLA 1VH3A 2I7BA 2RITA 5C49A 5BXCA 4EE4A 4KPXA 4UEGA 1VGTA 2I5KA 5CQPA 4Y7TA 1LL2A 3E26A 2AM5A 4BMAA 1R81A 3N9WA 1GWWA 3CKQA 2A8UA 4KNXA 4EE5A 3OKRA 1TZFA 4J18A 1NMMB 2XWMA 1ZHJA 1ZI3A 4EE3A 4MIXA 2W0VA 4AC3A 3V0NA 3U0XA 1H7HA 1ZCYA 3GUEA 3V8YA 4CJ8A 3BRKX 3OH0A 4HG6A 1MC3A 3IOHA 3U2TA 4G87A 1VGZA 2XWNA 1MP5A 3OH2A 4O6MA 4DDZA 3JUKA 1GX4A 4M2AA 2X65A 2MZBA 4EVWA 1WT0A 3EE5A 1INIA 1EZIA 1GQCA 3ST8A 3DK5A 5FV9A 3D5NA 3SXAA 5CMFX 5JQQA 3JUJA 1G2VA 4M2BA 5C4BA 1ON6A 4FRDA 1H7GA 4M4KA 5J49A 5D92A 4D0ZA 1WT2A 1OMXA 2ZU9A 4ASJA 2V0IA 2GGOA 1JYLA 1TVYA 1ZDGA 3SXBA 2WVLA 2YQCA 3HL3A 4Y64A 3V90A 3V0LA 5IFYA 2QH5A 5FTSA 3U2UA 3R3IA 1GX0A 3T7NA 1H4EA 1FGGA 2C0NA 3FWWA 4KPZA 3SXCA 4EEMA 5HS2A 1H7QA 1E5KA 2WGZA 4R7PA 5CMJA 1VGUA 1LL0A 5C8RA 3I0KA 1G23A 4B2WA 2AM4A 1H4CA 4FCEA 4C2SA 1K4VA 1ZJ2A 2X5SA 3I0FA 2PX7A 5C1LA 1WT3A 1Z90A 4E1KA 3OH4A 1VZTA 2W0WA 4Y6NA 1VGWA 1XZ6A 3CKVA 1EYRA 2ZU7A 3DUVA 3I0EA 2OEGA 2PGVA 1ZJ0A 2RJ4A 2RJ8A 4Y9XA 4YS8A 1ON8A 4JISA 1V82A 3SXEA 1VH1A 2NXVA 2Y4LA 2WVKA 3OGZA 2E8BA 4GBPA 4B2XA 3ZF8A 2FY7A 2D7IA 1FRWA 4Y7UA 2FYAA 3E25A 4KRVA 2P73A 3ZLLA 2FYCB 5FUHA 2ZU8A 4FQWA 4AYJA 1PZTA 1H7FA 3D98A 3NGWA 4Y63A 3I0IX 3K8EA 2VD4A 1OQMB 5C3BA 2X60A 2O1FA 3CKNA 1H7LA 1ZJ1A 1ZDFA 4Q7CA 1R82A 4D48A 1MP4A 2YQSA 2RJ7A 3T7MA 1IINA 3ZLKA 1QWJA 3SX3A 2AECA 1TW5A 2J0BA 2JCLA 1ZJ3A 2Y6PA 1H7TA 3TQDA 4IRQA 2ICXA 3SX5A 1FWYA 1H5SD 3CKJA 1YP3A 2GGQA 2VK9A 2RJ5A 2P72A 5AJPA 1ZI1A 3PKPA 4NAKA 5CQLX 4FRMA 4EEGA 4CJCA 5C38A 1HM9A 2VXMA 4CVHA 3I0GA 1WVCA 1S4NA 4HO2A 1ZJPA 2Y4MA 1G8OA 2QKXA 5C4FA 2Y4KA 2Z87A 1FR8A 1VPAA 5CMGX 5EJ1A 1LZ7A 2YQHA 1R7XA 3T7OA 3V0MA 2CU2A 1S4OA 1YP4A 1YP2A 2VS5A 4B5BA 2JCJA 4FIYA 3OC9A 5C48A 4FRAA 3RMWA 1LZ0A 3OH3A 1FO9A 4KC1A 4ASYA 1FG5N 1INJA 2AM3A 1JVGA 4B42A 1ZCTA 4HO8A 1O23B 4B3UA 4HO0A 1JVDA 2WEEA 5DDTA 5FU8A 5C4DA 5L6VA 5IDTA 2OI6A 1NWGB 3I0DA 1LZJA 4DECA 3R2WA 4Y6UA 1JV3A 2OI5A 1JYKA 4XWIA 2YC5A 5FU0A 2AGDA 2I5EA 1I52A 3ZGGA 3V0OA 1R80A 5C4CA 1G95A 3ZGFA 2QGIA 1ZJOA 2A8WA 3JTJA 2FFUA 4HO3A 2RJ6A 3LW6A 1R7UA 2PA4A 1S4PA 4O6NA 3SX7A 4HO4A 4IRPA 3SXGA 1GA8A 2V0JA 1VM8A 4P00A 1H5TB 5DDVA 2YESA 2YC3A 3FOQA 4HO5A 4M28A 3USRA 1H5SB 3F1CA 1G97A 1W77A 1R7VA 1NF5B 5AJOA 2AH9A 3PKQA 4AAWA 1LL3A 1FZWA 2YCMA 3I0CA 1QGQA 1TW1A 3IOJA 1G1LA 5C36A 4ECMA 1O0RA 1R7YA 1H5RB 5C3DA 4JD0A 1LVWA 4KXOA 2Z86A 3BCVA 1GWVA 3PNNA 3U2VA 5L6SA 2JCKA 1QG8A 4D0TA 2AESA 4NANA 1FXJA 1KWSA 4FRLA 2RIYA 2X5ZA 5AJNA 3U0YA 3TZTA 4KT7A 3F1YA 4LW3A 2VSHA 1VICA 5FYEA 4K6RA 4AYLA 2RJ0A 5C1GA 1R7TA 2WAWA 2VSIA 1G0RA 4HOCA 2PGYA 2BO7A 2VFZA 1ZIZA 2YQJA 4P02A 5C47A 5IDSA 1FOAA 1W57A 4KNRA 2OI7A 4Y7VA 5CQMX 1IIMA 3I0JA 3KIAA 1HV9A 2APCA 1FGXA 1NQIB 4G3SA 1V84A 3RSBA 4B4BA 1HM8A 1G93A 2D7RA 1FR9A 4FIXA 5C3AA 1H4DA 1NKHB 2RJ9A 3DJ4A 1XHBA 4G3PA 3I0HA 1FO8A 5EJZA 1O7OA 4EEAA 4B4GA 5CQNX 1G3LA 2JCOA 2BO6A 3V8ZA 1YROB 1HM0A 3QVBA 4ZDQA 1ZI4A 1MP3A 2V0KA 4HCQA 3IOIA 2Y7AA 2WE9A 1LZIA 3SPTA 3Q80A 2XMHA 4D11A 2FFVA 2WVMA 3CU0A 3OAMA 4HO6A 4KC4A 1H7EA 