5CMFX

Gta mutant with mercury - e303a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
284
structure length
263
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEHDASHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Glycosyltransfer in mutants of putative catalytic residue Glu303 of the human ABO(H) A and B blood group glycosyltransferases GTA and GTB proceeds through a labile active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 263
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5cmfX00
5FUHA 4NAKA 2P72A 2RJ4A 1NWGB 3SXAA 1H5SA 1K4VA 5CMHA 1HM0A 5DDTA 1S4PA 2NXVA 3V8ZA 1LL3A 3F1CA 2RIYA 3OH1A 3T7OA 3I0FA 2AM4A 4Y64A 4IRPA 3CKNA 2AM5A 1H5TA 1WT3A 3PNNA 1H5RA 2VD4A 4KC4A 2VSHA 1G0RA 3EE5A 3U2VA 1G9RA 1HJLA 1WT0A 4P02A 4JISA 5C1HA 5C4FA 2OEFA 4MYBA 1JVDA 3ZGGA 3CKVA 4CJBA 5CMJA 1HV9A 3POLA 2W0WA 4AYJA 2FYBA 1H5SB 3U2XA 3V0PA 4XWIA 4ASYA 1OMXA 4G3QA 3IOHA 4HO5A 4NALA 2OI6A 2JCOA 4AAWA 3U2TA 3SXEA 1VICA 4G3PA 4YS8A 2AESA 2OEGA 1H5RB 3FWWA 1YP2A 4HO8A 5IFYA 1GA8A 3KIAA 1YROB 4HO9A 2VSIA 2RJ5A 1VGTA 5C48A 5L6SA 1R82A 2RJ0A 3IOJA 1ZCYA 4FRAA 1YP4A 4G3SA 5AJNA 1H7EA 1NQIB 1G95A 2UX8A 4J18A 2AE7A 4FQWA 4HO4A 1FO9A 1ON8A 3OH3A 1H7TA 1WVCA 2WEEA 1JV1A 2Y7AA 1KWSA 4IRQA 1I52A 4DDZA 1LZ7A 2RJ1A 2XMHA 1WT1A 2QKXA 2V0LA 3CKOA 2YESA 2WVLA 2RJ9A 3CU0A 3OKRA 2X60A 2YQSA 1G93A 1ZJOA 4BMAA 4HOCA 5C38A 3USQA 4EE5A 5J49A 2RIZA 1JVGA 4Y6UA 3OH2A 1FR9A 1ZI1A 4FROA 2V0JA 4B42A 4EEAA 1ZJ0A 3SXCA 3U2WA 3T7NA 2OI5A 5CMFX 2I7BA 4DE7A 4B5BA 3R3IA 1FGGA 5CMGX 2D7RA 4KNRA 4B4MA 1LVWA 3DUVA 5FTSA 1TZFA 2YC3A 2QH5A 2V0HA 3I0EA 4HO2A 2WAWA 3Q4SA 2ICYA 4D0TA 1E5KA 2P6WA 2O1FA 2WE9A 3RMVA 2P73A 3Q7UA 4M4KA 2I5KA 4HCQA 4FRBA 4EEGA 2CU2A 3V0QA 4B4BA 5EJZA 2AM3A 4R7PA 4CVHA 1ZJ1A 1ON6A 3D8VA 1NF5B 4NANA 4Y6NA 5JQQA 3V91A 3OC9A 1HM9A 2X65A 2X5ZA 3SX7A 3LW6A 1ZCVA 4FRHA 2VFZA 1LZ0A 3F1YA 1QWJA 1GWVA 4FRPA 3V0NA 3RMWA 5CMIA 1H7HA 3SX5A 4FRQA 4Y7GA 3V8YA 4L41C 2RJ7A 1H7LA 1VM8A 4CJ8A 3PKQA 3ZLLA 1FXOA 1QG8A 3JUJA 3NGWA 1VH3A 2Y4LA 2VXLA 1ZI4A 3BRKX 1HJJA 2I5EA 4P00A 2BO7A 1ZCUA 2RJ8A 4B2XA 1H5TB 1H4EA 4B4GA 1IIMA 1YP3A 4Y7VA 5DDVA 2GGOA 4ZDQA 1LZIA 3V0MA 4D11C 4HO0A 4FCEA 1TVYA 1ZJ2A 4EEMA 1OQMB 5C8RA 1ZDFA 5FYEA 3K8DA 4EEOA 2E3DA 5CQMX 5CQPA 4DECA 2ZU8A 4EE4A 1ZCTA 1FXJA 3TQDA 4JD0A 4E1KA 5CQNX 5I1FA 2ICXA 2W0VA 2A8UA 4KPXA 5C3AA 2D7IA 4EVWA 2Y6PA 1O7QA 1S4NA 1QGQA 2ZU7A 3PKPA 5IDSA 1HM8A 1W57A 4Y62A 1FRWA 2YQHA 1WT2A 2FYAA 1GWWA 4FRDA 3SPTA 1XHBA 1ZHJA 1R80A 4NAIA 1FG5N 1GX0A 1VZXA 1SS9A 4B3UA 1G97A 1PZYB 5IDTA 3ZGFA 4Y9XA 1H4CA 3ST8A 3ZF8A 1G2VA 2JCLA 3GUEA 2V0IA 1FO8A 1H4DA 1ZI5A 3U0YA 3U0XA 1R81A 3HL3A 1G3LA 4G87A 5EJ1A 5C4EA 4FRLA 3I0GA 1FZWA 1R7YA 1W55A 3CKQA 5CQOA 4FCUA 2AH9A 2BO6A 1INJA 2AECA 2YQCA 1V84A 3I0HA 2DPWA 3O3PA 1OMZA 2MZBA 1FGXA 3V0LA 5C4BA 1MC3A 3V90A 3BCVA 2OI7A 4M2BA 1VZTA 2XWNA 1JV3A 3RSBA 3OAMA 1Z90A 2D0JA 2V0KA 3E26A 1V83A 2FFVA 2FY7A 1JYKA 4AYLA 3Q80A 2Y4MA 4Y7FA 1FR8A 1H7QA 4KPZA 1O0RA 4ASJA 4KNXA 1LL0A 4LW3A 3K8EA 1NHEB 1G23A 3SXDA 2VS5A 4Y7UA 1VGUA 5FU0A 3DJ4A 1W77A 4HO6A 2FYCB 4ARWA 2VXMA 5EIYA 1H5SC 2APCA 1VH1A 4B2WA 5FTVA 3USRA 5C3BA 5C4CA 5C1LA 2JCJA 4MNDA 3T7MA 4M28A 2VS3A 3CGXA 4C2SA 1MP5A 1O23B 5CQLX 5HS2A 3ZLKA 2AGDA 4BQHA 1IINA 5FV9A 2Y4JA 4HO3A 2Z87A 3SX3A 1GQCA 2XWMA 2E8BA 4D48A 1H7GA 2XWLA 1R7TA 4D11A 3I0DA 3I0LA 1NMMB 2FYDB 2Y4KA 2WGZA 5C1GA 4FRMA 5C3DA 3IOIA 3JTJA 3I0CA 2O1HA 4KT7A 1ZJ3A 2ZU9A 1FWYA 1H3MA 1S4OA 1PZTA 1JYLA 2VS4A 1LL2A 1VGZA 1G1LA 5C47A 4LW6A 4KC2A 1GX4A 5BXCA 4Y63A 3I0KA 