2JCJA

Crystal structure of alpha-1,3 galactosyltransferase (c-terminus truncated mutant-c3) in complex with udp and tris
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
284
structure length
284
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis.
pubmed doi rcsb
source organism Bos taurus
total genus 104
structure length 284
sequence length 284
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2006-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2jcjA00
2OEFA 1O23B 5C4DA 2XWNA 1ZJPA 4IRPA 4AYJA 5CQMX 4ZDQA 1I52A 1TVYA 2AM3A 4BQHA 4Y6NA 5AJOA 1H7HA 2E3DA 3DUVA 1WT3A 1H5TB 2FYAA 3U2VA 2FFUA 3I0CA 3ZLLA 1JV1A 2A8UA 3IOJA 1TZFA 2V0JA 4M2BA 2X5SA 1H7EA 5DDVA 1H5SA 3SX5A 3I0GA 4CVHA 2YCMA 1HM8A 3V0NA 1LL3A 2XMEA 1FR9A 1G2VA 2PA4A 4MYBA 2OI6A 1W57A 1VZXA 2JCOA 5FTSA 4B4BA 2V0HA 1LZ7A 2ICXA 3Q7UA 4Y64A 4KPZA 1VH1A 1HM0A 3CGXA 1VGUA 1FO8A 1INJA 5CMIA 4M4KA 3ZF8A 4HOCA 4G3SA 2V0IA 2Q4JA 4KC2A 2FY7A 2Z86A 5HS2A 1FXOA 2X5ZA 1WT2A 1ZDGA 5CQLX 1OMXA 1H7FA 5EIYA 2XWLA 4EVWA 4D11C 1ZCUA 1G23A 2FYDB 1R7YA 3F1CA 2RIZA 1ZJ0A 1VZTA 4M28A 2RJ9A 4Y7GA 3OAMA 4EEAA 1YP4A 1G1LA 1GX4A 1ZI3A 2RJ0A 5C38A 1V83A 4Y7FA 3SX8A 1PZYB 2YC5A 3QVBA 1O7QA 3RSBA 1R7TA 3T7NA 5CQOA 4FRMA 3U2TA 2ZU7A 1JYLA 3USQA 2FYBA 3PKQA 5EJZA 2UX8A 4JISA 1WVCA 1ZHJA 3CKOA 4HO3A 3V0LA 4B3UA 4HO5A 1E5KA 3OH4A 2W0WA 3T7OA 4FRAA 4EEOA 3D8VA 2VSHA 2MZBA 2YQHA 2RJ6A 4CJBA 2FFVA 4Y7UA 1YP3A 4K6RA 1H5SB 4EEGA 4Y6UA 5C4EA 5L6VA 4DECA 5FU0A 2RJ8A 1KWSA 1ZJ3A 1ON8A 4YS8A 4E1KA 3K8EA 4AAWA 1IINA 4Y63A 2FYCB 4NAKA 3LW6A 3SXDA 1ZJ1A 5AJNA 4B4GA 5C4BA 1VM8A 3U0YA 1NMMB 2VS4A 4UEGA 3SXEA 4KPXA 4FREA 3FOQA 1TW5A 1GQ9A 1WT0A 4G3PA 1NWGB 1VZUA 4JD0A 5FUHA 1OQMB 1NF5B 1R7VA 4FRQA 2AECA 2XWMA 3ST8A 1MP5A 2JCJA 1Z90A 2AGDA 2I5EA 5CMJA 5EJ1A 1HV9A 3FWWA 1XZ6A 5C49A 3D98A 3V8ZA 1ZI4A 4B4MA 2W0VA 3CKVA 4KRVA 4KNRA 2VSIA 2RJ1A 2QH5A 1H5RA 4CJCA 5BXCA 4HO0A 1FZWA 2JCKA 2O1FA 4B5BA 2V0LA 3U2UA 1FRWA 1V84A 2WE9A 4G3QA 1W55A 1LZ0A 2Y6PA 1VPAA 3CU0A 3ZGGA 1H4DA 2ZU8A 4R7PA 4LW3A 2I5KA 2Y4KA 4P02A 2Y7AA 2XMHA 5C47A 1H7LA 2BO6A 1ZCVA 4FRPA 3U2XA 3BCVA 1FO9A 1ZIZA 3F1YA 3SX7A 4FCEA 3OGZA 2OEGA 3BRKX 1O0RA 3JUJA 2DPWA 5C4FA 4EE5A 3SXCA 3DK5A 2AM5A 2ICYA 2PGYA 1JV3A 2P73A 3T7MA 2PX7A 3NGWA 4D0ZA 2RJ4A 2RITA 2WVKA 2YESA 4NALA 3SXGA 1NKHB 5C3AA 2ZU9A 3RMWA 2AH9A 3I0FA 2E8BA 2BO7A 5C8RA 4NAIA 3I0EA 4NANA 1YROB 1HJJA 1VICA 5FTVA 1LL0A 1ZI5A 3OH2A 4KC4A 1R82A 4ASYA 4IRQA 2CU2A 3I0LA 