3SXDA 1OMZA 3Q4SA 2D0JA 4KQLA 5CMHA 2OEFA 1QGSA 2ICYA 5EIYA 1SS9A 3U2XA 2V0HA 5C4EA 1W55A 4CJBA 1H3MA 1HJLA 2VS4A 4NALA 2O1HA 4D11C 2Q4JA 3OH1A 4ARWA 2VS3A 5FTVA 1V83A 4FRHA 1ZI5A 2Y4JA 2P6WA 2RIXA 5C1HA 2UX8A 2FYDB 2AE7A 4G3QA 3USQA 4Y7FA 2RJ1A 1HJJA 1H5TA 3POLA 1O7QA 3Q7UA 1JV1A 3D8VA 4NAIA 3SX8A 3V91A 2DPWA 4HO9A 4MYBA 4DE7A 4L41C 4FCUA 1H5SA 4FRBA 2RIZA 4FRQA 4LW6A 3U2WA 3K8DA 1VZXA 1WSZA 5D91A 4MNDA 4Y7GA 1NHEB 1GQ9A 2V0LA 4FRPA 4BQHA 2BO8A 3V0PA 4B4MA 5CMIA 1VZUA 2J0AA 5CQOA 2BO4A 1ZCUA 2E3DA 4FREA 4FROA 1H5RA 3RMVA 2FYBA 1ZCVA 4Y62A 4KC2A 5I1FA 3CKOA 3I0LA 1G9RA 1FXOA 3O3PA 1H5SC 2O1GA
chains in the Genus database with same CATH topology
2VXLA 4EEOA 3CGXA 2XMEA 1PZYB 1WT1A 3V0QA 2XWLA 1VH3A 2I7BA 2RITA 5C49A 5BXCA 4EE4A 4KPXA 4UEGA 1VGTA 2I5KA 5CQPA 4Y7TA 1LL2A 3E26A 2AM5A 4BMAA 1R81A 3N9WA 1GWWA 3CKQA 2A8UA 4KNXA 4EE5A 3OKRA 1TZFA 4J18A 1NMMB 2XWMA 1ZHJA 1ZI3A 4EE3A 4MIXA 2W0VA 4AC3A 3V0NA 3U0XA 1H7HA 1ZCYA 3GUEA 3V8YA 4CJ8A 3BRKX 3OH0A 4HG6A 1MC3A 3IOHA 3U2TA 4G87A 1VGZA 2XWNA 1MP5A 3OH2A 4O6MA 4DDZA 3JUKA 1GX4A 4M2AA 2X65A 2MZBA 4EVWA 1WT0A 3EE5A 1INIA 1EZIA 1GQCA 3ST8A 3DK5A 5FV9A 3D5NA 3SXAA 5CMFX 5JQQA 3JUJA 1G2VA 4M2BA 5C4BA 1ON6A 4FRDA 1H7GA 4M4KA 5J49A 5D92A 4D0ZA 1WT2A 1OMXA 2ZU9A 4ASJA 2V0IA 2GGOA 1JYLA 1TVYA 1ZDGA 3SXBA 2WVLA 2YQCA 3HL3A 4Y64A 3V90A 3V0LA 5IFYA 2QH5A 5FTSA 3U2UA 3R3IA 1GX0A 3T7NA 1H4EA 1FGGA 2C0NA 3FWWA 4KPZA 3SXCA 4EEMA 5HS2A 1H7QA 1E5KA 2WGZA 4R7PA 5CMJA 1VGUA 1LL0A 5C8RA 3I0KA 1G23A 4B2WA 2AM4A 1H4CA 4FCEA 4C2SA 1K4VA 1ZJ2A 2X5SA 3I0FA 2PX7A 5C1LA 1WT3A 1Z90A 4E1KA 3OH4A 1VZTA 2W0WA 4Y6NA 1VGWA 1XZ6A 3CKVA 1EYRA 2ZU7A 3DUVA 3I0EA 2OEGA 2PGVA 1ZJ0A 2RJ4A 2RJ8A 4Y9XA 4YS8A 1ON8A 4JISA 1V82A 3SXEA 1VH1A 2NXVA 2Y4LA 2WVKA 3OGZA 2E8BA 4GBPA 4B2XA 3ZF8A 2FY7A 2D7IA 1FRWA 4Y7UA 2FYAA 3E25A 4KRVA 2P73A 3ZLLA 2FYCB 5FUHA 2ZU8A 4FQWA 4AYJA 1PZTA 1H7FA 3D98A 3NGWA 4Y63A 3I0IX 3K8EA 2VD4A 1OQMB 5C3BA 2X60A 2O1FA 3CKNA 1H7LA 1ZJ1A 1ZDFA 4Q7CA 1R82A 4D48A 1MP4A 2YQSA 2RJ7A 3T7MA 1IINA 3ZLKA 1QWJA 3SX3A 2AECA 1TW5A 2J0BA 2JCLA 1ZJ3A 2Y6PA 1H7TA 3TQDA 4IRQA 2ICXA 3SX5A 1FWYA 1H5SD 3CKJA 1YP3A 2GGQA 2VK9A 2RJ5A 2P72A 5AJPA 1ZI1A 3PKPA 4NAKA 5CQLX 4FRMA 4EEGA 4CJCA 5C38A 1HM9A 2VXMA 4CVHA 3I0GA 1WVCA 1S4NA 4HO2A 1ZJPA 2Y4MA 1G8OA 2QKXA 5C4FA 2Y4KA 2Z87A 1FR8A 1VPAA 5CMGX 5EJ1A 1LZ7A 2YQHA 1R7XA 3T7OA 3V0MA 2CU2A 1S4OA 1YP4A 1YP2A 2VS5A 4B5BA 2JCJA 4FIYA 3OC9A 5C48A 4FRAA 3RMWA 1LZ0A 3OH3A 1FO9A 4KC1A 4ASYA 1FG5N 1INJA 2AM3A 1JVGA 4B42A 1ZCTA 4HO8A 1O23B 4B3UA 4HO0A 1JVDA 2WEEA 5DDTA 5FU8A 5C4DA 5L6VA 5IDTA 2OI6A 1NWGB 3I0DA 1LZJA 4DECA 3R2WA 4Y6UA 1JV3A 2OI5A 1JYKA 4XWIA 2YC5A 5FU0A 2AGDA 2I5EA 1I52A 3ZGGA 3V0OA 1R80A 5C4CA 1G95A 3ZGFA 2QGIA 1ZJOA 2A8WA 3JTJA 2FFUA 4HO3A 2RJ6A 3LW6A 1R7UA 2PA4A 1S4PA 4O6NA 3SX7A 4HO4A 4IRPA 3SXGA 1GA8A 2V0JA 1VM8A 4P00A 1H5TB 5DDVA 2YESA 2YC3A 3FOQA 4HO5A 4M28A 3USRA 1H5SB 3F1CA 1G97A 1W77A 1R7VA 1NF5B 5AJOA 2AH9A 3PKQA 4AAWA 1LL3A 1FZWA 2YCMA 3I0CA 1QGQA 1TW1A 