2PA4A 3SXGA 1TW1A 1V82A 1VZUA 1EYRA 3SXBA 4ECMA 4M2AA 1MP4A 1GQ9A 1ZIZA 2GGQA 4EE3A 2WVMA 2RIXA 5C4DA 2PX7A 1QGSA 4FREA 5L6VA 3D98A 2WVKA 4CJCA 1LZJA 2Z86A 1R7VA 2XMEA 1R7XA 3V0OA 5C36A 3U2UA 1O7OA 1EZIA 4KQLA 1XZ6A 3OH0A 2PGYA 4AC3A 1VGWA 1ZDGA 2BO4A 1TW5A 3OGZA 4KC1A 1VPAA 2RITA 3FOQA 2X5SA 3D5NA 2Q4JA 5AJPA 2QGIA 3CKJA 3R2WA 3E25A 3JUKA 3QVBA 4UEGA 5AJOA 1G8OA 3N9WA 2A8WA 2YCMA 4GBPA 3SX8A 2YQJA 1R7UA 1H5SD 3OH4A 3TZTA 1ZJPA 1FOAA 2RJ6A 1WSZA 4KRVA 5C49A 1NKHB 5FU8A 2JCKA 1MP3A 4D0ZA 1INIA 1H7FA 3I0IX 2O1GA 2FFUA 4HG6A 3I0JA 2PGVA 2BO8A 2YC5A 4KXOA 3DK5A 1ZI3A 4K6RA 4Y7TA
chains in the Genus database with same CATH superfamily
5FUHA 4NAKA 2P72A 2RJ4A 1NWGB 3SXAA 1H5SA 1K4VA 5CMHA 1HM0A 5DDTA 1S4PA 2NXVA 3V8ZA 2J0BA 1LL3A 3F1CA 2RIYA 3OH1A 3T7OA 2C0NA 3I0FA 2AM4A 4Y64A 4IRPA 3CKNA 2AM5A 1H5TA 1WT3A 3PNNA 1H5RA 2VD4A 4KC4A 2VSHA 1G0RA 3EE5A 3U2VA 1G9RA 1HJLA 1WT0A 4P02A 4JISA 5C1HA 5C4FA 2OEFA 4MYBA 1JVDA 3ZGGA 3CKVA 4CJBA 5CMJA 1HV9A 3POLA 2W0WA 4AYJA 2FYBA 1H5SB 3U2XA 3V0PA 4XWIA 4ASYA 1OMXA 4G3QA 3IOHA 4HO5A 4NALA 2OI6A 2JCOA 4AAWA 3U2TA 3SXEA 1VICA 4G3PA 4YS8A 2AESA 2OEGA 1H5RB 3FWWA 1YP2A 4HO8A 5IFYA 1GA8A 3KIAA 1YROB 4HO9A 2VSIA 2RJ5A 1VGTA 5C48A 5L6SA 1R82A 2RJ0A 3IOJA 1ZCYA 4FRAA 1YP4A 4G3SA 5AJNA 1H7EA 1NQIB 1G95A 2UX8A 4J18A 2AE7A 4FQWA 4HO4A 1FO9A 1ON8A 3OH3A 1H7TA 1WVCA 2WEEA 1JV1A 2Y7AA 1KWSA 4IRQA 1I52A 4DDZA 1LZ7A 4FIYA 2RJ1A 2XMHA 1WT1A 2QKXA 2V0LA 3CKOA 2YESA 2WVLA 2RJ9A 3CU0A 3OKRA 2X60A 2YQSA 1G93A 1ZJOA 4BMAA 4HOCA 5C38A 3USQA 4EE5A 5J49A 2RIZA 1JVGA 4Y6UA 3OH2A 1FR9A 1ZI1A 4FROA 2V0JA 4B42A 4EEAA 1ZJ0A 3SXCA 3U2WA 3T7NA 2OI5A 5CMFX 2I7BA 4DE7A 4B5BA 3R3IA 1FGGA 5CMGX 2D7RA 4KNRA 4B4MA 1LVWA 3DUVA 4FIXA 5FTSA 1TZFA 2YC3A 2QH5A 2V0HA 3I0EA 4HO2A 2WAWA 3Q4SA 2ICYA 4D0TA 1E5KA 2P6WA 2O1FA 2WE9A 3RMVA 2P73A 3Q7UA 4M4KA 2I5KA 4HCQA 4FRBA 4EEGA 2VK9A 2CU2A 3V0QA 4B4BA 2J0AA 5EJZA 2AM3A 4R7PA 4CVHA 1ZJ1A 1ON6A 3D8VA 1NF5B 4NANA 4Y6NA 5JQQA 3V91A 3OC9A 1HM9A 2X65A 2X5ZA 3SX7A 3LW6A 1ZCVA 4FRHA 2VFZA 1LZ0A 3F1YA 1QWJA 1GWVA 4FRPA 3V0NA 3RMWA 5CMIA 1H7HA 3SX5A 4FRQA 4Y7GA 3V8YA 4L41C 2RJ7A 1H7LA 1VM8A 4CJ8A 3PKQA 3ZLLA 1FXOA 1QG8A 3JUJA 3NGWA 1VH3A 2Y4LA 2VXLA 1ZI4A 3BRKX 1HJJA 2I5EA 4P00A 4Q7CA 2BO7A 1ZCUA 2RJ8A 4B2XA 1H5TB 1H4EA 4B4GA 1IIMA 1YP3A 4Y7VA 5DDVA 2GGOA 4ZDQA 1LZIA 3V0MA 4D11C 4HO0A 4FCEA 1TVYA 1ZJ2A 4EEMA 1OQMB 5C8RA 1ZDFA 5FYEA 3K8DA 4EEOA 5D91A 2E3DA 5CQMX 5CQPA 4DECA 2ZU8A 4EE4A 1ZCTA 1FXJA 3TQDA 4JD0A 4E1KA 5CQNX 5I1FA 2ICXA 2W0VA 2A8UA 4KPXA 5C3AA 2D7IA 4EVWA 2Y6PA 1O7QA 1S4NA 1QGQA 2ZU7A 3PKPA 5IDSA 1HM8A 1W57A 4Y62A 1FRWA 2YQHA 1WT2A 2FYAA 1GWWA 4FRDA 3SPTA 1XHBA 1ZHJA 1R80A 4NAIA 1FG5N 1GX0A 1VZXA 1SS9A 4B3UA 1G97A 1PZYB 5IDTA 3ZGFA 4Y9XA 1H4CA 3ST8A 3ZF8A 1G2VA 2JCLA 3GUEA 2V0IA 1FO8A 1H4DA 1ZI5A 3U0YA 3U0XA 1R81A 3HL3A 1G3LA 4G87A 5EJ1A 5C4EA 4FRLA 3I0GA 1FZWA 1R7YA 1W55A 3CKQA 5CQOA 4FCUA 2AH9A 2BO6A 1INJA 2AECA 2YQCA 1V84A 3I0HA 2DPWA 3O3PA 1OMZA 2MZBA 1FGXA 3V0LA 5C4BA 1MC3A 3V90A 3BCVA 2OI7A 4M2BA 1VZTA 2XWNA 1JV3A 3RSBA 3OAMA 1Z90A 2D0JA 2V0KA 3E26A 1V83A 2FFVA 2FY7A 1JYKA 4AYLA 3Q80A 2Y4MA 4Y7FA 1FR8A 1H7QA 4KPZA 1O0RA 4ASJA 4KNXA 1LL0A 4LW3A 3K8EA 1NHEB 4MIXA 1G23A 3SXDA 2VS5A 4Y7UA 1VGUA 5FU0A 3DJ4A 1W77A 4HO6A 2FYCB 4ARWA 2VXMA 5EIYA 1H5SC 2APCA 1VH1A 4B2WA 4O6MA 5FTVA 3USRA 5C3BA 5C4CA 5C1LA 2JCJA 4MNDA 3T7MA 4M28A 2VS3A 3CGXA 4C2SA 1MP5A 1O23B 5CQLX 5HS2A 3ZLKA 2AGDA 4BQHA 1IINA 5FV9A 2Y4JA 4HO3A 5D92A 2Z87A 3SX3A 1GQCA 2XWMA 2E8BA 4D48A 1H7GA 2XWLA 1R7TA 4D11A 