5CMFX

Gta mutant with mercury - e303a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
284
structure length
263
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEHDASHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Glycosyltransfer in mutants of putative catalytic residue Glu303 of the human ABO(H) A and B blood group glycosyltransferases GTA and GTB proceeds through a labile active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 263
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5cmfX00
2RIXA 3DUVA 3PKQA 2FYDB 4KXOA 3SXEA 2OEFA 4M2BA 3V0PA 3CKOA 2ZU7A 1VGUA 2JCOA 2WAWA 4JISA 3FOQA 1OQMB 1R7UA 2XWLA 2JCLA 1W57A 2D7IA 2VS3A 4FRLA 3SXBA 1VZTA 4HO3A 1IINA 5EJ1A 3RSBA 1GX0A 5C3AA 4G3QA 4HCQA 2YESA 4D48A 2AESA 5C47A 1FOAA 5L6SA 3IOHA 2P6WA 5FU0A 1W77A 2BO4A 5IFYA 1ZDGA 2YQJA 4HO0A 2JCKA 1ZJ3A 1H5RA 4D0TA 4HO6A 4AC3A 3USRA 1QWJA 2VSHA 1QGQA 5CMHA 2PGVA 2PA4A 3ZF8A 1H7HA 5FTVA 4AYJA 1YROB 3V8YA 1LZIA 1ZJPA 3CKVA 2XWNA 4Y9XA 1ZIZA 3SXDA 4EEGA 4Y7TA 5JQQA 1INIA 1VICA 1HJLA 4HOCA 1EZIA 3HL3A 1H5SB 4KC4A 5CQOA 1FXJA 3U2WA 5BXCA 1O0RA 1G97A 3SX8A 3ZLLA 4KC1A 2VD4A 4HO8A 4NALA 2ZU9A 2OEGA 1VGWA 3V90A 4CJCA 1H5RB 2W0WA 1V84A 1HM8A 1JV3A 4ECMA 1ZCTA 3F1YA 1LVWA 4KRVA 3POLA 3CKJA 4J18A 1H7QA 2NXVA 1LZ0A 2BO7A 4D11C 2ICXA 2FY7A 2JCJA 1LL2A 3Q80A 4MNDA 4EEMA 2WEEA 4B4MA 5J49A 1YP2A 2Y4JA 2OI5A 4Y7UA 3SX7A 2FYCB 5CMIA 3JUKA 2AM5A 1SS9A 3PKPA 1ZCYA 1FRWA 2ICYA 1R7VA 1VGTA 2V0JA 3V0QA 2Y4KA 1TZFA 1FGXA 4HO4A 2Y4MA 5C4BA 3IOJA 4KNXA 5C49A 1VGZA 1TW5A 3OH3A 3I0FA 5CQNX 1JVGA 4KQLA 3OAMA 4FCUA 5C3DA 4BMAA 4YS8A 2D0JA 2WE9A 4HO2A 3SXCA 2E8BA 1ZI1A 1EYRA 1FR8A 1R7TA 1ZHJA 1JYLA 1H7FA 4DE7A 1GWVA 3V0MA 1JV1A 2I5KA 1ON6A 3USQA 1V82A 3KIAA 1ZDFA 4FRQA 1H7LA 1IIMA 1TVYA 2PGYA 4FRDA 1K4VA 1OMZA 1R82A 5CQLX 1NQIB 4C2SA 2PX7A 4ASYA 1FGGA 2V0IA 1WT3A 1H7TA 3LW6A 1G3LA 1HM0A 4K6RA 4R7PA 3CU0A 1S4OA 5C8RA 1XZ6A 4GBPA 2WVLA 1R7YA 2P73A 4FRMA 4LW6A 1H5SC 1MC3A 2X5ZA 2Q4JA 1G23A 3CGXA 3K8EA 2Z86A 1H4DA 3U0XA 1XHBA 2V0KA 2UX8A 4Y7GA 4Y7FA 2X5SA 5C1HA 2FFUA 3FWWA 4Y63A 2I5EA 1MP3A 4P02A 1H5TA 2A8WA 3I0KA 3N9WA 1S4NA 1G1LA 1LZ7A 4DECA 5CMFX 1FWYA 2QGIA 2RJ8A 3OC9A 3Q7UA 5AJPA 4M4KA 2XMHA 5DDTA 2RIZA 4G87A 4Y7VA 3F1CA 1ZJ2A 3D5NA 3I0GA 2RJ0A 2QH5A 1G95A 4EE5A 4LW3A 4UEGA 1GQCA 4B4GA 3E25A 4ARWA 2OI7A 2O1GA 4P00A 1H7EA 1VZUA 1E5KA 3V0LA 2YCMA 1PZYB 4G3SA 4B5BA 3JTJA 2RJ9A 3O3PA 5FTSA 1LL0A 5C3BA 3ZGGA 3K8DA 3TQDA 5DDVA 3V91A 1LZJA 5CQMX 1ZI5A 3Q4SA 2VXMA 5L6VA 4EVWA 2VS4A 3QVBA 5C1LA 2YC3A 3V0NA 2A8UA 5EJZA 3SX3A 1V83A 5FU8A 4KPXA 1JYKA 4FROA 3SXAA 5FUHA 2BO8A 2RJ6A 5IDTA 1YP3A 2Y6PA 1WSZA 4CVHA 4D0ZA 2V0HA 4HO5A 4ASJA 2DPWA 3BCVA 2Z87A 4D11A 1ON8A 3T7NA 2O1FA 4FRHA 4DDZA 2W0VA 3OH4A 2CU2A 1H5SD 3CKQA 1FG5N 4ZDQA 2RJ5A 2FFVA 2YQCA 4CJ8A 5EIYA 1H3MA 2AM4A 5I1FA 1TW1A 3OKRA 1O7OA 2FYAA 3D98A 1MP4A 3TZTA 2VS5A 1WVCA 1VH1A 1VPAA 4FCEA 1GWWA 3R2WA 3OGZA 3PNNA 4KNRA 2I7BA 1ZJ0A 3BRKX 2Y7AA 3T7OA 5HS2A 4XWIA 3RMWA 1ZI3A 1O7QA 3IOIA 5C1GA 4FRBA 3DJ4A 1H7GA 3I0EA 1NKHB 1WT2A 3I0HA 2AM3A 4EE4A 1FO8A 5AJNA 1W55A 3EE5A 5C48A 2ZU8A 3NGWA 5CMGX 4Y6UA 1YP4A 4B4BA 4M2AA 2FYBA 2GGQA 5C36A 1VH3A 3U2VA 2WVKA 2AE7A 4NAIA 2E3DA 4CJBA 2WVMA 5AJOA 2GGOA 4NAKA 4FRPA 5FV9A 1MP5A 4Y62A 1HV9A 1H5SA 1NWGB 1PZTA 4AYLA 4MYBA 3I0IX 2XWMA 3OH2A 1JVDA 1QG8A 4IRPA 3U0YA 3R3IA 4EEOA 3V8ZA 3GUEA 5C4EA 3V0OA 4Y64A 4B2WA 1ZJOA 2QKXA 2VSIA 2RIYA 4B42A 2VFZA 2VXLA 1G0RA 1Z90A 2P72A 4M28A 3D8VA 3JUJA 5C4FA 3E26A 2X60A 4EEAA 3CKNA 5IDSA 2V0LA 2O1HA 3ZLKA 4B2XA 1R7XA 5CMJA 