3IOJA 1G1LA 5C36A 4ECMA 1O0RA 1R7YA 1H5RB 5C3DA 4JD0A 1LVWA 4KXOA 2Z86A 3BCVA 1GWVA 3PNNA 3U2VA 5L6SA 2JCKA 1QG8A 4D0TA 2AESA 4NANA 1FXJA 1KWSA 4FRLA 2RIYA 2X5ZA 5AJNA 3U0YA 3TZTA 4KT7A 3F1YA 4LW3A 2VSHA 1VICA 5FYEA 4K6RA 4AYLA 2RJ0A 5C1GA 1R7TA 2WAWA 2VSIA 1G0RA 4HOCA 2PGYA 2BO7A 2VFZA 1ZIZA 2YQJA 4P02A 5C47A 5IDSA 1FOAA 1W57A 4KNRA 2OI7A 4Y7VA 5CQMX 1IIMA 3I0JA 3KIAA 1HV9A 2APCA 1FGXA 1NQIB 4G3SA 1V84A 3RSBA 4B4BA 1HM8A 1G93A 2D7RA 1FR9A 4FIXA 5C3AA 1H4DA 1NKHB 2RJ9A 3DJ4A 1XHBA 4G3PA 3I0HA 1FO8A 5EJZA 1O7OA 4EEAA 4B4GA 5CQNX 1G3LA 2JCOA 2BO6A 3V8ZA 1YROB 1HM0A 3QVBA 4ZDQA 1ZI4A 1MP3A 2V0KA 4HCQA 3IOIA 2Y7AA 2WE9A 1LZIA 3SPTA 3Q80A 2XMHA 4D11A 2FFVA 2WVMA 3CU0A 3OAMA 4HO6A 4KC4A 1H7EA 3SXDA 1OMZA 3Q4SA 2D0JA 4KQLA 5CMHA 2OEFA 1QGSA 2ICYA 5EIYA 1SS9A 3U2XA 2V0HA 5C4EA 1W55A 4CJBA 1H3MA 1HJLA 2VS4A 4NALA 2O1HA 4D11C 2Q4JA 3OH1A 4ARWA 2VS3A 5FTVA 1V83A 4FRHA 1ZI5A 2Y4JA 2P6WA 2RIXA 5C1HA 2UX8A 2FYDB 2AE7A 4G3QA 3USQA 4Y7FA 2RJ1A 1HJJA 1H5TA 3POLA 1O7QA 3Q7UA 1JV1A 3D8VA 4NAIA 3SX8A 3V91A 2DPWA 4HO9A 4MYBA 4DE7A 4L41C 4FCUA 1H5SA 4FRBA 2RIZA 4FRQA 4LW6A 3U2WA 3K8DA 1VZXA 1WSZA 5D91A 4MNDA 4Y7GA 1NHEB 1GQ9A 2V0LA 4FRPA 4BQHA 2BO8A 3V0PA 4B4MA 5CMIA 1VZUA 2J0AA 5CQOA 2BO4A 1ZCUA 2E3DA 4FREA 4FROA 1H5RA 3RMVA 2FYBA 1ZCVA 4Y62A 4KC2A 5I1FA 3CKOA 3I0LA 1G9RA 1FXOA 3O3PA 1H5SC 2O1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXL A;  4EEO A;  3CGX A;  2XME A;  1PZY B;  1WT1 A;  3V0Q A;  2XWL A;  1VH3 A;  2I7B A;  2RIT A;  5C49 A;  5BXC A;  4EE4 A;  4KPX A;  4UEG A;  1VGT A;  2I5K A;  5CQP A;  4Y7T A;  1LL2 A;  3E26 A;  2AM5 A;  4BMA A;  1R81 A;  3N9W A;  1GWW A;  3CKQ A;  2A8U A;  4KNX A;  4EE5 A;  3OKR A;  1TZF A;  4J18 A;  1NMM B;  2XWM A;  1ZHJ A;  1ZI3 A;  4EE3 A;  2W0V A;  4AC3 A;  3V0N A;  3U0X A;  1H7H A;  1ZCY A;  3GUE A;  3V8Y A;  4CJ8 A;  3BRK X;  3OH0 A;  4HG6 A;  1MC3 A;  3IOH A;  3U2T A;  4G87 A;  1VGZ A;  2XWN A;  1MP5 A;  3OH2 A;  4DDZ A;  3JUK A;  1GX4 A;  4M2A A;  2X65 A;  2MZB A;  4EVW A;  1WT0 A;  3EE5 A;  1INI A;  1EZI A;  1GQC A;  3ST8 A;  3DK5 A;  5FV9 A;  3D5N A;  3SXA A;  5CMF X;  5JQQ A;  3JUJ A;  1G2V A;  4M2B A;  5C4B A;  1ON6 A;  4FRD A;  1H7G A;  4M4K A;  5J49 A;  4D0Z A;  1WT2 A;  1OMX A;  2ZU9 A;  4ASJ A;  2V0I A;  2GGO A;  1JYL A;  1TVY A;  1ZDG A;  3SXB A;  2WVL A;  2YQC A;  3HL3 A;  4Y64 A;  3V90 A;  3V0L A;  5IFY A;  2QH5 A;  5FTS A;  3U2U A;  3R3I A;  1GX0 A;  3T7N A;  1H4E A;  1FGG A;  3FWW A;  4KPZ A;  3SXC A;  4EEM A;  5HS2 A;  1H7Q A;  1E5K A;  2WGZ A;  4R7P A;  5CMJ A;  1VGU A;  1LL0 A;  5C8R A;  3I0K A;  1G23 A;  4B2W A;  2AM4 A;  1H4C A;  4FCE A;  4C2S A;  1K4V A;  1ZJ2 A;  2X5S A;  3I0F A;  2PX7 A;  5C1L A;  1WT3 A;  1Z90 A;  4E1K A;  3OH4 A;  1VZT A;  2W0W A;  4Y6N A;  1VGW A;  1XZ6 A;  3CKV A;  1EYR A;  2ZU7 A;  3DUV A;  3I0E A;  2OEG A;  2PGV A;  1ZJ0 A;  2RJ4 A;  2RJ8 A;  4Y9X A;  4YS8 A;  1ON8 A;  4JIS A;  1V82 A;  3SXE A;  1VH1 A;  2NXV A;  2Y4L A;  2WVK A;  3OGZ A;  