3I0DA 3I0LA 1NMMB 2FYDB 2Y4KA 2WGZA 5C1GA 4FRMA 5C3DA 3IOIA 3JTJA 3I0CA 2O1HA 4KT7A 1ZJ3A 2ZU9A 1FWYA 1H3MA 1S4OA 1PZTA 1JYLA 2VS4A 1LL2A 1VGZA 1G1LA 5C47A 4LW6A 4KC2A 1GX4A 5BXCA 4Y63A 3I0KA 2PA4A 3SXGA 1TW1A 1V82A 1VZUA 1EYRA 3SXBA 4ECMA 4M2AA 1MP4A 1GQ9A 1ZIZA 2GGQA 4EE3A 2WVMA 2RIXA 5C4DA 2PX7A 1QGSA 4O6NA 4FREA 5L6VA 3D98A 2WVKA 4CJCA 1LZJA 2Z86A 1R7VA 2XMEA 1R7XA 3V0OA 5C36A 3U2UA 1O7OA 1EZIA 4KQLA 1XZ6A 3OH0A 2PGYA 4AC3A 1VGWA 1ZDGA 2BO4A 1TW5A 3OGZA 4KC1A 1VPAA 2RITA 3FOQA 2X5SA 3D5NA 2Q4JA 5AJPA 2QGIA 3CKJA 3R2WA 3E25A 3JUKA 3QVBA 4UEGA 5AJOA 1G8OA 3N9WA 2A8WA 2YCMA 4GBPA 3SX8A 2YQJA 1R7UA 1H5SD 3OH4A 3TZTA 1ZJPA 1FOAA 2RJ6A 1WSZA 4KRVA 5C49A 1NKHB 5FU8A 2JCKA 1MP3A 4D0ZA 1INIA 1H7FA 3I0IX 2O1GA 2FFUA 4HG6A 3I0JA 2PGVA 2BO8A 2YC5A 4KXOA 3DK5A 1ZI3A 4K6RA 4Y7TA
chains in the Genus database with same CATH topology
5FUHA 4NAKA 2P72A 2RJ4A 1NWGB 3SXAA 1H5SA 1K4VA 5CMHA 1HM0A 5DDTA 1S4PA 2NXVA 3V8ZA 2J0BA 1LL3A 3F1CA 2RIYA 3OH1A 3T7OA 2C0NA 3I0FA 2AM4A 4Y64A 4IRPA 3CKNA 2AM5A 1H5TA 1WT3A 3PNNA 1H5RA 2VD4A 4KC4A 2VSHA 1G0RA 3EE5A 3U2VA 1G9RA 1HJLA 1WT0A 4P02A 4JISA 5C1HA 5C4FA 2OEFA 4MYBA 1JVDA 3ZGGA 3CKVA 4CJBA 5CMJA 1HV9A 3POLA 2W0WA 4AYJA 2FYBA 1H5SB 3U2XA 3V0PA 4XWIA 4ASYA 1OMXA 4G3QA 3IOHA 4HO5A 4NALA 2OI6A 2JCOA 4AAWA 3U2TA 3SXEA 1VICA 4G3PA 4YS8A 2AESA 2OEGA 1H5RB 3FWWA 1YP2A 4HO8A 5IFYA 1GA8A 3KIAA 1YROB 4HO9A 2VSIA 2RJ5A 1VGTA 5C48A 5L6SA 1R82A 2RJ0A 3IOJA 1ZCYA 4FRAA 1YP4A 4G3SA 5AJNA 1H7EA 1NQIB 1G95A 2UX8A 4J18A 2AE7A 4FQWA 4HO4A 1FO9A 1ON8A 3OH3A 1H7TA 1WVCA 2WEEA 1JV1A 2Y7AA 1KWSA 4IRQA 1I52A 4DDZA 1LZ7A 4FIYA 2RJ1A 2XMHA 1WT1A 2QKXA 2V0LA 3CKOA 2YESA 2WVLA 2RJ9A 3CU0A 3OKRA 2X60A 2YQSA 1G93A 1ZJOA 4BMAA 4HOCA 5C38A 3USQA 4EE5A 5J49A 2RIZA 1JVGA 4Y6UA 3OH2A 1FR9A 1ZI1A 4FROA 2V0JA 4B42A 4EEAA 1ZJ0A 3SXCA 3U2WA 3T7NA 2OI5A 5CMFX 2I7BA 4DE7A 4B5BA 3R3IA 1FGGA 5CMGX 2D7RA 4KNRA 4B4MA 1LVWA 3DUVA 4FIXA 5FTSA 1TZFA 2YC3A 2QH5A 2V0HA 3I0EA 4HO2A 2WAWA 3Q4SA 2ICYA 4D0TA 1E5KA 2P6WA 2O1FA 2WE9A 3RMVA 2P73A 3Q7UA 4M4KA 2I5KA 4HCQA 4FRBA 4EEGA 2VK9A 2CU2A 3V0QA 4B4BA 2J0AA 5EJZA 2AM3A 4R7PA 4CVHA 1ZJ1A 1ON6A 3D8VA 1NF5B 4NANA 4Y6NA 5JQQA 3V91A 3OC9A 1HM9A 2X65A 2X5ZA 3SX7A 3LW6A 1ZCVA 4FRHA 2VFZA 1LZ0A 3F1YA 1QWJA 1GWVA 4FRPA 3V0NA 3RMWA 5CMIA 1H7HA 3SX5A 4FRQA 4Y7GA 3V8YA 4L41C 2RJ7A 1H7LA 1VM8A 4CJ8A 3PKQA 3ZLLA 1FXOA 1QG8A 3JUJA 3NGWA 1VH3A 2Y4LA 2VXLA 1ZI4A 3BRKX 1HJJA 2I5EA 4P00A 4Q7CA 2BO7A 1ZCUA 2RJ8A 4B2XA 1H5TB 1H4EA 4B4GA 1IIMA 1YP3A 4Y7VA 5DDVA 2GGOA 4ZDQA 1LZIA 3V0MA 4D11C 4HO0A 4FCEA 1TVYA 1ZJ2A 4EEMA 1OQMB 5C8RA 1ZDFA 5FYEA 3K8DA 4EEOA 5D91A 2E3DA 5CQMX 5CQPA 4DECA 2ZU8A 4EE4A 1ZCTA 1FXJA 3TQDA 4JD0A 4E1KA 5CQNX 5I1FA 2ICXA 2W0VA 2A8UA 4KPXA 5C3AA 2D7IA 4EVWA 2Y6PA 1O7QA 1S4NA 1QGQA 2ZU7A 3PKPA 5IDSA 1HM8A 1W57A 4Y62A 1FRWA 2YQHA 1WT2A 2FYAA 1GWWA 4FRDA 3SPTA 1XHBA 1ZHJA 1R80A 4NAIA 1FG5N 1GX0A 1VZXA 1SS9A 4B3UA 1G97A 1PZYB 5IDTA 3ZGFA 4Y9XA 1H4CA 3ST8A 3ZF8A 1G2VA 2JCLA 3GUEA 2V0IA 1FO8A 1H4DA 1ZI5A 3U0YA 3U0XA 1R81A 3HL3A 1G3LA 4G87A 5EJ1A 5C4EA 4FRLA 3I0GA 1FZWA 1R7YA 1W55A 3CKQA 5CQOA 4FCUA 2AH9A 2BO6A 1INJA 2AECA 2YQCA 1V84A 3I0HA 2DPWA 3O3PA 1OMZA 2MZBA 1FGXA 3V0LA 5C4BA 1MC3A 3V90A 3BCVA 2OI7A 4M2BA 1VZTA 2XWNA 1JV3A 3RSBA 3OAMA 1Z90A 2D0JA 2V0KA 3E26A 1V83A 2FFVA 2FY7A 1JYKA 4AYLA 3Q80A 2Y4MA 4Y7FA 1FR8A 1H7QA 4KPZA 1O0RA 4ASJA 4KNXA 1LL0A 4LW3A 3K8EA 1NHEB 4MIXA 1G23A 3SXDA 2VS5A 4Y7UA 1VGUA 5FU0A 3DJ4A 1W77A 4HO6A 2FYCB 4ARWA 2VXMA 5EIYA 1H5SC 2APCA 1VH1A 4B2WA 4O6MA 5FTVA 3USRA 5C3BA 