4AYLA 5C48A 3HL3A 2AESA 3PKPA 2RJ5A 4KC1A 3RMVA 1V82A 3O3PA 5C36A 4DE7A 1ZDFA 1VGZA 3CKNA 5DDTA 4ASJA 1MC3A 3JUKA 2X60A 1H7QA 2YQJA 1G97A 5C3DA 4HO8A 5C1HA 4CJ8A 1G8OA 1HJLA 3V91A 3IOIA 1H5RB 1H5SC 2D0JA 4B2XA 4GBPA 3OH0A 3U0XA 5L6SA 1FWYA 3U2WA 1INIA 1VGTA 4L41C 2VS5A 1QGQA 2JCLA 4KXOA 4P00A 2NXVA 3TZTA 4G87A 2YQCA 4KNXA 4FQWA 2P72A 4D11A 3I0IX 2OI7A 3V8YA 2Y4MA 4Y9XA 1LZIA 4ECMA 3I0DA 1ZJ2A 2APCA 4EE4A 3Q80A 1TW1A 3POLA 5IFYA 5JQQA 1G3LA 2Z87A 4Y7TA 2WGZA 5CMHA 5C3BA 1R81A 2RIXA 3D5NA 2RJ7A 4KT7A 1GQCA 3V0OA 1H7GA 2AE7A 2BO4A 4B42A 1YP2A 3SPTA 1XHBA 1S4OA 2V0KA 5FU8A 4FROA 1PZTA 5CQPA 4LW6A 2GGQA 1G0RA 2YQSA 4HO9A 4DDZA 1JVGA 3SXAA 3R2WA 2I7BA 1IIMA 2D7IA 1FGGA 1R80A 4FRBA 1W77A 3ZLKA 4FCUA 4Y62A 3OH3A 1LL2A 3V0MA 1ZI1A 3DJ4A 3OH1A 4BMAA 4D0TA 1QGSA 4EE3A 1S4NA 3JTJA 1SS9A 2OI5A 3PNNA 1GWWA 4HG6A 3USRA 2VXLA 4C2SA 1S4PA 3ZGFA 1GX0A 1VH3A 1K4VA 2VS3A 5CMGX 4FRHA 2A8WA 2WEEA 1R7UA 2VD4A 2QKXA 2P6WA 3V90A 2BO8A 1FXJA 5C1LA 1GWVA 5C1GA 4KQLA 1QG8A 3GUEA 3OKRA 3TQDA 2RIYA 2WVLA 4HO6A 3SX3A 3OC9A 1H5TA 1WSZA 4ARWA 1LZJA 2Y4JA 3V0QA 1GA8A 1EYRA 3I0HA 4FRLA 1O7OA 1OMZA 2VFZA 2QGIA 2O1HA 1HM9A 4EEMA 1QWJA 1NQIB 1WT1A 3R3IA 1H4CA 1FR8A 1ZCTA 4B2WA 3KIAA 4D48A 5FYEA 5C4CA 1MP4A 1LVWA 1R7XA 3CKJA 4FRDA 2D7RA 4J18A 2PGVA 1NHEB 2WVMA 3I0JA 2VXMA 1FG5N 4AC3A 5IDSA 4HO2A 1MP3A 1H7TA 1H5SD 1VGWA 4Y7VA 1FOAA 2O1GA 2Y4LA 3EE5A 3I0KA 2WAWA 1EZIA 4XWIA 5IDTA 1G9RA 1FGXA 2GGOA 3SXBA 1H4EA 5FV9A 4M2AA 4MNDA 5AJPA 1JVDA 4HO4A 5CQNX 1ZJOA 1JYKA 4HCQA 3IOHA 1H3MA 1ON6A 3CKQA 3E25A 2AM4A 3K8DA 3V0PA 2X65A 5J49A 3E26A 2YC3A 3N9WA 1G93A 1ZCYA 5CMFX 3Q4SA 5I1FA 1G95A
chains in the Genus database with same CATH superfamily
2OEFA 1O23B 5C4DA 2XWNA 1ZJPA 4IRPA 4AYJA 4MIXA 5CQMX 4ZDQA 1I52A 1TVYA 2AM3A 4BQHA 4Y6NA 5AJOA 1H7HA 2E3DA 3DUVA 1WT3A 1H5TB 2FYAA 3U2VA 2FFUA 3I0CA 3ZLLA 5D92A 1JV1A 2A8UA 3IOJA 1TZFA 2V0JA 4M2BA 2X5SA 1H7EA 5DDVA 1H5SA 3SX5A 3I0GA 4CVHA 2YCMA 1HM8A 3V0NA 1LL3A 2XMEA 1FR9A 1G2VA 2PA4A 4MYBA 2OI6A 1W57A 1VZXA 2JCOA 5FTSA 4B4BA 2V0HA 1LZ7A 5D91A 2ICXA 3Q7UA 4Y64A 4KPZA 1VH1A 1HM0A 3CGXA 1VGUA 1FO8A 1INJA 5CMIA 4M4KA 3ZF8A 4HOCA 4G3SA 2V0IA 2Q4JA 4KC2A 2FY7A 2Z86A 5HS2A 1FXOA 2X5ZA 2VK9A 1WT2A 1ZDGA 5CQLX 1OMXA 1H7FA 5EIYA 2XWLA 4EVWA 4D11C 1ZCUA 1G23A 2FYDB 1R7YA 3F1CA 2RIZA 1ZJ0A 1VZTA 4M28A 2RJ9A 4Y7GA 3OAMA 4EEAA 1YP4A 1G1LA 1GX4A 1ZI3A 2RJ0A 5C38A 1V83A 4Y7FA 3SX8A 1PZYB 2YC5A 3QVBA 1O7QA 3RSBA 1R7TA 3T7NA 5CQOA 