2E8B A;  4GBP A;  4B2X A;  3ZF8 A;  2FY7 A;  2D7I A;  1FRW A;  4Y7U A;  2FYA A;  3E25 A;  4KRV A;  2P73 A;  3ZLL A;  2FYC B;  5FUH A;  2ZU8 A;  4FQW A;  4AYJ A;  1PZT A;  1H7F A;  3D98 A;  3NGW A;  4Y63 A;  3I0I X;  3K8E A;  2VD4 A;  1OQM B;  5C3B A;  2X60 A;  2O1F A;  3CKN A;  1H7L A;  1ZJ1 A;  1ZDF A;  1R82 A;  4D48 A;  1MP4 A;  2YQS A;  2RJ7 A;  3T7M A;  1IIN A;  3ZLK A;  1QWJ A;  3SX3 A;  2AEC A;  1TW5 A;  2JCL A;  1ZJ3 A;  2Y6P A;  1H7T A;  3TQD A;  4IRQ A;  2ICX A;  3SX5 A;  1FWY A;  1H5S D;  3CKJ A;  1YP3 A;  2GGQ A;  2RJ5 A;  2P72 A;  5AJP A;  1ZI1 A;  3PKP A;  4NAK A;  5CQL X;  4FRM A;  4EEG A;  4CJC A;  5C38 A;  1HM9 A;  2VXM A;  4CVH A;  3I0G A;  1WVC A;  1S4N A;  4HO2 A;  1ZJP A;  2Y4M A;  1G8O A;  2QKX A;  5C4F A;  2Y4K A;  2Z87 A;  1FR8 A;  1VPA A;  5CMG X;  5EJ1 A;  1LZ7 A;  2YQH A;  1R7X A;  3T7O A;  3V0M A;  2CU2 A;  1S4O A;  1YP4 A;  1YP2 A;  2VS5 A;  4B5B A;  2JCJ A;  3OC9 A;  5C48 A;  4FRA A;  3RMW A;  1LZ0 A;  3OH3 A;  1FO9 A;  4KC1 A;  4ASY A;  1FG5 N;  1INJ A;  2AM3 A;  1JVG A;  4B42 A;  1ZCT A;  4HO8 A;  1O23 B;  4B3U A;  4HO0 A;  1JVD A;  2WEE A;  5DDT A;  5FU8 A;  5C4D A;  5L6V A;  5IDT A;  2OI6 A;  1NWG B;  3I0D A;  1LZJ A;  4DEC A;  3R2W A;  4Y6U A;  1JV3 A;  2OI5 A;  1JYK A;  4XWI A;  2YC5 A;  5FU0 A;  2AGD A;  2I5E A;  1I52 A;  3ZGG A;  3V0O A;  1R80 A;  5C4C A;  1G95 A;  3ZGF A;  2QGI A;  1ZJO A;  2A8W A;  3JTJ A;  2FFU A;  4HO3 A;  2RJ6 A;  3LW6 A;  1R7U A;  2PA4 A;  1S4P A;  3SX7 A;  4HO4 A;  4IRP A;  3SXG A;  1GA8 A;  2V0J A;  1VM8 A;  4P00 A;  1H5T B;  5DDV A;  2YES A;  2YC3 A;  3FOQ A;  4HO5 A;  4M28 A;  3USR A;  1H5S B;  3F1C A;  1G97 A;  1W77 A;  1R7V A;  1NF5 B;  5AJO A;  2AH9 A;  3PKQ A;  4AAW A;  1LL3 A;  1FZW A;  2YCM A;  3I0C A;  1QGQ A;  1TW1 A;  3IOJ A;  1G1L A;  5C36 A;  4ECM A;  1O0R A;  1R7Y A;  1H5R B;  5C3D A;  4JD0 A;  1LVW A;  4KXO A;  2Z86 A;  3BCV A;  1GWV A;  3PNN A;  3U2V A;  5L6S A;  2JCK A;  1QG8 A;  4D0T A;  2AES A;  4NAN A;  1FXJ A;  1KWS A;  4FRL A;  2RIY A;  2X5Z A;  5AJN A;  3U0Y A;  3TZT A;  4KT7 A;  3F1Y A;  4LW3 A;  2VSH A;  1VIC A;  5FYE A;  4K6R A;  4AYL A;  2RJ0 A;  5C1G A;  1R7T A;  2WAW A;  2VSI A;  1G0R A;  4HOC A;  2PGY A;  2BO7 A;  2VFZ A;  1ZIZ A;  2YQJ A;  4P02 A;  5C47 A;  5IDS A;  1FOA A;  1W57 A;  4KNR A;  2OI7 A;  4Y7V A;  5CQM X;  1IIM A;  3I0J A;  3KIA A;  1HV9 A;  2APC A;  1FGX A;  1NQI B;  4G3S A;  1V84 A;  3RSB A;  4B4B A;  1HM8 A;  1G93 A;  2D7R A;  1FR9 A;  5C3A A;  1H4D A;  1NKH B;  2RJ9 A;  3DJ4 A;  1XHB A;  4G3P A;  3I0H A;  1FO8 A;  5EJZ A;  1O7O A;  4EEA A;  4B4G A;  5CQN X;  1G3L A;  2JCO A;  2BO6 A;  3V8Z A;  1YRO B;  1HM0 A;  3QVB A;  4ZDQ A;  1ZI4 A;  1MP3 A;  2V0K A;  4HCQ A;  3IOI A;  2Y7A A;  2WE9 A;  1LZI A;  3SPT A;  3Q80 A;  2XMH A;  4D11 A;  2FFV A;  2WVM A;  3CU0 A;  3OAM A;  4HO6 A;  4KC4 A;  1H7E A;  3SXD A;  1OMZ A;  3Q4S A;  2D0J A;  4KQL A;  5CMH A;  2OEF A;  1QGS A;  2ICY A;  5EIY A;  1SS9 A;  3U2X A;  