5C4CA 5C1LA 2JCJA 4MNDA 3T7MA 4M28A 2VS3A 3CGXA 4C2SA 1MP5A 1O23B 5CQLX 5HS2A 3ZLKA 2AGDA 4BQHA 1IINA 5FV9A 2Y4JA 4HO3A 5D92A 2Z87A 3SX3A 1GQCA 2XWMA 2E8BA 4D48A 1H7GA 2XWLA 1R7TA 4D11A 3I0DA 3I0LA 1NMMB 2FYDB 2Y4KA 2WGZA 5C1GA 4FRMA 5C3DA 3IOIA 3JTJA 3I0CA 2O1HA 4KT7A 1ZJ3A 2ZU9A 1FWYA 1H3MA 1S4OA 1PZTA 1JYLA 2VS4A 1LL2A 1VGZA 1G1LA 5C47A 4LW6A 4KC2A 1GX4A 5BXCA 4Y63A 3I0KA 2PA4A 3SXGA 1TW1A 1V82A 1VZUA 1EYRA 3SXBA 4ECMA 4M2AA 1MP4A 1GQ9A 1ZIZA 2GGQA 4EE3A 2WVMA 2RIXA 5C4DA 2PX7A 1QGSA 4O6NA 4FREA 5L6VA 3D98A 2WVKA 4CJCA 1LZJA 2Z86A 1R7VA 2XMEA 1R7XA 3V0OA 5C36A 3U2UA 1O7OA 1EZIA 4KQLA 1XZ6A 3OH0A 2PGYA 4AC3A 1VGWA 1ZDGA 2BO4A 1TW5A 3OGZA 4KC1A 1VPAA 2RITA 3FOQA 2X5SA 3D5NA 2Q4JA 5AJPA 2QGIA 3CKJA 3R2WA 3E25A 3JUKA 3QVBA 4UEGA 5AJOA 1G8OA 3N9WA 2A8WA 2YCMA 4GBPA 3SX8A 2YQJA 1R7UA 1H5SD 3OH4A 3TZTA 1ZJPA 1FOAA 2RJ6A 1WSZA 4KRVA 5C49A 1NKHB 5FU8A 2JCKA 1MP3A 4D0ZA 1INIA 1H7FA 3I0IX 2O1GA 2FFUA 4HG6A 3I0JA 2PGVA 2BO8A 2YC5A 4KXOA 3DK5A 1ZI3A 4K6RA 4Y7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUH A;  4NAK A;  2P72 A;  2RJ4 A;  1NWG B;  3SXA A;  1H5S A;  1K4V A;  5CMH A;  1HM0 A;  5DDT A;  1S4P A;  2NXV A;  3V8Z A;  1LL3 A;  3F1C A;  2RIY A;  3OH1 A;  3T7O A;  3I0F A;  2AM4 A;  4Y64 A;  4IRP A;  3CKN A;  2AM5 A;  1H5T A;  1WT3 A;  3PNN A;  1H5R A;  2VD4 A;  4KC4 A;  2VSH A;  1G0R A;  3EE5 A;  3U2V A;  1G9R A;  1HJL A;  1WT0 A;  4P02 A;  4JIS A;  5C1H A;  5C4F A;  2OEF A;  4MYB A;  1JVD A;  3ZGG A;  3CKV A;  4CJB A;  5CMJ A;  1HV9 A;  3POL A;  2W0W A;  4AYJ A;  2FYB A;  1H5S B;  3U2X A;  3V0P A;  4XWI A;  4ASY A;  1OMX A;  4G3Q A;  3IOH A;  4HO5 A;  4NAL A;  2OI6 A;  2JCO A;  4AAW A;  3U2T A;  3SXE A;  1VIC A;  4G3P A;  4YS8 A;  2AES A;  2OEG A;  1H5R B;  3FWW A;  1YP2 A;  4HO8 A;  5IFY A;  1GA8 A;  3KIA A;  1YRO B;  4HO9 A;  2VSI A;  2RJ5 A;  1VGT A;  5C48 A;  5L6S A;  1R82 A;  2RJ0 A;  3IOJ A;  1ZCY A;  4FRA A;  1YP4 A;  4G3S A;  5AJN A;  1H7E A;  1NQI B;  1G95 A;  2UX8 A;  4J18 A;  2AE7 A;  4FQW A;  4HO4 A;  1FO9 A;  1ON8 A;  3OH3 A;  1H7T A;  1WVC A;  2WEE A;  1JV1 A;  2Y7A A;  1KWS A;  4IRQ A;  1I52 A;  4DDZ A;  1LZ7 A;  2RJ1 A;  2XMH A;  1WT1 A;  2QKX A;  2V0L A;  3CKO A;  2YES A;  2WVL A;  2RJ9 A;  3CU0 A;  3OKR A;  2X60 A;  2YQS A;  1G93 A;  1ZJO A;  4BMA A;  4HOC A;  5C38 A;  3USQ A;  4EE5 A;  5J49 A;  2RIZ A;  1JVG A;  4Y6U A;  3OH2 A;  1FR9 A;  1ZI1 A;  4FRO A;  2V0J A;  4B42 A;  4EEA A;  1ZJ0 A;  3SXC A;  3U2W A;  3T7N A;  2OI5 A;  5CMF X;  2I7B A;  4DE7 A;  4B5B A;  3R3I A;  1FGG A;  5CMG X;  2D7R A;  4KNR A;  4B4M A;  1LVW A;  3DUV A;  5FTS A;  1TZF A;  2YC3 A;  2QH5 A;  2V0H A;  3I0E A;  4HO2 A;  2WAW A;  3Q4S A;  2ICY A;  4D0T A;  1E5K A;  2P6W A;  2O1F A;  2WE9 A;  3RMV A;  2P73 A;  3Q7U A;  4M4K A;  2I5K A;  4HCQ A;  4FRB A;  4EEG A;  2CU2 A;  3V0Q A;  4B4B A;  5EJZ A;  2AM3 A;  4R7P A;  4CVH A;  1ZJ1 A;  1ON6 A;  3D8V A;  1NF5 B;  4NAN A;  4Y6N A;  5JQQ A;  3V91 A;  3OC9 A;  1HM9 A;  2X65 A;  2X5Z A;  3SX7 A;  3LW6 A;  1ZCV A;  4FRH A;  2VFZ A;  1LZ0 A;  3F1Y A;  1QWJ A;  1GWV A;  4FRP A;  3V0N A;  3RMW A;  5CMI A;  1H7H A;  3SX5 A;  4FRQ A;  4Y7G A;  3V8Y A;  4L41 C;  2RJ7 A;  1H7L A;  1VM8 A;  4CJ8 A;  3PKQ A;  3ZLL A;  1FXO A;  1QG8 A;  3JUJ A;  3NGW A;  1VH3 A;  2Y4L A;  2VXL A;  1ZI4 A;  3BRK X;  1HJJ A;  2I5E A;  4P00 A;  2BO7 A;  1ZCU A;  2RJ8 A;  4B2X A;  1H5T B;  1H4E A;  4B4G A;  1IIM A;  1YP3 A;  4Y7V A;  5DDV A;  2GGO A;  4ZDQ A;  1LZI A;  3V0M A;  4D11 C;  4HO0 A;  4FCE A;  