4FRMA 3U2TA 2ZU7A 1JYLA 3USQA 2FYBA 3PKQA 5EJZA 2UX8A 4JISA 1WVCA 1ZHJA 3CKOA 4HO3A 3V0LA 4B3UA 4HO5A 1E5KA 3OH4A 2W0WA 3T7OA 4FRAA 4EEOA 3D8VA 2VSHA 2MZBA 2YQHA 2RJ6A 4CJBA 2FFVA 4Y7UA 1YP3A 4K6RA 1H5SB 4EEGA 4Y6UA 5C4EA 5L6VA 4DECA 5FU0A 2RJ8A 1KWSA 1ZJ3A 1ON8A 4YS8A 4E1KA 3K8EA 4AAWA 4FIYA 1IINA 4Y63A 2FYCB 4NAKA 3LW6A 3SXDA 1ZJ1A 5AJNA 4B4GA 5C4BA 1VM8A 3U0YA 1NMMB 2VS4A 4UEGA 3SXEA 4KPXA 4FREA 3FOQA 1TW5A 1GQ9A 1WT0A 4G3PA 1NWGB 1VZUA 4JD0A 5FUHA 1OQMB 1NF5B 1R7VA 4FRQA 2AECA 2XWMA 3ST8A 1MP5A 2JCJA 1Z90A 2AGDA 2I5EA 5CMJA 5EJ1A 1HV9A 3FWWA 1XZ6A 5C49A 3D98A 3V8ZA 2J0AA 1ZI4A 4B4MA 2W0VA 3CKVA 4KRVA 4KNRA 2VSIA 2RJ1A 2QH5A 1H5RA 4CJCA 5BXCA 4HO0A 1FZWA 2JCKA 2O1FA 4B5BA 2V0LA 3U2UA 1FRWA 1V84A 2WE9A 4G3QA 1W55A 1LZ0A 2Y6PA 1VPAA 3CU0A 3ZGGA 1H4DA 2ZU8A 4R7PA 4LW3A 2I5KA 2Y4KA 4P02A 2Y7AA 2XMHA 5C47A 1H7LA 2BO6A 1ZCVA 4FRPA 3U2XA 3BCVA 1FO9A 1ZIZA 3F1YA 3SX7A 4FCEA 3OGZA 2OEGA 3BRKX 1O0RA 3JUJA 2DPWA 5C4FA 4EE5A 3SXCA 2AM5A 2ICYA 2PGYA 1JV3A 2P73A 3DK5A 3T7MA 2PX7A 3NGWA 4D0ZA 4O6MA 2RJ4A 2RITA 2WVKA 2YESA 4NALA 3SXGA 1NKHB 5C3AA 2ZU9A 3RMWA 2AH9A 3I0FA 2E8BA 2BO7A 5C8RA 4NAIA 3I0EA 4NANA 1YROB 1HJJA 1VICA 5FTVA 1LL0A 1ZI5A 3OH2A 4KC4A 1R82A 4ASYA 4IRQA 2CU2A 3I0LA 4AYLA 5C48A 3HL3A 2AESA 3PKPA 2RJ5A 4KC1A 3RMVA 1V82A 3O3PA 5C36A 4Q7CA 4DE7A 1ZDFA 1VGZA 3CKNA 5DDTA 4ASJA 1MC3A 3JUKA 2X60A 1H7QA 2YQJA 1G97A 5C3DA 4HO8A 5C1HA 4CJ8A 1G8OA 1HJLA 3V91A 3IOIA 1H5RB 1H5SC 2D0JA 4B2XA 4GBPA 3OH0A 3U0XA 5L6SA 1FWYA 3U2WA 1INIA 1VGTA 4L41C 2VS5A 1QGQA 2JCLA 4KXOA 4P00A 2NXVA 3TZTA 4G87A 2YQCA 4KNXA 4FQWA 2P72A 4D11A 3I0IX 2OI7A 3V8YA 2Y4MA 4Y9XA 1LZIA 4ECMA 3I0DA 1ZJ2A 2APCA 2J0BA 4EE4A 3Q80A 1TW1A 3POLA 5IFYA 5JQQA 1G3LA 2Z87A 4Y7TA 2WGZA 5CMHA 5C3BA 1R81A 2RIXA 3D5NA 2RJ7A 4KT7A 1GQCA 3V0OA 1H7GA 2AE7A 2BO4A 4B42A 4O6NA 1YP2A 3SPTA 1XHBA 1S4OA 2V0KA 5FU8A 4FROA 1PZTA 5CQPA 4LW6A 2GGQA 1G0RA 2YQSA 4HO9A 4DDZA 1JVGA 3SXAA 3R2WA 2I7BA 1IIMA 2D7IA 1FGGA 1R80A 4FRBA 1W77A 3ZLKA 4FCUA 4Y62A 3OH3A 1LL2A 3V0MA 1ZI1A 3DJ4A 3OH1A 4BMAA 4D0TA 1QGSA 4EE3A 1S4NA 3JTJA 1SS9A 2OI5A 3PNNA 1GWWA 4HG6A 3USRA 2VXLA 4C2SA 1S4PA 3ZGFA 1GX0A 1VH3A 1K4VA 2VS3A 5CMGX 4FRHA 2A8WA 2WEEA 1R7UA 2VD4A 2QKXA 2P6WA 3V90A 2BO8A 1FXJA 5C1LA 1GWVA 5C1GA 4KQLA 1QG8A 3GUEA 3OKRA 3TQDA 2RIYA 2WVLA 4HO6A 3SX3A 3OC9A 1H5TA 1WSZA 4ARWA 1LZJA 2Y4JA 3V0QA 1GA8A 1EYRA 3I0HA 4FRLA 1O7OA 1OMZA 2VFZA 2QGIA 2O1HA 1HM9A 4EEMA 1QWJA 1NQIB 1WT1A 3R3IA 1H4CA 