1H4CA 1H5TB 2RJ1A 2APCA 2AH9A 3U2UA 1VM8A 1OMXA 1ZJ1A 4B3UA 3RMVA 1HM9A 1NF5B 4HO9A 2WGZA 3OH0A 4L41C 2RITA 5C4CA 5FYEA 5C4DA 1FO9A 1ZI4A 3T7MA 2XMEA 4KC2A 1R81A 1NMMB 3I0LA 1NHEB 1O23B 1GA8A 3OH1A 4FRAA 4JD0A 1FXOA 4FQWA 1G9RA 4AAWA 1GX4A 2RJ7A 1G93A 1GQ9A 1QGSA 2YQSA 3ZGFA 2OI6A 2YQHA 1ZCVA 2X65A 4EE3A 4KT7A 3SX5A 4HG6A 1WT1A 4E1KA 2AGDA 2YC5A 1LL3A 2AECA 3DK5A 3SPTA 1KWSA 1VZXA 1S4PA 3I0CA 4G3PA 2D7RA 1INJA 4BQHA 1H4EA 3I0DA 4NANA 2Y4LA 3SXGA 1G2VA 1I52A 2MZBA 1ZCUA 4Y6NA 1FZWA 3U2TA 5CQPA 1WT0A 3ST8A 1G8OA 1FR9A 2RJ4A 4FREA 1R80A 4KPZA 2BO6A 5C38A 1HJJA 3I0JA 4IRQA 3U2XA
chains in the Genus database with same CATH superfamily
2RIXA 3DUVA 3PKQA 2FYDB 4KXOA 3SXEA 2OEFA 4O6NA 4M2BA 3V0PA 3CKOA 2ZU7A 1VGUA 2JCOA 2WAWA 4JISA 3FOQA 1OQMB 1R7UA 2XWLA 2JCLA 1W57A 2D7IA 2VS3A 4FIYA 4FRLA 3SXBA 1VZTA 4HO3A 1IINA 5EJ1A 3RSBA 1GX0A 5C3AA 4G3QA 4HCQA 2YESA 4D48A 2AESA 5C47A 1FOAA 5L6SA 3IOHA 2P6WA 5FU0A 1W77A 2BO4A 5IFYA 1ZDGA 2YQJA 4HO0A 2JCKA 1ZJ3A 1H5RA 4D0TA 4HO6A 4AC3A 3USRA 1QWJA 2VSHA 1QGQA 5CMHA 2PGVA 2PA4A 4FIXA 2J0BA 3ZF8A 1H7HA 5FTVA 4AYJA 1YROB 3V8YA 1LZIA 1ZJPA 3CKVA 2XWNA 4Y9XA 1ZIZA 3SXDA 4EEGA 4Y7TA 5JQQA 1INIA 1VICA 1HJLA 4HOCA 1EZIA 3HL3A 1H5SB 4KC4A 5CQOA 1FXJA 3U2WA 5BXCA 1O0RA 1G97A 3SX8A 3ZLLA 4KC1A 2VD4A 4HO8A 4NALA 2ZU9A 2OEGA 4O6MA 1VGWA 3V90A 4CJCA 1H5RB 2W0WA 1V84A 1HM8A 1JV3A 4ECMA 1ZCTA 3F1YA 1LVWA 4KRVA 3POLA 3CKJA 4J18A 1H7QA 2NXVA 1LZ0A 2BO7A 4D11C 2ICXA 2FY7A 2JCJA 1LL2A 3Q80A 4MNDA 4EEMA 2WEEA 4B4MA 5J49A 1YP2A 2Y4JA 2OI5A 4Y7UA 3SX7A 2FYCB 5CMIA 3JUKA 2AM5A 1SS9A 3PKPA 1ZCYA 1FRWA 2ICYA 1R7VA 1VGTA 2V0JA 3V0QA 2Y4KA 1TZFA 1FGXA 4HO4A 2Y4MA 5C4BA 3IOJA 4KNXA 5C49A 1VGZA 1TW5A 3OH3A 3I0FA 5CQNX 1JVGA 4KQLA 2J0AA 3OAMA 4FCUA 5C3DA 4BMAA 4YS8A 2D0JA 2WE9A 4HO2A 3SXCA 2E8BA 1ZI1A 1EYRA 1FR8A 1R7TA 1ZHJA 1JYLA 1H7FA 4DE7A 1GWVA 3V0MA 1JV1A 2I5KA 1ON6A 3USQA 1V82A 3KIAA 1ZDFA 4FRQA 1H7LA 1IIMA 1TVYA 2PGYA 4FRDA 1K4VA 1OMZA 1R82A 5CQLX 1NQIB 4C2SA 2PX7A 4ASYA 1FGGA 2V0IA 1WT3A 1H7TA 3LW6A 1G3LA 1HM0A 2C0NA 4K6RA 4R7PA 3CU0A 1S4OA 5C8RA 1XZ6A 4GBPA 2WVLA 1R7YA 2P73A 4FRMA 4LW6A 1H5SC 1MC3A 2X5ZA 2Q4JA 1G23A 3CGXA 3K8EA 2Z86A 1H4DA 3U0XA 1XHBA 2V0KA 2UX8A 4Y7GA 4Y7FA 2X5SA 5C1HA 2FFUA 3FWWA 4Y63A 2I5EA 1MP3A 4P02A 1H5TA 2A8WA 3I0KA 3N9WA 1S4NA 1G1LA 1LZ7A 4DECA 5CMFX 1FWYA 2QGIA 2RJ8A 3OC9A 3Q7UA 5AJPA 4M4KA 2XMHA 5DDTA 2RIZA 4G87A 4Y7VA 3F1CA 1ZJ2A 3D5NA 3I0GA 2RJ0A 2QH5A 1G95A 4EE5A 4LW3A 4UEGA 1GQCA 4B4GA 3E25A 4ARWA 2OI7A 2O1GA 4P00A 1H7EA 1VZUA 1E5KA 3V0LA 2YCMA 1PZYB 4G3SA 4Q7CA 4B5BA 3JTJA 2RJ9A 3O3PA 5FTSA 1LL0A 5C3BA 3ZGGA 3K8DA 3TQDA 5DDVA 3V91A 1LZJA 5CQMX 1ZI5A 3Q4SA 2VXMA 5L6VA 4EVWA 2VS4A 3QVBA 5C1LA 2YC3A 3V0NA 2A8UA 5EJZA 3SX3A 1V83A 5FU8A 4KPXA 1JYKA 4FROA 3SXAA 5FUHA 2BO8A 2RJ6A 5D91A 5IDTA 1YP3A 2Y6PA 5D92A 1WSZA 4CVHA 4D0ZA 2V0HA 4HO5A 4ASJA 2DPWA 3BCVA 2Z87A 4D11A 1ON8A 3T7NA 2O1FA 4FRHA 4DDZA 2W0VA 3OH4A 2CU2A 1H5SD 3CKQA 1FG5N 4ZDQA 2RJ5A 2FFVA 2YQCA 4CJ8A 5EIYA 1H3MA 2AM4A 5I1FA 1TW1A 3OKRA 1O7OA 2FYAA 3D98A 1MP4A 3TZTA 2VS5A 1WVCA 1VH1A 1VPAA 2VK9A 4FCEA 1GWWA 3R2WA 3OGZA 3PNNA 4KNRA 2I7BA 1ZJ0A 3BRKX 2Y7AA 3T7OA 5HS2A 4XWIA 3RMWA 1ZI3A 1O7QA 4MIXA 3IOIA 5C1GA 4FRBA 3DJ4A 1H7GA 3I0EA 1NKHB 1WT2A 3I0HA 2AM3A 4EE4A 1FO8A 5AJNA 1W55A 3EE5A 5C48A 2ZU8A 3NGWA 5CMGX 4Y6UA 1YP4A 4B4BA 4M2AA 2FYBA 2GGQA 5C36A 1VH3A 3U2VA 2WVKA 2AE7A 4NAIA 2E3DA 4CJBA 2WVMA 5AJOA 2GGOA 4NAKA 4FRPA 5FV9A 1MP5A 4Y62A 1HV9A 1H5SA 1NWGB 1PZTA 4AYLA 4MYBA 3I0IX 2XWMA 3OH2A 1JVDA 1QG8A 4IRPA 3U0YA 