1TVY A;  1ZJ2 A;  4EEM A;  1OQM B;  5C8R A;  1ZDF A;  5FYE A;  3K8D A;  4EEO A;  2E3D A;  5CQM X;  5CQP A;  4DEC A;  2ZU8 A;  4EE4 A;  1ZCT A;  1FXJ A;  3TQD A;  4JD0 A;  4E1K A;  5CQN X;  5I1F A;  2ICX A;  2W0V A;  2A8U A;  4KPX A;  5C3A A;  2D7I A;  4EVW A;  2Y6P A;  1O7Q A;  1S4N A;  1QGQ A;  2ZU7 A;  3PKP A;  5IDS A;  1HM8 A;  1W57 A;  4Y62 A;  1FRW A;  2YQH A;  1WT2 A;  2FYA A;  1GWW A;  4FRD A;  3SPT A;  1XHB A;  1ZHJ A;  1R80 A;  4NAI A;  1FG5 N;  1GX0 A;  1VZX A;  1SS9 A;  4B3U A;  1G97 A;  1PZY B;  5IDT A;  3ZGF A;  4Y9X A;  1H4C A;  3ST8 A;  3ZF8 A;  1G2V A;  2JCL A;  3GUE A;  2V0I A;  1FO8 A;  1H4D A;  1ZI5 A;  3U0Y A;  3U0X A;  1R81 A;  3HL3 A;  1G3L A;  4G87 A;  5EJ1 A;  5C4E A;  4FRL A;  3I0G A;  1FZW A;  1R7Y A;  1W55 A;  3CKQ A;  5CQO A;  4FCU A;  2AH9 A;  2BO6 A;  1INJ A;  2AEC A;  2YQC A;  1V84 A;  3I0H A;  2DPW A;  3O3P A;  1OMZ A;  2MZB A;  1FGX A;  3V0L A;  5C4B A;  1MC3 A;  3V90 A;  3BCV A;  2OI7 A;  4M2B A;  1VZT A;  2XWN A;  1JV3 A;  3RSB A;  3OAM A;  1Z90 A;  2D0J A;  2V0K A;  3E26 A;  1V83 A;  2FFV A;  2FY7 A;  1JYK A;  4AYL A;  3Q80 A;  2Y4M A;  4Y7F A;  1FR8 A;  1H7Q A;  4KPZ A;  1O0R A;  4ASJ A;  4KNX A;  1LL0 A;  4LW3 A;  3K8E A;  1NHE B;  1G23 A;  3SXD A;  2VS5 A;  4Y7U A;  1VGU A;  5FU0 A;  3DJ4 A;  1W77 A;  4HO6 A;  2FYC B;  4ARW A;  2VXM A;  5EIY A;  1H5S C;  2APC A;  1VH1 A;  4B2W A;  5FTV A;  3USR A;  5C3B A;  5C4C A;  5C1L A;  2JCJ A;  4MND A;  3T7M A;  4M28 A;  2VS3 A;  3CGX A;  4C2S A;  1MP5 A;  1O23 B;  5CQL X;  5HS2 A;  3ZLK A;  2AGD A;  4BQH A;  1IIN A;  5FV9 A;  2Y4J A;  4HO3 A;  2Z87 A;  3SX3 A;  1GQC A;  2XWM A;  2E8B A;  4D48 A;  1H7G A;  2XWL A;  1R7T A;  4D11 A;  3I0D A;  3I0L A;  1NMM B;  2FYD B;  2Y4K A;  2WGZ A;  5C1G A;  4FRM A;  5C3D A;  3IOI A;  3JTJ A;  3I0C A;  2O1H A;  4KT7 A;  1ZJ3 A;  2ZU9 A;  1FWY A;  1H3M A;  1S4O A;  1PZT A;  1JYL A;  2VS4 A;  1LL2 A;  1VGZ A;  1G1L A;  5C47 A;  4LW6 A;  4KC2 A;  1GX4 A;  5BXC A;  4Y63 A;  3I0K A;  2PA4 A;  3SXG A;  1TW1 A;  1V82 A;  1VZU A;  1EYR A;  3SXB A;  4ECM A;  4M2A A;  1MP4 A;  1GQ9 A;  1ZIZ A;  2GGQ A;  4EE3 A;  2WVM A;  2RIX A;  5C4D A;  2PX7 A;  1QGS A;  4FRE A;  5L6V A;  3D98 A;  2WVK A;  4CJC A;  1LZJ A;  2Z86 A;  1R7V A;  2XME A;  1R7X A;  3V0O A;  5C36 A;  3U2U A;  1O7O A;  1EZI A;  4KQL A;  1XZ6 A;  3OH0 A;  2PGY A;  4AC3 A;  1VGW A;  1ZDG A;  2BO4 A;  1TW5 A;  3OGZ A;  4KC1 A;  1VPA A;  2RIT A;  3FOQ A;  2X5S A;  3D5N A;  2Q4J A;  5AJP A;  2QGI A;  3CKJ A;  3R2W A;  3E25 A;  3JUK A;  3QVB A;  4UEG A;  5AJO A;  1G8O A;  3N9W A;  2A8W A;  2YCM A;  4GBP A;  3SX8 A;  2YQJ A;  1R7U A;  1H5S D;  3OH4 A;  3TZT A;  1ZJP A;  1FOA A;  2RJ6 A;  1WSZ A;  4KRV A;  5C49 A;  1NKH B;  5FU8 A;  2JCK A;  1MP3 A;  4D0Z A;  1INI A;  1H7F A;  3I0I X;  2O1G A;  2FFU A;  4HG6 A;  3I0J A;  2PGV A;  2BO8 A;  2YC5 A;  4KXO A;  3DK5 A;  1ZI3 A;  4K6R A;  4Y7T A; 
#chains in the Genus database with same CATH topology
 5FUH A;  4NAK A;  2P72 A;  2RJ4 A;  1NWG B;  3SXA A;  1H5S A;  1K4V A;  5CMH A;  1HM0 A;  5DDT A;  1S4P A;  2NXV A;  3V8Z A;  2J0B A;  1LL3 A;  3F1C A;  2RIY A;  3OH1 A;  3T7O A;  2C0N A;  3I0F A;  2AM4 A;  4Y64 A;  4IRP A;  3CKN A;  2AM5 A;  1H5T A;  1WT3 A;  3PNN A;  1H5R A;  2VD4 A;  4KC4 A;  2VSH A;  1G0R A;  3EE5 A;  3U2V A;  1G9R A;  1HJL A;  1WT0 A;  4P02 A;  4JIS A;  5C1H A;  5C4F A;  2OEF A;  4MYB A;  1JVD A;  3ZGG A;  3CKV A;  4CJB A;  5CMJ A;  1HV9 A;  3POL A;  2W0W A;  4AYJ A;  2FYB A;  1H5S B;  3U2X