1FR8A 1ZCTA 4B2WA 3KIAA 4D48A 5FYEA 5C4CA 1MP4A 1LVWA 1R7XA 3CKJA 4FRDA 2D7RA 4J18A 2PGVA 1NHEB 2WVMA 3I0JA 2VXMA 1FG5N 4AC3A 5IDSA 4HO2A 1MP3A 1H7TA 1H5SD 1VGWA 4Y7VA 1FOAA 2O1GA 2Y4LA 3EE5A 3I0KA 2WAWA 1EZIA 4XWIA 5IDTA 1G9RA 1FGXA 2GGOA 3SXBA 1H4EA 5FV9A 4M2AA 4MNDA 5AJPA 1JVDA 4HO4A 5CQNX 1ZJOA 2C0NA 1JYKA 4HCQA 3IOHA 1H3MA 1ON6A 3CKQA 3E25A 2AM4A 3K8DA 3V0PA 2X65A 5J49A 3E26A 2YC3A 3N9WA 1G93A 1ZCYA 4FIXA 5CMFX 3Q4SA 5I1FA 1G95A
chains in the Genus database with same CATH topology
2OEFA 1O23B 5C4DA 2XWNA 1ZJPA 4IRPA 4AYJA 4MIXA 5CQMX 4ZDQA 1I52A 1TVYA 2AM3A 4BQHA 4Y6NA 5AJOA 1H7HA 2E3DA 3DUVA 1WT3A 1H5TB 2FYAA 3U2VA 2FFUA 3I0CA 3ZLLA 5D92A 1JV1A 2A8UA 3IOJA 1TZFA 2V0JA 4M2BA 2X5SA 1H7EA 5DDVA 1H5SA 3SX5A 3I0GA 4CVHA 2YCMA 1HM8A 3V0NA 1LL3A 2XMEA 1FR9A 1G2VA 2PA4A 4MYBA 2OI6A 1W57A 1VZXA 2JCOA 5FTSA 4B4BA 2V0HA 1LZ7A 5D91A 2ICXA 3Q7UA 4Y64A 4KPZA 1VH1A 1HM0A 3CGXA 1VGUA 1FO8A 1INJA 5CMIA 4M4KA 3ZF8A 4HOCA 4G3SA 2V0IA 2Q4JA 4KC2A 2FY7A 2Z86A 5HS2A 1FXOA 2X5ZA 2VK9A 1WT2A 1ZDGA 5CQLX 1OMXA 1H7FA 5EIYA 2XWLA 4EVWA 4D11C 1ZCUA 1G23A 2FYDB 1R7YA 3F1CA 2RIZA 1ZJ0A 1VZTA 4M28A 2RJ9A 4Y7GA 3OAMA 4EEAA 1YP4A 1G1LA 1GX4A 1ZI3A 2RJ0A 5C38A 1V83A 4Y7FA 3SX8A 1PZYB 2YC5A 3QVBA 1O7QA 3RSBA 1R7TA 3T7NA 5CQOA 4FRMA 3U2TA 2ZU7A 1JYLA 3USQA 2FYBA 3PKQA 5EJZA 2UX8A 4JISA 1WVCA 1ZHJA 3CKOA 4HO3A 3V0LA 4B3UA 4HO5A 1E5KA 3OH4A 2W0WA 3T7OA 4FRAA 4EEOA 3D8VA 2VSHA 2MZBA 2YQHA 2RJ6A 4CJBA 2FFVA 4Y7UA 1YP3A 4K6RA 1H5SB 4EEGA 4Y6UA 5C4EA 5L6VA 4DECA 5FU0A 2RJ8A 1KWSA 1ZJ3A 1ON8A 4YS8A 4E1KA 3K8EA 4AAWA 4FIYA 1IINA 4Y63A 2FYCB 4NAKA 3LW6A 3SXDA 1ZJ1A 5AJNA 4B4GA 5C4BA 1VM8A 3U0YA 1NMMB 2VS4A 4UEGA 3SXEA 4KPXA 4FREA 3FOQA 1TW5A 1GQ9A 1WT0A 4G3PA 1NWGB 1VZUA 4JD0A 5FUHA 1OQMB 1NF5B 1R7VA 4FRQA 2AECA 2XWMA 3ST8A 1MP5A 2JCJA 1Z90A 2AGDA 2I5EA 5CMJA 5EJ1A 1HV9A 3FWWA 1XZ6A 5C49A 3D98A 3V8ZA 2J0AA 1ZI4A 4B4MA 2W0VA 3CKVA 4KRVA 4KNRA 2VSIA 2RJ1A 2QH5A 1H5RA 4CJCA 5BXCA 4HO0A 1FZWA 2JCKA 2O1FA 4B5BA 2V0LA 3U2UA 1FRWA 1V84A 2WE9A 4G3QA 1W55A 1LZ0A 2Y6PA 1VPAA 3CU0A 3ZGGA 1H4DA 2ZU8A 4R7PA 4LW3A 2I5KA 2Y4KA 4P02A 2Y7AA 2XMHA 5C47A 1H7LA 2BO6A 1ZCVA 4FRPA 3U2XA 3BCVA 1FO9A 1ZIZA 3F1YA 3SX7A 4FCEA 3OGZA 2OEGA 3BRKX 1O0RA 3JUJA 2DPWA 5C4FA 4EE5A 3SXCA 2AM5A 2ICYA 2PGYA 1JV3A 2P73A 3DK5A 3T7MA 2PX7A 3NGWA 4D0ZA 4O6MA 2RJ4A 2RITA 2WVKA 2YESA 4NALA 3SXGA 1NKHB 5C3AA 2ZU9A 3RMWA 2AH9A 3I0FA 2E8BA 2BO7A 5C8RA 4NAIA 3I0EA 4NANA 1YROB 1HJJA 1VICA 5FTVA 