3R3IA 4EEOA 3V8ZA 3GUEA 5C4EA 3V0OA 4Y64A 4B2WA 1ZJOA 2QKXA 2VSIA 2RIYA 4B42A 2VFZA 2VXLA 1G0RA 1Z90A 2P72A 4M28A 3D8VA 3JUJA 5C4FA 3E26A 2X60A 4EEAA 3CKNA 5IDSA 2V0LA 2O1HA 3ZLKA 4B2XA 1R7XA 5CMJA 1H4CA 1H5TB 2RJ1A 2APCA 2AH9A 3U2UA 1VM8A 1OMXA 1ZJ1A 4B3UA 3RMVA 1HM9A 1NF5B 4HO9A 2WGZA 3OH0A 4L41C 2RITA 5C4CA 5FYEA 5C4DA 1FO9A 1ZI4A 3T7MA 2XMEA 4KC2A 1R81A 1NMMB 3I0LA 1NHEB 1O23B 1GA8A 3OH1A 4FRAA 4JD0A 1FXOA 4FQWA 1G9RA 4AAWA 1GX4A 2RJ7A 1G93A 1GQ9A 1QGSA 2YQSA 3ZGFA 2OI6A 2YQHA 1ZCVA 2X65A 4EE3A 4KT7A 3SX5A 4HG6A 1WT1A 4E1KA 2AGDA 2YC5A 1LL3A 2AECA 3DK5A 3SPTA 1KWSA 1VZXA 1S4PA 3I0CA 4G3PA 2D7RA 1INJA 4BQHA 1H4EA 3I0DA 4NANA 2Y4LA 3SXGA 1G2VA 1I52A 2MZBA 1ZCUA 4Y6NA 1FZWA 3U2TA 5CQPA 1WT0A 3ST8A 1G8OA 1FR9A 2RJ4A 4FREA 1R80A 4KPZA 2BO6A 5C38A 1HJJA 3I0JA 4IRQA 3U2XA
chains in the Genus database with same CATH topology
2RIXA 3DUVA 3PKQA 2FYDB 4KXOA 3SXEA 2OEFA 4O6NA 4M2BA 3V0PA 3CKOA 2ZU7A 1VGUA 2JCOA 2WAWA 4JISA 3FOQA 1OQMB 1R7UA 2XWLA 2JCLA 1W57A 2D7IA 2VS3A 4FIYA 4FRLA 3SXBA 1VZTA 4HO3A 1IINA 5EJ1A 3RSBA 1GX0A 5C3AA 4G3QA 4HCQA 2YESA 4D48A 2AESA 5C47A 1FOAA 5L6SA 3IOHA 2P6WA 5FU0A 1W77A 2BO4A 5IFYA 1ZDGA 2YQJA 4HO0A 2JCKA 1ZJ3A 1H5RA 4D0TA 4HO6A 4AC3A 3USRA 1QWJA 2VSHA 1QGQA 5CMHA 2PGVA 2PA4A 4FIXA 2J0BA 3ZF8A 1H7HA 5FTVA 4AYJA 1YROB 3V8YA 1LZIA 1ZJPA 3CKVA 2XWNA 4Y9XA 1ZIZA 3SXDA 4EEGA 4Y7TA 5JQQA 1INIA 1VICA 1HJLA 4HOCA 1EZIA 3HL3A 1H5SB 4KC4A 5CQOA 1FXJA 3U2WA 5BXCA 1O0RA 1G97A 3SX8A 3ZLLA 4KC1A 2VD4A 4HO8A 4NALA 2ZU9A 2OEGA 4O6MA 1VGWA 3V90A 4CJCA 1H5RB 2W0WA 1V84A 1HM8A 1JV3A 4ECMA 1ZCTA 3F1YA 1LVWA 4KRVA 3POLA 3CKJA 4J18A 1H7QA 2NXVA 1LZ0A 2BO7A 4D11C 2ICXA 2FY7A 2JCJA 1LL2A 3Q80A 4MNDA 4EEMA 2WEEA 4B4MA 5J49A 1YP2A 2Y4JA 2OI5A 4Y7UA 3SX7A 2FYCB 5CMIA 3JUKA 2AM5A 1SS9A 3PKPA 1ZCYA 1FRWA 2ICYA 1R7VA 1VGTA 2V0JA 3V0QA 2Y4KA 1TZFA 1FGXA 4HO4A 2Y4MA 5C4BA 3IOJA 4KNXA 5C49A 1VGZA 1TW5A 3OH3A 3I0FA 5CQNX 1JVGA 4KQLA 2J0AA 3OAMA 4FCUA 5C3DA 4BMAA 4YS8A 2D0JA 2WE9A 4HO2A 3SXCA 2E8BA 1ZI1A 1EYRA 1FR8A 1R7TA 1ZHJA 1JYLA 1H7FA 4DE7A 1GWVA 3V0MA 1JV1A 2I5KA 1ON6A 3USQA 1V82A 3KIAA 1ZDFA 4FRQA 1H7LA 1IIMA 1TVYA 2PGYA 4FRDA 1K4VA 1OMZA 1R82A 5CQLX 1NQIB 4C2SA 2PX7A 4ASYA 1FGGA 2V0IA 1WT3A 1H7TA 3LW6A 1G3LA 1HM0A 2C0NA 4K6RA 4R7PA 3CU0A 1S4OA 5C8RA 1XZ6A 4GBPA 2WVLA 1R7YA 2P73A 4FRMA 4LW6A 1H5SC 1MC3A 2X5ZA 2Q4JA 1G23A 3CGXA 3K8EA 2Z86A 1H4DA 3U0XA 1XHBA 2V0KA 2UX8A 4Y7GA 4Y7FA 2X5SA 5C1HA 2FFUA 3FWWA 4Y63A 2I5EA 1MP3A 4P02A 1H5TA 2A8WA 3I0KA 3N9WA 1S4NA 1G1LA 1LZ7A 4DECA 5CMFX 1FWYA 2QGIA 2RJ8A 3OC9A 3Q7UA 5AJPA 4M4KA 2XMHA 5DDTA 2RIZA 4G87A 4Y7VA 3F1CA 1ZJ2A 3D5NA 3I0GA 2RJ0A 2QH5A 1G95A 4EE5A 4LW3A 4UEGA 1GQCA 4B4GA 3E25A 4ARWA 2OI7A 2O1GA 4P00A 1H7EA 1VZUA 1E5KA 3V0LA 2YCMA 1PZYB 4G3SA 4Q7CA 4B5BA 3JTJA 2RJ9A 3O3PA 5FTSA 1LL0A 5C3BA 3ZGGA 3K8DA 3TQDA 5DDVA 3V91A 1LZJA 5CQMX 1ZI5A 3Q4SA 2VXMA 5L6VA 4EVWA 2VS4A 3QVBA 5C1LA 2YC3A 3V0NA 2A8UA 5EJZA 3SX3A 1V83A 5FU8A 4KPXA 1JYKA 4FROA 3SXAA 5FUHA 2BO8A 2RJ6A 5D91A 5IDTA 1YP3A 2Y6PA 5D92A 1WSZA 4CVHA 4D0ZA 2V0HA 4HO5A 4ASJA 2DPWA 3BCVA 2Z87A 4D11A 1ON8A 3T7NA 2O1FA 4FRHA 4DDZA 2W0VA 3OH4A 2CU2A 1H5SD 3CKQA 1FG5N 4ZDQA 2RJ5A 2FFVA 2YQCA 4CJ8A 5EIYA 1H3MA 2AM4A 5I1FA 1TW1A 3OKRA 1O7OA 2FYAA 3D98A 1MP4A 3TZTA 2VS5A 1WVCA 1VH1A 1VPAA 2VK9A 4FCEA 1GWWA 3R2WA 3OGZA 3PNNA 4KNRA 2I7BA 1ZJ0A 3BRKX 2Y7AA 3T7OA 5HS2A 4XWIA 3RMWA 1ZI3A 1O7QA 4MIXA 3IOIA 5C1GA 4FRBA 3DJ4A 1H7GA 3I0EA 1NKHB 1WT2A 3I0HA 2AM3A 4EE4A 1FO8A 5AJNA 1W55A 3EE5A 5C48A 2ZU8A 3NGWA 5CMGX 4Y6UA 1YP4A 4B4BA 4M2AA 2FYBA 2GGQA 5C36A 1VH3A 3U2VA 2WVKA 2AE7A 4NAIA 2E3DA 4CJBA 2WVMA 5AJOA 2GGOA 4NAKA 4FRPA 5FV9A 1MP5A 4Y62A 1HV9A 1H5SA 1NWGB 1PZTA 4AYLA 4MYBA 3I0IX 2XWMA 3OH2A 1JVDA 1QG8A 4IRPA 3U0YA 3R3IA 4EEOA 3V8ZA 3GUEA 5C4EA 3V0OA 4Y64A 4B2WA 1ZJOA 2QKXA 2VSIA 2RIYA 4B42A 2VFZA 2VXLA 1G0RA 1Z90A 2P72A 4M28A 3D8VA 3JUJA 5C4FA 3E26A 2X60A 4EEAA 3CKNA 5IDSA 2V0LA 2O1HA 3ZLKA 4B2XA 1R7XA 5CMJA 1H4CA 1H5TB 2RJ1A 2APCA 2AH9A 3U2UA 1VM8A 1OMXA 1ZJ1A 4B3UA 3RMVA 1HM9A 1NF5B 4HO9A 2WGZA 3OH0A 4L41C 2RITA 5C4CA 5FYEA 5C4DA 1FO9A 1ZI4A 3T7MA 2XMEA 4KC2A 1R81A 1NMMB 3I0LA 1NHEB 1O23B 1GA8A 3OH1A 4FRAA 4JD0A 1FXOA 4FQWA 1G9RA 4AAWA 1GX4A 2RJ7A 1G93A 1GQ9A 1QGSA 2YQSA 3ZGFA 2OI6A 2YQHA 1ZCVA 2X65A 4EE3A 4KT7A 3SX5A 4HG6A 1WT1A 4E1KA 2AGDA 2YC5A 1LL3A 2AECA 3DK5A 3SPTA 1KWSA 1VZXA 1S4PA 3I0CA 4G3PA 2D7RA 1INJA 4BQHA 1H4EA 3I0DA 4NANA 2Y4LA 3SXGA 1G2VA 1I52A 2MZBA 1ZCUA 4Y6NA 1FZWA 3U2TA 5CQPA 1WT0A 3ST8A 1G8OA 1FR9A 2RJ4A 4FREA 1R80A 4KPZA 2BO6A 5C38A 1HJJA 3I0JA 4IRQA 3U2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIX A;  3DUV A;  3PKQ A;  2FYD B;  4KXO A;  3SXE A;  2OEF A;  4M2B A;  3V0P A;  3CKO A;  2ZU7 A;  1VGU A;  2JCO A;  2WAW A;  4JIS A;  3FOQ A;  1OQM B;  1R7U A;  2XWL A;  2JCL A;  1W57 A;  2D7I A;  2VS3 A;  4FRL A;  3SXB A;  1VZT A;  4HO3 A;  1IIN A;  5EJ1 A;  3RSB A;  1GX0 A;  5C3A A;  4G3Q A;  4HCQ A;  2YES A;  4D48 A;  2AES A;  5C47 A;  1FOA A;  5L6S A;  3IOH A;  2P6W A;  5FU0 A;  1W77 A;  2BO4 A;  5IFY A;  1ZDG A;  2YQJ A;  4HO0 A;  2JCK A;  1ZJ3 A;  1H5R A;  4D0T A;  4HO6 A;  4AC3 A;  3USR A;  1QWJ A;  2VSH A;  1QGQ A;  5CMH A;  2PGV A;  2PA4 A;  3ZF8 A;  1H7H A;  5FTV A;  4AYJ A;  1YRO B;  3V8Y A;  1LZI A;  1ZJP A;  3CKV A;  2XWN A;  4Y9X A;  1ZIZ A;  3SXD A;  4EEG A;  4Y7T A;  5JQQ A;  1INI A;  1VIC A;  1HJL A;  4HOC A;  1EZI A;  3HL3 A;  1H5S B;  4KC4 A;  5CQO A;  1FXJ A;  3U2W A;  5BXC A;  1O0R A;  1G97 A;  3SX8 A;  3ZLL A;  4KC1 A;  2VD4 A;  4HO8 A;  4NAL A;  2ZU9 A;  2OEG A;  1VGW A;  3V90 A;  4CJC A;  1H5R B;  2W0W A;  1V84 A;  1HM8 A;  1JV3 A;  4ECM A;  1ZCT A;  3F1Y A;  1LVW A;  4KRV A;  3POL A;  3CKJ A;  4J18 A;  1H7Q A;  2NXV A;  1LZ0 A;  2BO7 A;  4D11 C;  2ICX A;  2FY7 A;  2JCJ A;  1LL2 A;  3Q80 A;  4MND A;  4EEM A;  2WEE A;  4B4M A;  5J49 A;  1YP2 A;  2Y4J A;  2OI5 A;  4Y7U A;  3SX7 A;  2FYC B;  5CMI A;  3JUK A;  2AM5 A;  1SS9 A;  3PKP A;  1ZCY A;  1FRW A;  2ICY A;  1R7V A;  1VGT A;  2V0J A;  3V0Q A;  2Y4K A;  1TZF A;  1FGX A;  4HO4 A;  2Y4M A;  5C4B A;  3IOJ A;  4KNX A;  5C49 A;  1VGZ A;  1TW5 A;  3OH3 A;  3I0F A;  5CQN X;  1JVG A;  4KQL A;  3OAM A;  4FCU A;  5C3D A;  4BMA A;  4YS8 A;  2D0J A;  2WE9 A;  4HO2 A;  3SXC A;  2E8B A;  1ZI1 A;  1EYR A;  1FR8 A;  1R7T A;  1ZHJ A;  1JYL A;  1H7F A;  4DE7 A;  1GWV A;  3V0M A;  1JV1 A;  2I5K A;  1ON6 A;  3USQ A;  1V82 A;  3KIA A;  1ZDF A;  4FRQ A;  1H7L A;  1IIM A;  1TVY A;  2PGY A;  4FRD A;  1K4V A;  1OMZ A;  1R82 A;  5CQL X;  1NQI B;  4C2S A;  2PX7 A;  4ASY A;  1FGG A;  2V0I A;  1WT3 A;  1H7T A;  3LW6 A;  1G3L A;  1HM0 A;  4K6R A;  4R7P A;  3CU0 A;  1S4O A;  5C8R A;  1XZ6 A;  4GBP A;  2WVL A;  1R7Y A;  2P73 A;  4FRM A;  4LW6 A;  1H5S C;  1MC3 A;  2X5Z A;  2Q4J A;  1G23 A;  3CGX A;  3K8E A;  2Z86 A;  1H4D A;  3U0X A;  1XHB A;  2V0K A;  2UX8 A;  4Y7G A;  4Y7F A;  2X5S A;  5C1H A;  2FFU A;  3FWW A;  4Y63 A;  2I5E A;  1MP3 A;  4P02 A;  1H5T A;  2A8W A;  3I0K A;  3N9W A;  1S4N A;  1G1L A;  1LZ7 A;  4DEC A;  5CMF X;  1FWY A;  2QGI A;  2RJ8 A;  3OC9 A;  3Q7U A;  