A;  3V0P A;  4XWI A;  4ASY A;  1OMX A;  4G3Q A;  3IOH A;  4HO5 A;  4NAL A;  2OI6 A;  2JCO A;  4AAW A;  3U2T A;  3SXE A;  1VIC A;  4G3P A;  4YS8 A;  2AES A;  2OEG A;  1H5R B;  3FWW A;  1YP2 A;  4HO8 A;  5IFY A;  1GA8 A;  3KIA A;  1YRO B;  4HO9 A;  2VSI A;  2RJ5 A;  1VGT A;  5C48 A;  5L6S A;  1R82 A;  2RJ0 A;  3IOJ A;  1ZCY A;  4FRA A;  1YP4 A;  4G3S A;  5AJN A;  1H7E A;  1NQI B;  1G95 A;  2UX8 A;  4J18 A;  2AE7 A;  4FQW A;  4HO4 A;  1FO9 A;  1ON8 A;  3OH3 A;  1H7T A;  1WVC A;  2WEE A;  1JV1 A;  2Y7A A;  1KWS A;  4IRQ A;  1I52 A;  4DDZ A;  1LZ7 A;  4FIY A;  2RJ1 A;  2XMH A;  1WT1 A;  2QKX A;  2V0L A;  3CKO A;  2YES A;  2WVL A;  2RJ9 A;  3CU0 A;  3OKR A;  2X60 A;  2YQS A;  1G93 A;  1ZJO A;  4BMA A;  4HOC A;  5C38 A;  3USQ A;  4EE5 A;  5J49 A;  2RIZ A;  1JVG A;  4Y6U A;  3OH2 A;  1FR9 A;  1ZI1 A;  4FRO A;  2V0J A;  4B42 A;  4EEA A;  1ZJ0 A;  3SXC A;  3U2W A;  3T7N A;  2OI5 A;  5CMF X;  2I7B A;  4DE7 A;  4B5B A;  3R3I A;  1FGG A;  5CMG X;  2D7R A;  4KNR A;  4B4M A;  1LVW A;  3DUV A;  4FIX A;  5FTS A;  1TZF A;  2YC3 A;  2QH5 A;  2V0H A;  3I0E A;  4HO2 A;  2WAW A;  3Q4S A;  2ICY A;  4D0T A;  1E5K A;  2P6W A;  2O1F A;  2WE9 A;  3RMV A;  2P73 A;  3Q7U A;  4M4K A;  2I5K A;  4HCQ A;  4FRB A;  4EEG A;  2VK9 A;  2CU2 A;  3V0Q A;  4B4B A;  2J0A A;  5EJZ A;  2AM3 A;  4R7P A;  4CVH A;  1ZJ1 A;  1ON6 A;  3D8V A;  1NF5 B;  4NAN A;  4Y6N A;  5JQQ A;  3V91 A;  3OC9 A;  1HM9 A;  2X65 A;  2X5Z A;  3SX7 A;  3LW6 A;  1ZCV A;  4FRH A;  2VFZ A;  1LZ0 A;  3F1Y A;  1QWJ A;  1GWV A;  4FRP A;  3V0N A;  3RMW A;  5CMI A;  1H7H A;  3SX5 A;  4FRQ A;  4Y7G A;  3V8Y A;  4L41 C;  2RJ7 A;  1H7L A;  1VM8 A;  4CJ8 A;  3PKQ A;  3ZLL A;  1FXO A;  1QG8 A;  3JUJ A;  3NGW A;  1VH3 A;  2Y4L A;  2VXL A;  1ZI4 A;  3BRK X;  1HJJ A;  2I5E A;  4P00 A;  4Q7C A;  2BO7 A;  1ZCU A;  2RJ8 A;  4B2X A;  1H5T B;  1H4E A;  4B4G A;  1IIM A;  1YP3 A;  4Y7V A;  5DDV A;  2GGO A;  4ZDQ A;  1LZI A;  3V0M A;  4D11 C;  4HO0 A;  4FCE A;  1TVY A;  1ZJ2 A;  4EEM A;  1OQM B;  5C8R A;  1ZDF A;  5FYE A;  3K8D A;  4EEO A;  5D91 A;  2E3D A;  5CQM X;  5CQP A;  4DEC A;  2ZU8 A;  4EE4 A;  1ZCT A;  1FXJ A;  3TQD A;  4JD0 A;  4E1K A;  5CQN X;  5I1F A;  2ICX A;  2W0V A;  2A8U A;  4KPX A;  5C3A A;  2D7I A;  4EVW A;  2Y6P A;  1O7Q A;  1S4N A;  1QGQ A;  2ZU7 A;  3PKP A;  5IDS A;  1HM8 A;  1W57 A;  4Y62 A;  1FRW A;  2YQH A;  1WT2 A;  2FYA A;  1GWW A;  4FRD A;  3SPT A;  1XHB A;  1ZHJ A;  1R80 A;  4NAI A;  1FG5 N;  1GX0 A;  1VZX A;  1SS9 A;  4B3U A;  1G97 A;  1PZY B;  5IDT A;  3ZGF A;  4Y9X A;  1H4C A;  3ST8 A;  3ZF8 A;  1G2V A;  2JCL A;  3GUE A;  2V0I A;  1FO8 A;  1H4D A;  1ZI5 A;  3U0Y A;  3U0X A;  1R81 A;  3HL3 A;  1G3L A;  4G87 A;  5EJ1 A;  5C4E A;  4FRL A;  3I0G A;  1FZW A;  1R7Y A;  1W55 A;  3CKQ A;  5CQO A;  4FCU A;  2AH9 A;  2BO6 A;  1INJ A;  2AEC A;  2YQC A;  1V84 A;  3I0H A;  2DPW A;  3O3P A;  1OMZ A;  2MZB A;  1FGX A;  3V0L A;  5C4B A;  1MC3 A;  3V90 A;  3BCV A;  2OI7 A;  4M2B A;  1VZT A;  2XWN A;  1JV3 A;  3RSB A;  3OAM A;  1Z90 A;  2D0J A;  2V0K A;  3E26 A;  1V83 A;  2FFV A;  2FY7 A;  1JYK A;  4AYL A;  3Q80 A;  2Y4M A;  4Y7F A;  1FR8 A;  1H7Q A;  4KPZ A;  1O0R A;  4ASJ A;  4KNX A;  1LL0 A;  4LW3 A;  3K8E A;  1NHE B;  4MIX A;  1G23 A;  3SXD A;  2VS5 A;  4Y7U A;  1VGU A;  5FU0 A;  3DJ4 A;  1W77 A;  4HO6 A;  2FYC B;  4ARW A;  2VXM A;  5EIY A;  1H5S C;  2APC A;  1VH1 A;  4B2W A;  4O6M A;  5FTV A;  3USR A;  5C3B A;  5C4C A;  5C1L A;  2JCJ A;  4MND A;  3T7M A;  4M28 A;  2VS3 A;  3CGX A;  