1LL0A 1ZI5A 3OH2A 4KC4A 1R82A 4ASYA 4IRQA 2CU2A 3I0LA 4AYLA 5C48A 3HL3A 2AESA 3PKPA 2RJ5A 4KC1A 3RMVA 1V82A 3O3PA 5C36A 4Q7CA 4DE7A 1ZDFA 1VGZA 3CKNA 5DDTA 4ASJA 1MC3A 3JUKA 2X60A 1H7QA 2YQJA 1G97A 5C3DA 4HO8A 5C1HA 4CJ8A 1G8OA 1HJLA 3V91A 3IOIA 1H5RB 1H5SC 2D0JA 4B2XA 4GBPA 3OH0A 3U0XA 5L6SA 1FWYA 3U2WA 1INIA 1VGTA 4L41C 2VS5A 1QGQA 2JCLA 4KXOA 4P00A 2NXVA 3TZTA 4G87A 2YQCA 4KNXA 4FQWA 2P72A 4D11A 3I0IX 2OI7A 3V8YA 2Y4MA 4Y9XA 1LZIA 4ECMA 3I0DA 1ZJ2A 2APCA 2J0BA 4EE4A 3Q80A 1TW1A 3POLA 5IFYA 5JQQA 1G3LA 2Z87A 4Y7TA 2WGZA 5CMHA 5C3BA 1R81A 2RIXA 3D5NA 2RJ7A 4KT7A 1GQCA 3V0OA 1H7GA 2AE7A 2BO4A 4B42A 4O6NA 1YP2A 3SPTA 1XHBA 1S4OA 2V0KA 5FU8A 4FROA 1PZTA 5CQPA 4LW6A 2GGQA 1G0RA 2YQSA 4HO9A 4DDZA 1JVGA 3SXAA 3R2WA 2I7BA 1IIMA 2D7IA 1FGGA 1R80A 4FRBA 1W77A 3ZLKA 4FCUA 4Y62A 3OH3A 1LL2A 3V0MA 1ZI1A 3DJ4A 3OH1A 4BMAA 4D0TA 1QGSA 4EE3A 1S4NA 3JTJA 1SS9A 2OI5A 3PNNA 1GWWA 4HG6A 3USRA 2VXLA 4C2SA 1S4PA 3ZGFA 1GX0A 1VH3A 1K4VA 2VS3A 5CMGX 4FRHA 2A8WA 2WEEA 1R7UA 2VD4A 2QKXA 2P6WA 3V90A 2BO8A 1FXJA 5C1LA 1GWVA 5C1GA 4KQLA 1QG8A 3GUEA 3OKRA 3TQDA 2RIYA 2WVLA 4HO6A 3SX3A 3OC9A 1H5TA 1WSZA 4ARWA 1LZJA 2Y4JA 3V0QA 1GA8A 1EYRA 3I0HA 4FRLA 1O7OA 1OMZA 2VFZA 2QGIA 2O1HA 1HM9A 4EEMA 1QWJA 1NQIB 1WT1A 3R3IA 1H4CA 1FR8A 1ZCTA 4B2WA 3KIAA 4D48A 5FYEA 5C4CA 1MP4A 1LVWA 1R7XA 3CKJA 4FRDA 2D7RA 4J18A 2PGVA 1NHEB 2WVMA 3I0JA 2VXMA 1FG5N 4AC3A 5IDSA 4HO2A 1MP3A 1H7TA 1H5SD 1VGWA 4Y7VA 1FOAA 2O1GA 2Y4LA 3EE5A 3I0KA 2WAWA 1EZIA 4XWIA 5IDTA 1G9RA 1FGXA 2GGOA 3SXBA 1H4EA 5FV9A 4M2AA 4MNDA 5AJPA 1JVDA 4HO4A 5CQNX 1ZJOA 2C0NA 1JYKA 4HCQA 3IOHA 1H3MA 1ON6A 3CKQA 3E25A 2AM4A 3K8DA 3V0PA 2X65A 5J49A 3E26A 2YC3A 3N9WA 1G93A 1ZCYA 4FIXA 5CMFX 3Q4SA 5I1FA 1G95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEF A;  1O23 B;  5C4D A;  2XWN A;  1ZJP A;  4IRP A;  4AYJ A;  5CQM X;  4ZDQ A;  1I52 A;  1TVY A;  2AM3 A;  4BQH A;  4Y6N A;  5AJO A;  1H7H A;  2E3D A;  3DUV A;  1WT3 A;  1H5T B;  2FYA A;  3U2V A;  2FFU A;  3I0C A;  3ZLL A;  1JV1 A;  2A8U A;  3IOJ A;  1TZF A;  2V0J A;  4M2B A;  2X5S A;  1H7E A;  5DDV A;  1H5S A;  3SX5 A;  3I0G A;  4CVH A;  2YCM A;  1HM8 A;  3V0N A;  1LL3 A;  2XME A;  1FR9 A;  1G2V A;  2PA4 A;  4MYB A;  2OI6 A;  1W57 A;  1VZX A;  2JCO A;  5FTS A;  4B4B A;  2V0H A;  1LZ7 A;  2ICX A;  3Q7U A;  4Y64 A;  4KPZ A;  1VH1 A;  1HM0 A;  3CGX A;  1VGU A;  1FO8 A;  1INJ A;  5CMI A;  4M4K A;  3ZF8 A;  4HOC A;  4G3S A;  2V0I A;  2Q4J A;  