2V0H A;  5C4E A;  1W55 A;  4CJB A;  1H3M A;  1HJL A;  2VS4 A;  4NAL A;  2O1H A;  4D11 C;  2Q4J A;  3OH1 A;  4ARW A;  2VS3 A;  5FTV A;  1V83 A;  4FRH A;  1ZI5 A;  2Y4J A;  2P6W A;  2RIX A;  5C1H A;  2UX8 A;  2FYD B;  2AE7 A;  4G3Q A;  3USQ A;  4Y7F A;  2RJ1 A;  1HJJ A;  1H5T A;  3POL A;  1O7Q A;  3Q7U A;  1JV1 A;  3D8V A;  4NAI A;  3SX8 A;  3V91 A;  2DPW A;  4HO9 A;  4MYB A;  4DE7 A;  4L41 C;  4FCU A;  1H5S A;  4FRB A;  2RIZ A;  4FRQ A;  4LW6 A;  3U2W A;  3K8D A;  1VZX A;  1WSZ A;  4MND A;  4Y7G A;  1NHE B;  1GQ9 A;  2V0L A;  4FRP A;  4BQH A;  2BO8 A;  3V0P A;  4B4M A;  5CMI A;  1VZU A;  5CQO A;  2BO4 A;  1ZCU A;  2E3D A;  4FRE A;  4FRO A;  1H5R A;  3RMV A;  2FYB A;  1ZCV A;  4Y62 A;  4KC2 A;  5I1F A;  3CKO A;  3I0L A;  1G9R A;  1FXO A;  3O3P A;  1H5S C;  2O1G A; 
#chains in the Genus database with same CATH topology
 2VXL A;  4EEO A;  3CGX A;  2XME A;  1PZY B;  1WT1 A;  3V0Q A;  2XWL A;  1VH3 A;  2I7B A;  2RIT A;  5C49 A;  5BXC A;  4EE4 A;  4KPX A;  4UEG A;  1VGT A;  2I5K A;  5CQP A;  4Y7T A;  1LL2 A;  3E26 A;  2AM5 A;  4BMA A;  1R81 A;  3N9W A;  1GWW A;  3CKQ A;  2A8U A;  4KNX A;  4EE5 A;  3OKR A;  1TZF A;  4J18 A;  1NMM B;  2XWM A;  1ZHJ A;  1ZI3 A;  4EE3 A;  4MIX A;  2W0V A;  4AC3 A;  3V0N A;  3U0X A;  1H7H A;  1ZCY A;  3GUE A;  3V8Y A;  4CJ8 A;  3BRK X;  3OH0 A;  4HG6 A;  1MC3 A;  3IOH A;  3U2T A;  4G87 A;  1VGZ A;  2XWN A;  1MP5 A;  3OH2 A;  4O6M A;  4DDZ A;  3JUK A;  1GX4 A;  4M2A A;  2X65 A;  2MZB A;  4EVW A;  1WT0 A;  3EE5 A;  1INI A;  1EZI A;  1GQC A;  3ST8 A;  3DK5 A;  5FV9 A;  3D5N A;  3SXA A;  5CMF X;  5JQQ A;  3JUJ A;  1G2V A;  4M2B A;  5C4B A;  1ON6 A;  4FRD A;  1H7G A;  4M4K A;  5J49 A;  5D92 A;  4D0Z A;  1WT2 A;  1OMX A;  2ZU9 A;  4ASJ A;  2V0I A;  2GGO A;  1JYL A;  1TVY A;  1ZDG A;  3SXB A;  2WVL A;  2YQC A;  3HL3 A;  4Y64 A;  3V90 A;  3V0L A;  5IFY A;  2QH5 A;  5FTS A;  3U2U A;  3R3I A;  1GX0 A;  3T7N A;  1H4E A;  1FGG A;  2C0N A;  3FWW A;  4KPZ A;  3SXC A;  4EEM A;  5HS2 A;  1H7Q A;  1E5K A;  2WGZ A;  4R7P A;  5CMJ A;  1VGU A;  1LL0 A;  5C8R A;  3I0K A;  1G23 A;  4B2W A;  2AM4 A;  1H4C A;  4FCE A;  4C2S A;  1K4V A;  1ZJ2 A;  2X5S A;  3I0F A;  2PX7 A;  5C1L A;  1WT3 A;  1Z90 A;  4E1K A;  3OH4 A;  1VZT A;  2W0W A;  4Y6N A;  1VGW A;  1XZ6 A;  3CKV A;  1EYR A;  2ZU7 A;  3DUV A;  3I0E A;  2OEG A;  2PGV A;  1ZJ0 A;  2RJ4 A;  2RJ8 A;  4Y9X A;  4YS8 A;  1ON8 A;  4JIS A;  1V82 A;  3SXE A;  1VH1 A;  2NXV A;  2Y4L A;  2WVK A;  3OGZ A;  2E8B A;  4GBP A;  4B2X A;  3ZF8 A;  2FY7 A;  2D7I A;  1FRW A;  4Y7U A;  2FYA A;  3E25 A;  4KRV A;  2P73 A;  3ZLL A;  2FYC B;  5FUH A;  2ZU8 A;  4FQW A;  4AYJ A;  1PZT A;  1H7F A;  3D98 A;  3NGW A;  4Y63 A;  3I0I X;  3K8E A;  2VD4 A;  1OQM B;  5C3B A;  2X60 A;  2O1F A;  3CKN A;  1H7L A;  1ZJ1 A;  1ZDF A;  4Q7C A;  1R82 A;  4D48 A;  1MP4 A;  2YQS A;  2RJ7 A;  3T7M A;  1IIN A;  3ZLK A;  1QWJ A;  3SX3 A;  2AEC A;  1TW5 A;  2J0B A;  2JCL A;  1ZJ3 A;  2Y6P A;  1H7T A;  3TQD A;  4IRQ A;  2ICX A;  3SX5 A;  1FWY A;  1H5S D;  3CKJ A;  1YP3 A;  2GGQ A;  2VK9 A;  2RJ5 A;  2P72 A;  5AJP A;  1ZI1 A;  3PKP A;  4NAK A;  5CQL X;  4FRM A;  4EEG A;  4CJC A;  5C38 A;  1HM9 A;  2VXM A;  4CVH A;  3I0G A;  1WVC A;  1S4N A;  4HO2 A;  1ZJP A;  2Y4M A;  1G8O A;  2QKX A;  5C4F A;  2Y4K A;  2Z87 A;  1FR8 A;  1VPA A;  5CMG X;  5EJ1 A;  1LZ7 A;  2YQH A;  1R7X A;  3T7O A;  3V0M A;  2CU2 A;  1S4O A;  1YP4 A;  1YP2 A;  2VS5 A;  4B5B A;  2JCJ A;  4FIY A;  3OC9 A;  5C48 A;  4FRA A;  3RMW A;  1LZ0 A;  3OH3 A;  1FO9 A;  4KC1 A;  4ASY A;  1FG5 N;  1INJ A;  2AM3 A;  1JVG A;  4B42 A;  1ZCT A;  4HO8 A;  1O23 B;  4B3U A;  4HO0 A;  1JVD A;  2WEE A;  5DDT A;  5FU8 A;  5C4D A;  5L6V A;  5IDT A;  2OI6 A;  1NWG B;  3I0D A;  1LZJ A;  4DEC A;  3R2W A;  4Y6U A;  1JV3 A;  2OI5 A;  1JYK A;  4XWI A;  2YC5 A;  5FU0 A;  2AGD A;  2I5E A;  1I52 A;  3ZGG A;  3V0O A;  1R80 A;  5C4C A;  1G95 A;  3ZGF A;  2QGI A;  1ZJO A;  2A8W A;  3JTJ A;  2FFU A;  4HO3 A;  2RJ6 A;  3LW6 A;  1R7U A;  2PA4 A;  1S4P A;  4O6N A;  3SX7 A;  4HO4 A;  4IRP A;  3SXG A;  1GA8 A;  2V0J A;  1VM8 A;  4P00 A;  1H5T B;  5DDV A;  2YES A;  2YC3 A;  3FOQ A;  4HO5 A;  4M28 A;  3USR A;  1H5S B;  3F1C A;  1G97 A;  1W77 A;  1R7V A;  1NF5 B;  5AJO A;  2AH9 A;  3PKQ A;  4AAW A;  1LL3 A;  1FZW A;  2YCM A;  3I0C A;  1QGQ A;  1TW1 A;  3IOJ A;  1G1L A;  5C36 A;  4ECM A;  1O0R A;  1R7Y A;  1H5R B;  5C3D A;  4JD0 A;  1LVW A;  4KXO A;  2Z86 A;  3BCV A;  1GWV A;  3PNN A;  3U2V A;  5L6S A;  2JCK A;  1QG8 A;  4D0T A;  2AES A;  4NAN A;  1FXJ A;  1KWS A;  4FRL A;  2RIY A;  2X5Z A;  5AJN A;  3U0Y A;  3TZT A;  4KT7 A;  3F1Y A;  4LW3 A;  2VSH A;  1VIC A;  5FYE A;  4K6R A;  4AYL A;  2RJ0 A;  5C1G A;  1R7T A;  2WAW A;  2VSI A;  1G0R A;  4HOC A;  2PGY A;  2BO7 A;  2VFZ A;  1ZIZ A;  2YQJ A;  4P02 A;  5C47 A;  5IDS A;  1FOA A;  1W57 A;  4KNR A;  2OI7 A;  4Y7V A;  5CQM X;  1IIM A;  3I0J A;  3KIA A;  1HV9 A;  2APC A;  1FGX A;  1NQI B;  4G3S A;  1V84 A;  3RSB A;  4B4B A;  1HM8 A;  1G93 A;  2D7R A;  1FR9 A;  4FIX A;  5C3A A;  1H4D A;  1NKH B;  2RJ9 A;  3DJ4 A;  1XHB A;  4G3P A;  3I0H A;  1FO8 A;  5EJZ A;  1O7O A;  4EEA A;  4B4G A;  5CQN X;  1G3L A;  2JCO A;  2BO6 A;  3V8Z A;  1YRO B;  1HM0 A;  3QVB A;  4ZDQ A;  1ZI4 A;  1MP3 A;  2V0K A;  4HCQ A;  3IOI A;  2Y7A A;  2WE9 A;  1LZI A;  3SPT A;  3Q80 A;  2XMH A;  4D11 A;  2FFV A;  2WVM A;  3CU0 A;  3OAM A;  4HO6 A;  4KC4 A;  1H7E A;  3SXD A;  1OMZ A;  3Q4S A;  2D0J A;  4KQL A;  5CMH A;  2OEF A;  1QGS A;  2ICY A;  5EIY A;  1SS9 A;  3U2X A;  2V0H A;  5C4E A;  1W55 A;  4CJB A;  1H3M A;  1HJL A;  2VS4 A;  4NAL A;  2O1H A;  4D11 C;  2Q4J A;  3OH1 A;  4ARW A;  2VS3 A;  5FTV A;  1V83 A;  4FRH A;  1ZI5 A;  2Y4J A;  2P6W A;  2RIX A;  5C1H A;  2UX8 A;  2FYD B;  2AE7 A;  4G3Q A;  3USQ A;  4Y7F A;  2RJ1 A;  1HJJ A;  1H5T A;  3POL A;  1O7Q A;  3Q7U A;  1JV1 A;  3D8V A;  4NAI A;  3SX8 A;  3V91 A;  2DPW A;  4HO9 A;  4MYB A;  4DE7 A;  4L41 C;  4FCU A;  1H5S A;  4FRB A;  2RIZ A;  4FRQ A;  4LW6 A;  3U2W A;  3K8D A;  1VZX A;  1WSZ A;  5D91 A;  4MND A;  4Y7G A;  1NHE B;  1GQ9 A;  2V0L A;  4FRP A;  4BQH A;  2BO8 A;  3V0P A;  4B4M A;  5CMI A;  1VZU A;  2J0A A;  5CQO A;  2BO4 A;  1ZCU A;  2E3D A;  4FRE A;  4FRO A;  1H5R A;  3RMV A;  2FYB A;  1ZCV A;  4Y62 A;  4KC2 A;  5I1F A;  3CKO A;  3I0L A;  1G9R A;  1FXO A;  3O3P A;  1H5S C;  2O1G A; 