5AJP A;  4M4K A;  2XMH A;  5DDT A;  2RIZ A;  4G87 A;  4Y7V A;  3F1C A;  1ZJ2 A;  3D5N A;  3I0G A;  2RJ0 A;  2QH5 A;  1G95 A;  4EE5 A;  4LW3 A;  4UEG A;  1GQC A;  4B4G A;  3E25 A;  4ARW A;  2OI7 A;  2O1G A;  4P00 A;  1H7E A;  1VZU A;  1E5K A;  3V0L A;  2YCM A;  1PZY B;  4G3S A;  4B5B A;  3JTJ A;  2RJ9 A;  3O3P A;  5FTS A;  1LL0 A;  5C3B A;  3ZGG A;  3K8D A;  3TQD A;  5DDV A;  3V91 A;  1LZJ A;  5CQM X;  1ZI5 A;  3Q4S A;  2VXM A;  5L6V A;  4EVW A;  2VS4 A;  3QVB A;  5C1L A;  2YC3 A;  3V0N A;  2A8U A;  5EJZ A;  3SX3 A;  1V83 A;  5FU8 A;  4KPX A;  1JYK A;  4FRO A;  3SXA A;  5FUH A;  2BO8 A;  2RJ6 A;  5IDT A;  1YP3 A;  2Y6P A;  1WSZ A;  4CVH A;  4D0Z A;  2V0H A;  4HO5 A;  4ASJ A;  2DPW A;  3BCV A;  2Z87 A;  4D11 A;  1ON8 A;  3T7N A;  2O1F A;  4FRH A;  4DDZ A;  2W0V A;  3OH4 A;  2CU2 A;  1H5S D;  3CKQ A;  1FG5 N;  4ZDQ A;  2RJ5 A;  2FFV A;  2YQC A;  4CJ8 A;  5EIY A;  1H3M A;  2AM4 A;  5I1F A;  1TW1 A;  3OKR A;  1O7O A;  2FYA A;  3D98 A;  1MP4 A;  3TZT A;  2VS5 A;  1WVC A;  1VH1 A;  1VPA A;  4FCE A;  1GWW A;  3R2W A;  3OGZ A;  3PNN A;  4KNR A;  2I7B A;  1ZJ0 A;  3BRK X;  2Y7A A;  3T7O A;  5HS2 A;  4XWI A;  3RMW A;  1ZI3 A;  1O7Q A;  3IOI A;  5C1G A;  4FRB A;  3DJ4 A;  1H7G A;  3I0E A;  1NKH B;  1WT2 A;  3I0H A;  2AM3 A;  4EE4 A;  1FO8 A;  5AJN A;  1W55 A;  3EE5 A;  5C48 A;  2ZU8 A;  3NGW A;  5CMG X;  4Y6U A;  1YP4 A;  4B4B A;  4M2A A;  2FYB A;  2GGQ A;  5C36 A;  1VH3 A;  3U2V A;  2WVK A;  2AE7 A;  4NAI A;  2E3D A;  4CJB A;  2WVM A;  5AJO A;  2GGO A;  4NAK A;  4FRP A;  5FV9 A;  1MP5 A;  4Y62 A;  1HV9 A;  1H5S A;  1NWG B;  1PZT A;  4AYL A;  4MYB A;  3I0I X;  2XWM A;  3OH2 A;  1JVD A;  1QG8 A;  4IRP A;  3U0Y A;  3R3I A;  4EEO A;  3V8Z A;  3GUE A;  5C4E A;  3V0O A;  4Y64 A;  4B2W A;  1ZJO A;  2QKX A;  2VSI A;  2RIY A;  4B42 A;  2VFZ A;  2VXL A;  1G0R A;  1Z90 A;  2P72 A;  4M28 A;  3D8V A;  3JUJ A;  5C4F A;  3E26 A;  2X60 A;  4EEA A;  3CKN A;  5IDS A;  2V0L A;  2O1H A;  3ZLK A;  4B2X A;  1R7X A;  5CMJ A;  1H4C A;  1H5T B;  2RJ1 A;  2APC A;  2AH9 A;  3U2U A;  1VM8 A;  1OMX A;  1ZJ1 A;  4B3U A;  3RMV A;  1HM9 A;  1NF5 B;  4HO9 A;  2WGZ A;  3OH0 A;  4L41 C;  2RIT A;  5C4C A;  5FYE A;  5C4D A;  1FO9 A;  1ZI4 A;  3T7M A;  2XME A;  4KC2 A;  1R81 A;  1NMM B;  3I0L A;  1NHE B;  1O23 B;  1GA8 A;  3OH1 A;  4FRA A;  4JD0 A;  1FXO A;  4FQW A;  1G9R A;  4AAW A;  1GX4 A;  2RJ7 A;  1G93 A;  1GQ9 A;  1QGS A;  2YQS A;  3ZGF A;  2OI6 A;  2YQH A;  1ZCV A;  2X65 A;  4EE3 A;  4KT7 A;  3SX5 A;  4HG6 A;  1WT1 A;  4E1K A;  2AGD A;  2YC5 A;  1LL3 A;  2AEC A;  3DK5 A;  3SPT A;  1KWS A;  1VZX A;  1S4P A;  3I0C A;  4G3P A;  2D7R A;  1INJ A;  4BQH A;  1H4E A;  3I0D A;  4NAN A;  2Y4L A;  3SXG A;  1G2V A;  1I52 A;  2MZB A;  1ZCU A;  4Y6N A;  1FZW A;  3U2T A;  5CQP A;  1WT0 A;  3ST8 A;  1G8O A;  1FR9 A;  2RJ4 A;  4FRE A;  1R80 A;  4KPZ A;  2BO6 A;  5C38 A;  1HJJ A;  3I0J A;  4IRQ A;  3U2X A; 
#chains in the Genus database with same CATH topology
 2RIX A;  3DUV A;  3PKQ A;  2FYD B;  4KXO A;  3SXE A;  2OEF A;  4O6N A;  4M2B A;  3V0P A;  3CKO A;  2ZU7 A;  1VGU A;  2JCO A;  2WAW A;  4JIS A;  3FOQ A;  1OQM B;  1R7U A;  2XWL A;  2JCL A;  1W57 A;  2D7I A;  2VS3 A;  4FIY A;  4FRL A;  3SXB A;  1VZT A;  4HO3 A;  1IIN A;  5EJ1 A;  3RSB A;  1GX0 A;  5C3A A;  4G3Q A;  4HCQ A;  2YES A;  4D48 A;  2AES A;  5C47 A;  1FOA A;  5L6S A;  3IOH A;  2P6W A;  5FU0 A;  1W77 A;  2BO4 A;  5IFY A;  1ZDG A;  2YQJ A;  4HO0 A;  2JCK A;  1ZJ3 A;  1H5R A;  4D0T A;  4HO6 A;  4AC3 A;  3USR