4KC2 A;  2FY7 A;  2Z86 A;  5HS2 A;  1FXO A;  2X5Z A;  1WT2 A;  1ZDG A;  5CQL X;  1OMX A;  1H7F A;  5EIY A;  2XWL A;  4EVW A;  4D11 C;  1ZCU A;  1G23 A;  2FYD B;  1R7Y A;  3F1C A;  2RIZ A;  1ZJ0 A;  1VZT A;  4M28 A;  2RJ9 A;  4Y7G A;  3OAM A;  4EEA A;  1YP4 A;  1G1L A;  1GX4 A;  1ZI3 A;  2RJ0 A;  5C38 A;  1V83 A;  4Y7F A;  3SX8 A;  1PZY B;  2YC5 A;  3QVB A;  1O7Q A;  3RSB A;  1R7T A;  3T7N A;  5CQO A;  4FRM A;  3U2T A;  2ZU7 A;  1JYL A;  3USQ A;  2FYB A;  3PKQ A;  5EJZ A;  2UX8 A;  4JIS A;  1WVC A;  1ZHJ A;  3CKO A;  4HO3 A;  3V0L A;  4B3U A;  4HO5 A;  1E5K A;  3OH4 A;  2W0W A;  3T7O A;  4FRA A;  4EEO A;  3D8V A;  2VSH A;  2MZB A;  2YQH A;  2RJ6 A;  4CJB A;  2FFV A;  4Y7U A;  1YP3 A;  4K6R A;  1H5S B;  4EEG A;  4Y6U A;  5C4E A;  5L6V A;  4DEC A;  5FU0 A;  2RJ8 A;  1KWS A;  1ZJ3 A;  1ON8 A;  4YS8 A;  4E1K A;  3K8E A;  4AAW A;  1IIN A;  4Y63 A;  2FYC B;  4NAK A;  3LW6 A;  3SXD A;  1ZJ1 A;  5AJN A;  4B4G A;  5C4B A;  1VM8 A;  3U0Y A;  1NMM B;  2VS4 A;  4UEG A;  3SXE A;  4KPX A;  4FRE A;  3FOQ A;  1TW5 A;  1GQ9 A;  1WT0 A;  4G3P A;  1NWG B;  1VZU A;  4JD0 A;  5FUH A;  1OQM B;  1NF5 B;  1R7V A;  4FRQ A;  2AEC A;  2XWM A;  3ST8 A;  1MP5 A;  2JCJ A;  1Z90 A;  2AGD A;  2I5E A;  5CMJ A;  5EJ1 A;  1HV9 A;  3FWW A;  1XZ6 A;  5C49 A;  3D98 A;  3V8Z A;  1ZI4 A;  4B4M A;  2W0V A;  3CKV A;  4KRV A;  4KNR A;  2VSI A;  2RJ1 A;  2QH5 A;  1H5R A;  4CJC A;  5BXC A;  4HO0 A;  1FZW A;  2JCK A;  2O1F A;  4B5B A;  2V0L A;  3U2U A;  1FRW A;  1V84 A;  2WE9 A;  4G3Q A;  1W55 A;  1LZ0 A;  2Y6P A;  1VPA A;  3CU0 A;  3ZGG A;  1H4D A;  2ZU8 A;  4R7P A;  4LW3 A;  2I5K A;  2Y4K A;  4P02 A;  2Y7A A;  2XMH A;  5C47 A;  1H7L A;  2BO6 A;  1ZCV A;  4FRP A;  3U2X A;  3BCV A;  1FO9 A;  1ZIZ A;  3F1Y A;  3SX7 A;  4FCE A;  3OGZ A;  2OEG A;  3BRK X;  1O0R A;  3JUJ A;  2DPW A;  5C4F A;  4EE5 A;  3SXC A;  3DK5 A;  2AM5 A;  2ICY A;  2PGY A;  1JV3 A;  2P73 A;  3T7M A;  2PX7 A;  3NGW A;  4D0Z A;  2RJ4 A;  2RIT A;  2WVK A;  2YES A;  4NAL A;  3SXG A;  1NKH B;  5C3A A;  2ZU9 A;  3RMW A;  2AH9 A;  3I0F A;  2E8B A;  2BO7 A;  5C8R A;  4NAI A;  3I0E A;  4NAN A;  1YRO B;  1HJJ A;  1VIC A;  5FTV A;  1LL0 A;  1ZI5 A;  3OH2 A;  4KC4 A;  1R82 A;  4ASY A;  4IRQ A;  2CU2 A;  3I0L A;  4AYL A;  5C48 A;  3HL3 A;  2AES A;  3PKP A;  2RJ5 A;  4KC1 A;  3RMV A;  1V82 A;  3O3P A;  5C36 A;  4DE7 A;  1ZDF A;  1VGZ A;  3CKN A;  5DDT A;  4ASJ A;  1MC3 A;  3JUK A;  2X60 A;  1H7Q A;  