4C2S A;  1MP5 A;  1O23 B;  5CQL X;  5HS2 A;  3ZLK A;  2AGD A;  4BQH A;  1IIN A;  5FV9 A;  2Y4J A;  4HO3 A;  5D92 A;  2Z87 A;  3SX3 A;  1GQC A;  2XWM A;  2E8B A;  4D48 A;  1H7G A;  2XWL A;  1R7T A;  4D11 A;  3I0D A;  3I0L A;  1NMM B;  2FYD B;  2Y4K A;  2WGZ A;  5C1G A;  4FRM A;  5C3D A;  3IOI A;  3JTJ A;  3I0C A;  2O1H A;  4KT7 A;  1ZJ3 A;  2ZU9 A;  1FWY A;  1H3M A;  1S4O A;  1PZT A;  1JYL A;  2VS4 A;  1LL2 A;  1VGZ A;  1G1L A;  5C47 A;  4LW6 A;  4KC2 A;  1GX4 A;  5BXC A;  4Y63 A;  3I0K A;  2PA4 A;  3SXG A;  1TW1 A;  1V82 A;  1VZU A;  1EYR A;  3SXB A;  4ECM A;  4M2A A;  1MP4 A;  1GQ9 A;  1ZIZ A;  2GGQ A;  4EE3 A;  2WVM A;  2RIX A;  5C4D A;  2PX7 A;  1QGS A;  4O6N A;  4FRE A;  5L6V A;  3D98 A;  2WVK A;  4CJC A;  1LZJ A;  2Z86 A;  1R7V A;  2XME A;  1R7X A;  3V0O A;  5C36 A;  3U2U A;  1O7O A;  1EZI A;  4KQL A;  1XZ6 A;  3OH0 A;  2PGY A;  4AC3 A;  1VGW A;  1ZDG A;  2BO4 A;  1TW5 A;  3OGZ A;  4KC1 A;  1VPA A;  2RIT A;  3FOQ A;  2X5S A;  3D5N A;  2Q4J A;  5AJP A;  2QGI A;  3CKJ A;  3R2W A;  3E25 A;  3JUK A;  3QVB A;  4UEG A;  5AJO A;  1G8O A;  3N9W A;  2A8W A;  2YCM A;  4GBP A;  3SX8 A;  2YQJ A;  1R7U A;  1H5S D;  3OH4 A;  3TZT A;  1ZJP A;  1FOA A;  2RJ6 A;  1WSZ A;  4KRV A;  5C49 A;  1NKH B;  5FU8 A;  2JCK A;  1MP3 A;  4D0Z A;  1INI A;  1H7F A;  3I0I X;  2O1G A;  2FFU A;  4HG6 A;  3I0J A;  2PGV A;  2BO8 A;  2YC5 A;  4KXO A;  3DK5 A;  1ZI3 A;  4K6R A;  4Y7T A; 
#chains in the Genus database with same CATH homology
 5FUH A;  4NAK A;  2P72 A;  2RJ4 A;  1NWG B;  3SXA A;  1H5S A;  1K4V A;  5CMH A;  1HM0 A;  5DDT A;  1S4P A;  2NXV A;  3V8Z A;  2J0B A;  1LL3 A;  3F1C A;  2RIY A;  3OH1 A;  3T7O A;  2C0N A;  3I0F A;  2AM4 A;  4Y64 A;  4IRP A;  3CKN A;  2AM5 A;  1H5T A;  1WT3 A;  3PNN A;  1H5R A;  2VD4 A;  4KC4 A;  2VSH A;  1G0R A;  3EE5 A;  3U2V A;  1G9R A;  1HJL A;  1WT0 A;  4P02 A;  4JIS A;  5C1H A;  5C4F A;  2OEF A;  4MYB A;  1JVD A;  3ZGG A;  3CKV A;  4CJB A;  5CMJ A;  1HV9 A;  3POL A;  2W0W A;  4AYJ A;  2FYB A;  1H5S B;  3U2X A;  3V0P A;  4XWI A;  4ASY A;  1OMX A;  4G3Q A;  3IOH A;  4HO5 A;  4NAL A;  2OI6 A;  2JCO A;  4AAW A;  3U2T A;  3SXE A;  1VIC A;  4G3P A;  4YS8 A;  2AES A;  2OEG A;  1H5R B;  3FWW A;  1YP2 A;  4HO8 A;  5IFY A;  1GA8 A;  3KIA A;  1YRO B;  4HO9 A;  2VSI A;  2RJ5 A;  1VGT A;  5C48 A;  5L6S A;  1R82 A;  2RJ0 A;  3IOJ A;  1ZCY A;  4FRA A;  1YP4 A;  4G3S A;  5AJN A;  1H7E A;  1NQI B;  1G95 A;  2UX8 A;  4J18 A;  2AE7 A;  4FQW A;  4HO4 A;  1FO9 A;  1ON8 A;  3OH3 A;  1H7T A;  1WVC A;  2WEE A;  1JV1 A;  2Y7A A;  1KWS A;  4IRQ A;  1I52 A;  4DDZ A;  1LZ7 A;  4FIY A;  2RJ1 A;  2XMH A;  1WT1 A;  2QKX A;  2V0L A;  3CKO A;  2YES A;  2WVL A;  2RJ9 A;  3CU0 A;  3OKR A;  2X60 A;  2YQS A;  1G93 A;  1ZJO A;  4BMA A;  4HOC A;  5C38 A;  3USQ A;  4EE5 A;  5J49 A;  2RIZ A;  1JVG A;  4Y6U A;  3OH2 A;  1FR9 A;  1ZI1 A;  4FRO A;  2V0J A;  4B42 A;  4EEA A;  1ZJ0 A;  3SXC A;  3U2W A;  3T7N A;  2OI5 A;  5CMF X;  2I7B A;  4DE7 A;  4B5B A;  3R3I A;  1FGG A;  5CMG X;  2D7R A;  4KNR A;  4B4M A;  1LVW A;  3DUV A;  4FIX A;  5FTS A;  1TZF A;  2YC3 A;  2QH5 A;  2V0H A;  3I0E A;  4HO2 A;  2WAW A;  3Q4S A;  2ICY A;  4D0T A;  1E5K A;  2P6W A;  2O1F A;  2WE9 A;  3RMV A;  2P73 A;  3Q7U A;  4M4K A;  2I5K A;  4HCQ A;  4FRB A;  4EEG A;  2VK9 A;  2CU2 A;  3V0Q A;  4B4B A;  2J0A A;  5EJZ A;  2AM3 A;  4R7P A;  4CVH A;  1ZJ1 A;  1ON6 A;  3D8V A;  1NF5 B;  4NAN A;  4Y6N A;  5JQQ A;  3V91 A;  3OC9 A;  1HM9 A;  2X65 A;  2X5Z A;  3SX7 A;  3LW6 A;  1ZCV A;  