A;  1QWJ A;  2VSH A;  1QGQ A;  5CMH A;  2PGV A;  2PA4 A;  4FIX A;  2J0B A;  3ZF8 A;  1H7H A;  5FTV A;  4AYJ A;  1YRO B;  3V8Y A;  1LZI A;  1ZJP A;  3CKV A;  2XWN A;  4Y9X A;  1ZIZ A;  3SXD A;  4EEG A;  4Y7T A;  5JQQ A;  1INI A;  1VIC A;  1HJL A;  4HOC A;  1EZI A;  3HL3 A;  1H5S B;  4KC4 A;  5CQO A;  1FXJ A;  3U2W A;  5BXC A;  1O0R A;  1G97 A;  3SX8 A;  3ZLL A;  4KC1 A;  2VD4 A;  4HO8 A;  4NAL A;  2ZU9 A;  2OEG A;  4O6M A;  1VGW A;  3V90 A;  4CJC A;  1H5R B;  2W0W A;  1V84 A;  1HM8 A;  1JV3 A;  4ECM A;  1ZCT A;  3F1Y A;  1LVW A;  4KRV A;  3POL A;  3CKJ A;  4J18 A;  1H7Q A;  2NXV A;  1LZ0 A;  2BO7 A;  4D11 C;  2ICX A;  2FY7 A;  2JCJ A;  1LL2 A;  3Q80 A;  4MND A;  4EEM A;  2WEE A;  4B4M A;  5J49 A;  1YP2 A;  2Y4J A;  2OI5 A;  4Y7U A;  3SX7 A;  2FYC B;  5CMI A;  3JUK A;  2AM5 A;  1SS9 A;  3PKP A;  1ZCY A;  1FRW A;  2ICY A;  1R7V A;  1VGT A;  2V0J A;  3V0Q A;  2Y4K A;  1TZF A;  1FGX A;  4HO4 A;  2Y4M A;  5C4B A;  3IOJ A;  4KNX A;  5C49 A;  1VGZ A;  1TW5 A;  3OH3 A;  3I0F A;  5CQN X;  1JVG A;  4KQL A;  2J0A A;  3OAM A;  4FCU A;  5C3D A;  4BMA A;  4YS8 A;  2D0J A;  2WE9 A;  4HO2 A;  3SXC A;  2E8B A;  1ZI1 A;  1EYR A;  1FR8 A;  1R7T A;  1ZHJ A;  1JYL A;  1H7F A;  4DE7 A;  1GWV A;  3V0M A;  1JV1 A;  2I5K A;  1ON6 A;  3USQ A;  1V82 A;  3KIA A;  1ZDF A;  4FRQ A;  1H7L A;  1IIM A;  1TVY A;  2PGY A;  4FRD A;  1K4V A;  1OMZ A;  1R82 A;  5CQL X;  1NQI B;  4C2S A;  2PX7 A;  4ASY A;  1FGG A;  2V0I A;  1WT3 A;  1H7T A;  3LW6 A;  1G3L A;  1HM0 A;  2C0N A;  4K6R A;  4R7P A;  3CU0 A;  1S4O A;  5C8R A;  1XZ6 A;  4GBP A;  2WVL A;  1R7Y A;  2P73 A;  4FRM A;  4LW6 A;  1H5S C;  1MC3 A;  2X5Z A;  2Q4J A;  1G23 A;  3CGX A;  3K8E A;  2Z86 A;  1H4D A;  3U0X A;  1XHB A;  2V0K A;  2UX8 A;  4Y7G A;  4Y7F A;  2X5S A;  5C1H A;  2FFU A;  3FWW A;  4Y63 A;  2I5E A;  1MP3 A;  4P02 A;  1H5T A;  2A8W A;  3I0K A;  3N9W A;  1S4N A;  1G1L A;  1LZ7 A;  4DEC A;  5CMF X;  1FWY A;  2QGI A;  2RJ8 A;  3OC9 A;  3Q7U A;  5AJP A;  4M4K A;  2XMH A;  5DDT A;  2RIZ A;  4G87 A;  4Y7V A;  3F1C A;  1ZJ2 A;  3D5N A;  3I0G A;  2RJ0 A;  2QH5 A;  1G95 A;  4EE5 A;  4LW3 A;  4UEG A;  1GQC A;  4B4G A;  3E25 A;  4ARW A;  2OI7 A;  2O1G A;  4P00 A;  1H7E A;  1VZU A;  1E5K A;  3V0L A;  2YCM A;  1PZY B;  4G3S A;  4Q7C A;  4B5B A;  3JTJ A;  2RJ9 A;  3O3P A;  5FTS A;  1LL0 A;  5C3B A;  3ZGG A;  3K8D A;  3TQD A;  5DDV A;  3V91 A;  1LZJ A;  5CQM X;  1ZI5 A;  3Q4S A;  2VXM A;  5L6V A;  4EVW A;  2VS4 A;  3QVB A;  5C1L A;  2YC3 A;  3V0N A;  2A8U A;  5EJZ A;  3SX3 A;  1V83 A;  5FU8 A;  4KPX A;  1JYK A;  4FRO A;  3SXA A;  5FUH A;  2BO8 A;  2RJ6 A;  5D91 A;  5IDT A;  1YP3 A;  2Y6P A;  5D92 A;  1WSZ A;  4CVH A;  4D0Z A;  2V0H A;  4HO5 A;  4ASJ A;  2DPW A;  3BCV A;  2Z87 A;  4D11 A;  1ON8 A;  3T7N A;  2O1F A;  4FRH A;  4DDZ A;  2W0V A;  3OH4 A;  2CU2 A;  1H5S D;  3CKQ A;  1FG5 N;  4ZDQ A;  2RJ5 A;  2FFV A;  2YQC A;  4CJ8 A;  5EIY A;  1H3M A;  2AM4 A;  5I1F A;  1TW1 A;  3OKR A;  1O7O A;  2FYA A;  3D98 A;  1MP4 A;  3TZT A;  2VS5 A;  1WVC A;  1VH1 A;  1VPA A;  2VK9 A;  4FCE A;  1GWW A;  3R2W A;  3OGZ A;  3PNN A;  4KNR A;  2I7B A;  1ZJ0 A;  3BRK X;  2Y7A A;  3T7O A;  5HS2 A;  4XWI A;  3RMW A;  1ZI3 A;  1O7Q A;  4MIX A;  3IOI A;  5C1G A;  4FRB A;  3DJ4 A;  1H7G A;  3I0E A;  1NKH B;  1WT2 A;  3I0H A;  2AM3 A;  4EE4 A;  1FO8 A;  5AJN A;  1W55 A;  3EE5 A;  5C48 A;  2ZU8 A;  3NGW A;  5CMG X;  4Y6U A;  1YP4 A;  4B4B A;  4M2A A;  2FYB A;  2GGQ A;  5C36 A;  1VH3 A;  3U2V A;  2WVK A;  2AE7 A;  4NAI A;  