2YQJ A;  1G97 A;  5C3D A;  4HO8 A;  5C1H A;  4CJ8 A;  1G8O A;  1HJL A;  3V91 A;  3IOI A;  1H5R B;  1H5S C;  2D0J A;  4B2X A;  4GBP A;  3OH0 A;  3U0X A;  5L6S A;  1FWY A;  3U2W A;  1INI A;  1VGT A;  4L41 C;  2VS5 A;  1QGQ A;  2JCL A;  4KXO A;  4P00 A;  2NXV A;  3TZT A;  4G87 A;  2YQC A;  4KNX A;  4FQW A;  2P72 A;  4D11 A;  3I0I X;  2OI7 A;  3V8Y A;  2Y4M A;  4Y9X A;  1LZI A;  4ECM A;  3I0D A;  1ZJ2 A;  2APC A;  4EE4 A;  3Q80 A;  1TW1 A;  3POL A;  5IFY A;  5JQQ A;  1G3L A;  2Z87 A;  4Y7T A;  2WGZ A;  5CMH A;  5C3B A;  1R81 A;  2RIX A;  3D5N A;  2RJ7 A;  4KT7 A;  1GQC A;  3V0O A;  1H7G A;  2AE7 A;  2BO4 A;  4B42 A;  1YP2 A;  3SPT A;  1XHB A;  1S4O A;  2V0K A;  5FU8 A;  4FRO A;  1PZT A;  5CQP A;  4LW6 A;  2GGQ A;  1G0R A;  2YQS A;  4HO9 A;  4DDZ A;  1JVG A;  3SXA A;  3R2W A;  2I7B A;  1IIM A;  2D7I A;  1FGG A;  1R80 A;  4FRB A;  1W77 A;  3ZLK A;  4FCU A;  4Y62 A;  3OH3 A;  1LL2 A;  3V0M A;  1ZI1 A;  3DJ4 A;  3OH1 A;  4BMA A;  4D0T A;  1QGS A;  4EE3 A;  1S4N A;  3JTJ A;  1SS9 A;  2OI5 A;  3PNN A;  1GWW A;  4HG6 A;  3USR A;  2VXL A;  4C2S A;  1S4P A;  3ZGF A;  1GX0 A;  1VH3 A;  1K4V A;  2VS3 A;  5CMG X;  4FRH A;  2A8W A;  2WEE A;  1R7U A;  2VD4 A;  2QKX A;  2P6W A;  3V90 A;  2BO8 A;  1FXJ A;  5C1L A;  1GWV A;  5C1G A;  4KQL A;  1QG8 A;  3GUE A;  3OKR A;  3TQD A;  2RIY A;  2WVL A;  4HO6 A;  3SX3 A;  3OC9 A;  1H5T A;  1WSZ A;  4ARW A;  1LZJ A;  2Y4J A;  3V0Q A;  1GA8 A;  1EYR A;  3I0H A;  4FRL A;  1O7O A;  1OMZ A;  2VFZ A;  2QGI A;  2O1H A;  1HM9 A;  4EEM A;  1QWJ A;  1NQI B;  1WT1 A;  3R3I A;  1H4C A;  1FR8 A;  1ZCT A;  4B2W A;  3KIA A;  4D48 A;  5FYE A;  5C4C A;  1MP4 A;  1LVW A;  1R7X A;  3CKJ A;  4FRD A;  2D7R A;  4J18 A;  2PGV A;  1NHE B;  2WVM A;  3I0J A;  2VXM A;  1FG5 N;  4AC3 A;  5IDS A;  4HO2 A;  1MP3 A;  1H7T A;  1H5S D;  1VGW A;  4Y7V A;  1FOA A;  2O1G A;  2Y4L A;  3EE5 A;  3I0K A;  2WAW A;  1EZI A;  4XWI A;  5IDT A;  1G9R A;  1FGX A;  2GGO A;  3SXB A;  1H4E A;  5FV9 A;  4M2A A;  4MND A;  5AJP A;  1JVD A;  4HO4 A;  5CQN X;  1ZJO A;  1JYK A;  4HCQ A;  3IOH A;  1H3M A;  1ON6 A;  3CKQ A;  3E25 A;  2AM4 A;  3K8D A;  3V0P A;  2X65 A;  5J49 A;  3E26 A;  2YC3 A;  3N9W A;  1G93 A;  1ZCY A;  5CMF X;  3Q4S A;  5I1F A;  1G95 A; 
#chains in the Genus database with same CATH topology