#chains in the Genus database with same CATH homology
 2VXL A;  4EEO A;  3CGX A;  2XME A;  1PZY B;  1WT1 A;  3V0Q A;  2XWL A;  1VH3 A;  2I7B A;  2RIT A;  5C49 A;  5BXC A;  4EE4 A;  4KPX A;  4UEG A;  1VGT A;  2I5K A;  5CQP A;  4Y7T A;  1LL2 A;  3E26 A;  2AM5 A;  4BMA A;  1R81 A;  3N9W A;  1GWW A;  3CKQ A;  2A8U A;  4KNX A;  4EE5 A;  3OKR A;  1TZF A;  4J18 A;  1NMM B;  2XWM A;  1ZHJ A;  1ZI3 A;  4EE3 A;  4MIX A;  2W0V A;  4AC3 A;  3V0N A;  3U0X A;  1H7H A;  1ZCY A;  3GUE A;  3V8Y A;  4CJ8 A;  3BRK X;  3OH0 A;  4HG6 A;  1MC3 A;  3IOH A;  3U2T A;  4G87 A;  1VGZ A;  2XWN A;  1MP5 A;  3OH2 A;  4O6M A;  4DDZ A;  3JUK A;  1GX4 A;  4M2A A;  2X65 A;  2MZB A;  4EVW A;  1WT0 A;  3EE5 A;  1INI A;  1EZI A;  1GQC A;  3ST8 A;  3DK5 A;  5FV9 A;  3D5N A;  3SXA A;  5CMF X;  5JQQ A;  3JUJ A;  1G2V A;  4M2B A;  5C4B A;  1ON6 A;  4FRD A;  1H7G A;  4M4K A;  5J49 A;  5D92 A;  4D0Z A;  1WT2 A;  1OMX A;  2ZU9 A;  4ASJ A;  2V0I A;  2GGO A;  1JYL A;  1TVY A;  1ZDG A;  3SXB A;  2WVL A;  2YQC A;  3HL3 A;  4Y64 A;  3V90 A;  3V0L A;  5IFY A;  2QH5 A;  5FTS A;  3U2U A;  3R3I A;  1GX0 A;  3T7N A;  1H4E A;  1FGG A;  2C0N A;  3FWW A;  4KPZ A;  3SXC A;  4EEM A;  5HS2 A;  1H7Q A;  1E5K A;  2WGZ A;  4R7P A;  5CMJ A;  1VGU A;  1LL0 A;  5C8R A;  3I0K A;  1G23 A;  4B2W A;  2AM4 A;  1H4C A;  4FCE A;  4C2S A;  1K4V A;  1ZJ2 A;  2X5S A;  3I0F A;  2PX7 A;  5C1L A;  1WT3 A;  1Z90 A;  4E1K A;  3OH4 A;  1VZT A;  2W0W A;  4Y6N A;  1VGW A;  1XZ6 A;  3CKV A;  1EYR A;  2ZU7 A;  3DUV A;  3I0E A;  2OEG A;  2PGV A;  1ZJ0 A;  2RJ4 A;  2RJ8 A;  4Y9X A;  4YS8 A;  1ON8 A;  4JIS A;  1V82 A;  3SXE A;  1VH1 A;  2NXV A;  2Y4L A;  2WVK A;  3OGZ A;  2E8B A;  4GBP A;  4B2X A;  3ZF8 A;  2FY7 A;  2D7I A;  1FRW A;  4Y7U A;  2FYA A;  3E25 A;  4KRV A;  2P73 A;  3ZLL A;  2FYC B;  5FUH A;  2ZU8 A;  4FQW A;  4AYJ A;  1PZT A;  1H7F A;  3D98 A;  3NGW A;  4Y63 A;  3I0I X;  3K8E A;  2VD4 A;  1OQM B;  5C3B A;  2X60 A;  2O1F A;  3CKN A;  1H7L A;  1ZJ1 A;  1ZDF A;  4Q7C A;  1R82 A;  4D48 A;  1MP4 A;  2YQS A;  2RJ7 A;  3T7M A;  1IIN A;  3ZLK A;  1QWJ A;  3SX3 A;  2AEC A;  1TW5 A;  2J0B A;  2JCL A;  1ZJ3 A;  2Y6P A;  1H7T A;  3TQD A;  4IRQ A;  2ICX A;  3SX5 A;  1FWY A;  1H5S D;  3CKJ A;  1YP3 A;  2GGQ A;  2VK9 A;  2RJ5 A;  2P72 A;  5AJP A;  1ZI1 A;  3PKP A;  4NAK A;  5CQL X;  4FRM A;  4EEG A;  4CJC A;  5C38 A;  1HM9 A;  2VXM A;  4CVH A;  3I0G A;  1WVC A;  1S4N A;  4HO2 A;  1ZJP A;  2Y4M A;  1G8O A;  2QKX A;  5C4F A;  2Y4K A;  2Z87 A;  1FR8 A;  1VPA A;  5CMG X;  5EJ1 A;  1LZ7 A;  2YQH A;  1R7X A;  3T7O A;  3V0M A;  2CU2 A;  1S4O A;  1YP4 A;  