2E3D A;  4CJB A;  2WVM A;  5AJO A;  2GGO A;  4NAK A;  4FRP A;  5FV9 A;  1MP5 A;  4Y62 A;  1HV9 A;  1H5S A;  1NWG B;  1PZT A;  4AYL A;  4MYB A;  3I0I X;  2XWM A;  3OH2 A;  1JVD A;  1QG8 A;  4IRP A;  3U0Y A;  3R3I A;  4EEO A;  3V8Z A;  3GUE A;  5C4E A;  3V0O A;  4Y64 A;  4B2W A;  1ZJO A;  2QKX A;  2VSI A;  2RIY A;  4B42 A;  2VFZ A;  2VXL A;  1G0R A;  1Z90 A;  2P72 A;  4M28 A;  3D8V A;  3JUJ A;  5C4F A;  3E26 A;  2X60 A;  4EEA A;  3CKN A;  5IDS A;  2V0L A;  2O1H A;  3ZLK A;  4B2X A;  1R7X A;  5CMJ A;  1H4C A;  1H5T B;  2RJ1 A;  2APC A;  2AH9 A;  3U2U A;  1VM8 A;  1OMX A;  1ZJ1 A;  4B3U A;  3RMV A;  1HM9 A;  1NF5 B;  4HO9 A;  2WGZ A;  3OH0 A;  4L41 C;  2RIT A;  5C4C A;  5FYE A;  5C4D A;  1FO9 A;  1ZI4 A;  3T7M A;  2XME A;  4KC2 A;  1R81 A;  1NMM B;  3I0L A;  1NHE B;  1O23 B;  1GA8 A;  3OH1 A;  4FRA A;  4JD0 A;  1FXO A;  4FQW A;  1G9R A;  4AAW A;  1GX4 A;  2RJ7 A;  1G93 A;  1GQ9 A;  1QGS A;  2YQS A;  3ZGF A;  2OI6 A;  2YQH A;  1ZCV A;  2X65 A;  4EE3 A;  4KT7 A;  3SX5 A;  4HG6 A;  1WT1 A;  4E1K A;  2AGD A;  2YC5 A;  1LL3 A;  2AEC A;  3DK5 A;  3SPT A;  1KWS A;  1VZX A;  1S4P A;  3I0C A;  4G3P A;  2D7R A;  1INJ A;  4BQH A;  1H4E A;  3I0D A;  4NAN A;  2Y4L A;  3SXG A;  1G2V A;  1I52 A;  2MZB A;  1ZCU A;  4Y6N A;  1FZW A;  3U2T A;  5CQP A;  1WT0 A;  3ST8 A;  1G8O A;  1FR9 A;  2RJ4 A;  4FRE A;  1R80 A;  4KPZ A;  2BO6 A;  5C38 A;  1HJJ A;  3I0J A;  4IRQ A;  3U2X A; 
#chains in the Genus database with same CATH homology
 2RIX A;  3DUV A;  3PKQ A;  2FYD B;  4KXO A;  3SXE A;  2OEF A;  4O6N A;  4M2B A;  3V0P A;  3CKO A;  2ZU7 A;  1VGU A;  2JCO A;  2WAW A;  4JIS A;  3FOQ A;  1OQM B;  1R7U A;  2XWL A;  2JCL A;  1W57 A;  2D7I A;  2VS3 A;  4FIY A;  4FRL A;  3SXB A;  1VZT A;  4HO3 A;  1IIN A;  5EJ1 A;  3RSB A;  1GX0 A;  5C3A A;  4G3Q A;  4HCQ A;  2YES A;  4D48 A;  2AES A;  5C47 A;  1FOA A;  5L6S A;  3IOH A;  2P6W A;  5FU0 A;  1W77 A;  2BO4 A;  5IFY A;  1ZDG A;  2YQJ A;  4HO0 A;  2JCK A;  1ZJ3 A;  1H5R A;  4D0T A;  4HO6 A;  4AC3 A;  3USR A;  1QWJ A;  2VSH A;  1QGQ A;  5CMH A;  2PGV A;  2PA4 A;  4FIX A;  2J0B A;  3ZF8 A;  1H7H A;  5FTV A;  4AYJ A;  1YRO B;  3V8Y A;  1LZI A;  1ZJP A;  3CKV A;  2XWN A;  4Y9X A;  1ZIZ A;  3SXD A;  4EEG A;  4Y7T A;  5JQQ A;  1INI A;  1VIC A;  1HJL A;  4HOC A;  1EZI A;  3HL3 A;  1H5S B;  4KC4 A;  5CQO A;  1FXJ A;  3U2W A;  5BXC A;  1O0R A;  1G97 A;  3SX8 A;  3ZLL A;  4KC1 A;  2VD4 A;  4HO8 A;  4NAL A;  2ZU9 A;  2OEG A;  4O6M A;  1VGW A;  3V90 A;  4CJC A;  1H5R B;  2W0W A;  1V84 A;  1HM8 A;  1JV3 A;  4ECM A;  1ZCT A;  3F1Y A;  1LVW A;  4KRV A;  3POL A;  3CKJ A;  4J18 A;  1H7Q A;  2NXV A;  1LZ0 A;  2BO7 A;  4D11 C;  2ICX A;  2FY7 A;  2JCJ A;  1LL2 A;  3Q80 A;  4MND A;  4EEM A;  2WEE A;  4B4M A;  5J49 A;  1YP2 A;  2Y4J A;  2OI5 A;  4Y7U A;  3SX7 A;  2FYC B;  5CMI A;  3JUK A;  2AM5 A;  1SS9 A;  3PKP A;  1ZCY A;  1FRW A;  2ICY A;  1R7V A;  1VGT A;  2V0J A;  3V0Q A;  2Y4K A;  1TZF A;  1FGX A;  4HO4 A;  2Y4M A;  5C4B A;  3IOJ A;  4KNX A;  5C49 A;  1VGZ A;  1TW5 A;  3OH3 A;  3I0F A;  5CQN X;  1JVG A;  4KQL A;  2J0A A;  3OAM A;  4FCU A;  5C3D A;  4BMA A;  4YS8 A;  2D0J A;  2WE9 A;  4HO2 A;  3SXC A;  2E8B A;  1ZI1 A;  1EYR A;  1FR8 A;  1R7T A;  1ZHJ A;  1JYL A;  1H7F A;  4DE7 A;  1GWV A;  3V0M A;  1JV1 A;  2I5K A;  1ON6 A;  3USQ A;  1V82 A;  3KIA A;  1ZDF A;  4FRQ A;  1H7L A;  1IIM A;  1TVY A;  2PGY A;  4FRD A;  1K4V A;  1OMZ A;  1R82 A;  5CQL X;  1NQI B;  4C2S A;  2PX7 A;  4ASY A;  1FGG A;  2V0I A;  1WT3 A;  1H7T A;  