4FRH A;  2VFZ A;  1LZ0 A;  3F1Y A;  1QWJ A;  1GWV A;  4FRP A;  3V0N A;  3RMW A;  5CMI A;  1H7H A;  3SX5 A;  4FRQ A;  4Y7G A;  3V8Y A;  4L41 C;  2RJ7 A;  1H7L A;  1VM8 A;  4CJ8 A;  3PKQ A;  3ZLL A;  1FXO A;  1QG8 A;  3JUJ A;  3NGW A;  1VH3 A;  2Y4L A;  2VXL A;  1ZI4 A;  3BRK X;  1HJJ A;  2I5E A;  4P00 A;  4Q7C A;  2BO7 A;  1ZCU A;  2RJ8 A;  4B2X A;  1H5T B;  1H4E A;  4B4G A;  1IIM A;  1YP3 A;  4Y7V A;  5DDV A;  2GGO A;  4ZDQ A;  1LZI A;  3V0M A;  4D11 C;  4HO0 A;  4FCE A;  1TVY A;  1ZJ2 A;  4EEM A;  1OQM B;  5C8R A;  1ZDF A;  5FYE A;  3K8D A;  4EEO A;  5D91 A;  2E3D A;  5CQM X;  5CQP A;  4DEC A;  2ZU8 A;  4EE4 A;  1ZCT A;  1FXJ A;  3TQD A;  4JD0 A;  4E1K A;  5CQN X;  5I1F A;  2ICX A;  2W0V A;  2A8U A;  4KPX A;  5C3A A;  2D7I A;  4EVW A;  2Y6P A;  1O7Q A;  1S4N A;  1QGQ A;  2ZU7 A;  3PKP A;  5IDS A;  1HM8 A;  1W57 A;  4Y62 A;  1FRW A;  2YQH A;  1WT2 A;  2FYA A;  1GWW A;  4FRD A;  3SPT A;  1XHB A;  1ZHJ A;  1R80 A;  4NAI A;  1FG5 N;  1GX0 A;  1VZX A;  1SS9 A;  4B3U A;  1G97 A;  1PZY B;  5IDT A;  3ZGF A;  4Y9X A;  1H4C A;  3ST8 A;  3ZF8 A;  1G2V A;  2JCL A;  3GUE A;  2V0I A;  1FO8 A;  1H4D A;  1ZI5 A;  3U0Y A;  3U0X A;  1R81 A;  3HL3 A;  1G3L A;  4G87 A;  5EJ1 A;  5C4E A;  4FRL A;  3I0G A;  1FZW A;  1R7Y A;  1W55 A;  3CKQ A;  5CQO A;  4FCU A;  2AH9 A;  2BO6 A;  1INJ A;  2AEC A;  2YQC A;  1V84 A;  3I0H A;  2DPW A;  3O3P A;  1OMZ A;  2MZB A;  1FGX A;  3V0L A;  5C4B A;  1MC3 A;  3V90 A;  3BCV A;  2OI7 A;  4M2B A;  1VZT A;  2XWN A;  1JV3 A;  3RSB A;  3OAM A;  1Z90 A;  2D0J A;  2V0K A;  3E26 A;  1V83 A;  2FFV A;  2FY7 A;  1JYK A;  4AYL A;  3Q80 A;  2Y4M A;  4Y7F A;  1FR8 A;  1H7Q A;  4KPZ A;  1O0R A;  4ASJ A;  4KNX A;  1LL0 A;  4LW3 A;  3K8E A;  1NHE B;  4MIX A;  1G23 A;  3SXD A;  2VS5 A;  4Y7U A;  1VGU A;  5FU0 A;  3DJ4 A;  1W77 A;  4HO6 A;  2FYC B;  4ARW A;  2VXM A;  5EIY A;  1H5S C;  2APC A;  1VH1 A;  4B2W A;  4O6M A;  5FTV A;  3USR A;  5C3B A;  5C4C A;  5C1L A;  2JCJ A;  4MND A;  3T7M A;  4M28 A;  2VS3 A;  3CGX A;  4C2S A;  1MP5 A;  1O23 B;  5CQL X;  5HS2 A;  3ZLK A;  2AGD A;  4BQH A;  1IIN A;  5FV9 A;  2Y4J A;  4HO3 A;  5D92 A;  2Z87 A;  3SX3 A;  1GQC A;  2XWM A;  2E8B A;  4D48 A;  1H7G A;  2XWL A;  1R7T A;  4D11 A;  3I0D A;  3I0L A;  1NMM B;  2FYD B;  2Y4K A;  2WGZ A;  5C1G A;  4FRM A;  5C3D A;  3IOI A;  3JTJ A;  3I0C A;  2O1H A;  4KT7 A;  1ZJ3 A;  2ZU9 A;  1FWY A;  1H3M A;  1S4O A;  1PZT A;  1JYL A;  2VS4 A;  1LL2 A;  1VGZ A;  1G1L A;  5C47 A;  4LW6 A;  4KC2 A;  1GX4 A;  5BXC A;  4Y63 A;  3I0K A;  2PA4 A;  3SXG A;  1TW1 A;  1V82 A;  1VZU A;  1EYR A;  3SXB A;  4ECM A;  4M2A A;  1MP4 A;  1GQ9 A;  1ZIZ A;  2GGQ A;  4EE3 A;  2WVM A;  2RIX A;  5C4D A;  2PX7 A;  1QGS A;  4O6N A;  4FRE A;  5L6V A;  3D98 A;  2WVK A;  4CJC A;  1LZJ A;  2Z86 A;  1R7V A;  2XME A;  1R7X A;  3V0O A;  5C36 A;  3U2U A;  1O7O A;  1EZI A;  4KQL A;  1XZ6 A;  3OH0 A;  2PGY A;  4AC3 A;  1VGW A;  1ZDG A;  2BO4 A;  1TW5 A;  3OGZ A;  4KC1 A;  1VPA A;  2RIT A;  3FOQ A;  2X5S A;  3D5N A;  2Q4J A;  5AJP A;  2QGI A;  3CKJ A;  3R2W A;  3E25 A;  3JUK A;  3QVB A;  4UEG A;  5AJO A;  1G8O A;  3N9W A;  2A8W A;  2YCM A;  4GBP A;  3SX8 A;  2YQJ A;  1R7U A;  1H5S D;  3OH4 A;  3TZT A;  1ZJP A;  1FOA A;  2RJ6 A;  1WSZ A;  4KRV A;  5C49 A;  1NKH B;  5FU8 A;  2JCK A;  1MP3 A;  4D0Z A;  1INI A;  1H7F A;  3I0I X;  2O1G A;  2FFU A;  4HG6 A;  3I0J A;  2PGV A;  2BO8 A;  2YC5 A;  4KXO A;  3DK5 A;  1ZI3 A;  4K6R A;  4Y7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...