1YP2 A;  2VS5 A;  4B5B A;  2JCJ A;  4FIY A;  3OC9 A;  5C48 A;  4FRA A;  3RMW A;  1LZ0 A;  3OH3 A;  1FO9 A;  4KC1 A;  4ASY A;  1FG5 N;  1INJ A;  2AM3 A;  1JVG A;  4B42 A;  1ZCT A;  4HO8 A;  1O23 B;  4B3U A;  4HO0 A;  1JVD A;  2WEE A;  5DDT A;  5FU8 A;  5C4D A;  5L6V A;  5IDT A;  2OI6 A;  1NWG B;  3I0D A;  1LZJ A;  4DEC A;  3R2W A;  4Y6U A;  1JV3 A;  2OI5 A;  1JYK A;  4XWI A;  2YC5 A;  5FU0 A;  2AGD A;  2I5E A;  1I52 A;  3ZGG A;  3V0O A;  1R80 A;  5C4C A;  1G95 A;  3ZGF A;  2QGI A;  1ZJO A;  2A8W A;  3JTJ A;  2FFU A;  4HO3 A;  2RJ6 A;  3LW6 A;  1R7U A;  2PA4 A;  1S4P A;  4O6N A;  3SX7 A;  4HO4 A;  4IRP A;  3SXG A;  1GA8 A;  2V0J A;  1VM8 A;  4P00 A;  1H5T B;  5DDV A;  2YES A;  2YC3 A;  3FOQ A;  4HO5 A;  4M28 A;  3USR A;  1H5S B;  3F1C A;  1G97 A;  1W77 A;  1R7V A;  1NF5 B;  5AJO A;  2AH9 A;  3PKQ A;  4AAW A;  1LL3 A;  1FZW A;  2YCM A;  3I0C A;  1QGQ A;  1TW1 A;  3IOJ A;  1G1L A;  5C36 A;  4ECM A;  1O0R A;  1R7Y A;  1H5R B;  5C3D A;  4JD0 A;  1LVW A;  4KXO A;  2Z86 A;  3BCV A;  1GWV A;  3PNN A;  3U2V A;  5L6S A;  2JCK A;  1QG8 A;  4D0T A;  2AES A;  4NAN A;  1FXJ A;  1KWS A;  4FRL A;  2RIY A;  2X5Z A;  5AJN A;  3U0Y A;  3TZT A;  4KT7 A;  3F1Y A;  4LW3 A;  2VSH A;  1VIC A;  5FYE A;  4K6R A;  4AYL A;  2RJ0 A;  5C1G A;  1R7T A;  2WAW A;  2VSI A;  1G0R A;  4HOC A;  2PGY A;  2BO7 A;  2VFZ A;  1ZIZ A;  2YQJ A;  4P02 A;  5C47 A;  5IDS A;  1FOA A;  1W57 A;  4KNR A;  2OI7 A;  4Y7V A;  5CQM X;  1IIM A;  3I0J A;  3KIA A;  1HV9 A;  2APC A;  1FGX A;  1NQI B;  4G3S A;  1V84 A;  3RSB A;  4B4B A;  1HM8 A;  1G93 A;  2D7R A;  1FR9 A;  4FIX A;  5C3A A;  1H4D A;  1NKH B;  2RJ9 A;  3DJ4 A;  1XHB A;  4G3P A;  3I0H A;  1FO8 A;  5EJZ A;  1O7O A;  4EEA A;  4B4G A;  5CQN X;  1G3L A;  2JCO A;  2BO6 A;  3V8Z A;  1YRO B;  1HM0 A;  3QVB A;  4ZDQ A;  1ZI4 A;  1MP3 A;  2V0K A;  4HCQ A;  3IOI A;  2Y7A A;  2WE9 A;  1LZI A;  3SPT A;  3Q80 A;  2XMH A;  4D11 A;  2FFV A;  2WVM A;  3CU0 A;  3OAM A;  4HO6 A;  4KC4 A;  1H7E A;  3SXD A;  1OMZ A;  3Q4S A;  2D0J A;  4KQL A;  5CMH A;  2OEF A;  1QGS A;  2ICY A;  5EIY A;  1SS9 A;  3U2X A;  2V0H A;  5C4E A;  1W55 A;  4CJB A;  1H3M A;  1HJL A;  2VS4 A;  4NAL A;  2O1H A;  4D11 C;  2Q4J A;  3OH1 A;  4ARW A;  2VS3 A;  5FTV A;  1V83 A;  4FRH A;  1ZI5 A;  2Y4J A;  2P6W A;  2RIX A;  5C1H A;  2UX8 A;  2FYD B;  2AE7 A;  4G3Q A;  3USQ A;  4Y7F A;  2RJ1 A;  1HJJ A;  1H5T A;  3POL A;  1O7Q A;  3Q7U A;  1JV1 A;  3D8V A;  4NAI A;  3SX8 A;  3V91 A;  2DPW A;  4HO9 A;  4MYB A;  4DE7 A;  4L41 C;  4FCU A;  1H5S A;  4FRB A;  2RIZ A;  4FRQ A;  4LW6 A;  3U2W A;  3K8D A;  1VZX A;  1WSZ A;  5D91 A;  4MND A;  4Y7G A;  1NHE B;  1GQ9 A;  2V0L A;  4FRP A;  4BQH A;  2BO8 A;  3V0P A;  4B4M A;  5CMI A;  1VZU A;  2J0A A;  5CQO A;  2BO4 A;  1ZCU A;  2E3D A;  4FRE A;  4FRO A;  1H5R A;  3RMV A;  2FYB A;  1ZCV A;  4Y62 A;  4KC2 A;  5I1F A;  3CKO A;  3I0L A;  1G9R A;  1FXO A;  3O3P A;  1H5S C;  2O1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...