3LW6 A;  1G3L A;  1HM0 A;  2C0N A;  4K6R A;  4R7P A;  3CU0 A;  1S4O A;  5C8R A;  1XZ6 A;  4GBP A;  2WVL A;  1R7Y A;  2P73 A;  4FRM A;  4LW6 A;  1H5S C;  1MC3 A;  2X5Z A;  2Q4J A;  1G23 A;  3CGX A;  3K8E A;  2Z86 A;  1H4D A;  3U0X A;  1XHB A;  2V0K A;  2UX8 A;  4Y7G A;  4Y7F A;  2X5S A;  5C1H A;  2FFU A;  3FWW A;  4Y63 A;  2I5E A;  1MP3 A;  4P02 A;  1H5T A;  2A8W A;  3I0K A;  3N9W A;  1S4N A;  1G1L A;  1LZ7 A;  4DEC A;  5CMF X;  1FWY A;  2QGI A;  2RJ8 A;  3OC9 A;  3Q7U A;  5AJP A;  4M4K A;  2XMH A;  5DDT A;  2RIZ A;  4G87 A;  4Y7V A;  3F1C A;  1ZJ2 A;  3D5N A;  3I0G A;  2RJ0 A;  2QH5 A;  1G95 A;  4EE5 A;  4LW3 A;  4UEG A;  1GQC A;  4B4G A;  3E25 A;  4ARW A;  2OI7 A;  2O1G A;  4P00 A;  1H7E A;  1VZU A;  1E5K A;  3V0L A;  2YCM A;  1PZY B;  4G3S A;  4Q7C A;  4B5B A;  3JTJ A;  2RJ9 A;  3O3P A;  5FTS A;  1LL0 A;  5C3B A;  3ZGG A;  3K8D A;  3TQD A;  5DDV A;  3V91 A;  1LZJ A;  5CQM X;  1ZI5 A;  3Q4S A;  2VXM A;  5L6V A;  4EVW A;  2VS4 A;  3QVB A;  5C1L A;  2YC3 A;  3V0N A;  2A8U A;  5EJZ A;  3SX3 A;  1V83 A;  5FU8 A;  4KPX A;  1JYK A;  4FRO A;  3SXA A;  5FUH A;  2BO8 A;  2RJ6 A;  5D91 A;  5IDT A;  1YP3 A;  2Y6P A;  5D92 A;  1WSZ A;  4CVH A;  4D0Z A;  2V0H A;  4HO5 A;  4ASJ A;  2DPW A;  3BCV A;  2Z87 A;  4D11 A;  1ON8 A;  3T7N A;  2O1F A;  4FRH A;  4DDZ A;  2W0V A;  3OH4 A;  2CU2 A;  1H5S D;  3CKQ A;  1FG5 N;  4ZDQ A;  2RJ5 A;  2FFV A;  2YQC A;  4CJ8 A;  5EIY A;  1H3M A;  2AM4 A;  5I1F A;  1TW1 A;  3OKR A;  1O7O A;  2FYA A;  3D98 A;  1MP4 A;  3TZT A;  2VS5 A;  1WVC A;  1VH1 A;  1VPA A;  2VK9 A;  4FCE A;  1GWW A;  3R2W A;  3OGZ A;  3PNN A;  4KNR A;  2I7B A;  1ZJ0 A;  3BRK X;  2Y7A A;  3T7O A;  5HS2 A;  4XWI A;  3RMW A;  1ZI3 A;  1O7Q A;  4MIX A;  3IOI A;  5C1G A;  4FRB A;  3DJ4 A;  1H7G A;  3I0E A;  1NKH B;  1WT2 A;  3I0H A;  2AM3 A;  4EE4 A;  1FO8 A;  5AJN A;  1W55 A;  3EE5 A;  5C48 A;  2ZU8 A;  3NGW A;  5CMG X;  4Y6U A;  1YP4 A;  4B4B A;  4M2A A;  2FYB A;  2GGQ A;  5C36 A;  1VH3 A;  3U2V A;  2WVK A;  2AE7 A;  4NAI A;  2E3D A;  4CJB A;  2WVM A;  5AJO A;  2GGO A;  4NAK A;  4FRP A;  5FV9 A;  1MP5 A;  4Y62 A;  1HV9 A;  1H5S A;  1NWG B;  1PZT A;  4AYL A;  4MYB A;  3I0I X;  2XWM A;  3OH2 A;  1JVD A;  1QG8 A;  4IRP A;  3U0Y A;  3R3I A;  4EEO A;  3V8Z A;  3GUE A;  5C4E A;  3V0O A;  4Y64 A;  4B2W A;  1ZJO A;  2QKX A;  2VSI A;  2RIY A;  4B42 A;  2VFZ A;  2VXL A;  1G0R A;  1Z90 A;  2P72 A;  4M28 A;  3D8V A;  3JUJ A;  5C4F A;  3E26 A;  2X60 A;  4EEA A;  3CKN A;  5IDS A;  2V0L A;  2O1H A;  3ZLK A;  4B2X A;  1R7X A;  5CMJ A;  1H4C A;  1H5T B;  2RJ1 A;  2APC A;  2AH9 A;  3U2U A;  1VM8 A;  1OMX A;  1ZJ1 A;  4B3U A;  3RMV A;  1HM9 A;  1NF5 B;  4HO9 A;  2WGZ A;  3OH0 A;  4L41 C;  2RIT A;  5C4C A;  5FYE A;  5C4D A;  1FO9 A;  1ZI4 A;  3T7M A;  2XME A;  4KC2 A;  1R81 A;  1NMM B;  3I0L A;  1NHE B;  1O23 B;  1GA8 A;  3OH1 A;  4FRA A;  4JD0 A;  1FXO A;  4FQW A;  1G9R A;  4AAW A;  1GX4 A;  2RJ7 A;  1G93 A;  1GQ9 A;  1QGS A;  2YQS A;  3ZGF A;  2OI6 A;  2YQH A;  1ZCV A;  2X65 A;  4EE3 A;  4KT7 A;  3SX5 A;  4HG6 A;  1WT1 A;  4E1K A;  2AGD A;  2YC5 A;  1LL3 A;  2AEC A;  3DK5 A;  3SPT A;  1KWS A;  1VZX A;  1S4P A;  3I0C A;  4G3P A;  2D7R A;  1INJ A;  4BQH A;  1H4E A;  3I0D A;  4NAN A;  2Y4L A;  3SXG A;  1G2V A;  1I52 A;  2MZB A;  1ZCU A;  4Y6N A;  1FZW A;  3U2T A;  5CQP A;  1WT0 A;  3ST8 A;  1G8O A;  1FR9 A;  2RJ4 A;  4FRE A;  1R80 A;  4KPZ A;  2BO6 A;  5C38 A;  1HJJ A;  3I0J A;  4IRQ A;  3U2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...