 2OEF A;  1O23 B;  5C4D A;  2XWN A;  1ZJP A;  4IRP A;  4AYJ A;  4MIX A;  5CQM X;  4ZDQ A;  1I52 A;  1TVY A;  2AM3 A;  4BQH A;  4Y6N A;  5AJO A;  1H7H A;  2E3D A;  3DUV A;  1WT3 A;  1H5T B;  2FYA A;  3U2V A;  2FFU A;  3I0C A;  3ZLL A;  5D92 A;  1JV1 A;  2A8U A;  3IOJ A;  1TZF A;  2V0J A;  4M2B A;  2X5S A;  1H7E A;  5DDV A;  1H5S A;  3SX5 A;  3I0G A;  4CVH A;  2YCM A;  1HM8 A;  3V0N A;  1LL3 A;  2XME A;  1FR9 A;  1G2V A;  2PA4 A;  4MYB A;  2OI6 A;  1W57 A;  1VZX A;  2JCO A;  5FTS A;  4B4B A;  2V0H A;  1LZ7 A;  5D91 A;  2ICX A;  3Q7U A;  4Y64 A;  4KPZ A;  1VH1 A;  1HM0 A;  3CGX A;  1VGU A;  1FO8 A;  1INJ A;  5CMI A;  4M4K A;  3ZF8 A;  4HOC A;  4G3S A;  2V0I A;  2Q4J A;  4KC2 A;  2FY7 A;  2Z86 A;  5HS2 A;  1FXO A;  2X5Z A;  2VK9 A;  1WT2 A;  1ZDG A;  5CQL X;  1OMX A;  1H7F A;  5EIY A;  2XWL A;  4EVW A;  4D11 C;  1ZCU A;  1G23 A;  2FYD B;  1R7Y A;  3F1C A;  2RIZ A;  1ZJ0 A;  1VZT A;  4M28 A;  2RJ9 A;  4Y7G A;  3OAM A;  4EEA A;  1YP4 A;  1G1L A;  1GX4 A;  1ZI3 A;  2RJ0 A;  5C38 A;  1V83 A;  4Y7F A;  3SX8 A;  1PZY B;  2YC5 A;  3QVB A;  1O7Q A;  3RSB A;  1R7T A;  3T7N A;  5CQO A;  4FRM A;  3U2T A;  2ZU7 A;  1JYL A;  3USQ A;  2FYB A;  3PKQ A;  5EJZ A;  2UX8 A;  4JIS A;  1WVC A;  1ZHJ A;  3CKO A;  4HO3 A;  3V0L A;  4B3U A;  4HO5 A;  1E5K A;  3OH4 A;  2W0W A;  3T7O A;  4FRA A;  4EEO A;  3D8V A;  2VSH A;  2MZB A;  2YQH A;  2RJ6 A;  4CJB A;  2FFV A;  4Y7U A;  1YP3 A;  4K6R A;  1H5S B;  4EEG A;  4Y6U A;  5C4E A;  5L6V A;  4DEC A;  5FU0 A;  2RJ8 A;  1KWS A;  1ZJ3 A;  1ON8 A;  4YS8 A;  4E1K A;  3K8E A;  4AAW A;  4FIY A;  1IIN A;  4Y63 A;  2FYC B;  4NAK A;  3LW6 A;  3SXD A;  1ZJ1 A;  5AJN A;  4B4G A;  5C4B A;  1VM8 A;  3U0Y A;  1NMM B;  2VS4 A;  4UEG A;  3SXE A;  4KPX A;  4FRE A;  3FOQ A;  1TW5 A;  1GQ9 A;  1WT0 A;  4G3P A;  1NWG B;  1VZU A;  4JD0 A;  5FUH A;  1OQM B;  1NF5 B;  1R7V A;  4FRQ A;  2AEC A;  2XWM A;  3ST8 A;  1MP5 A;  2JCJ A;  1Z90 A;  2AGD A;  2I5E A;  5CMJ A;  5EJ1 A;  1HV9 A;  3FWW A;  1XZ6 A;  5C49 A;  3D98 A;  3V8Z A;  2J0A A;  1ZI4 A;  4B4M A;  2W0V A;  3CKV A;  4KRV A;  4KNR A;  2VSI A;  2RJ1 A;  2QH5 A;  1H5R A;  4CJC A;  5BXC A;  4HO0 A;  1FZW A;  2JCK A;  2O1F A;  4B5B A;  2V0L A;  3U2U A;  1FRW A;  1V84 A;  2WE9 A;  4G3Q A;  1W55 A;  1LZ0 A;  2Y6P A;  1VPA A;  3CU0 A;  3ZGG A;  1H4D A;  2ZU8 A;  4R7P A;  4LW3 A;  2I5K A;  2Y4K A;  4P02 A;  2Y7A A;  2XMH A;  5C47 A;  1H7L A;  2BO6 A;  1ZCV A;  4FRP A;  3U2X A;  3BCV A;  1FO9 A;  1ZIZ A;  3F1Y A;  3SX7 A;  4FCE A;  3OGZ A;  2OEG A;  3BRK X;  1O0R A;  3JUJ A;  2DPW A;  5C4F A;  4EE5 A;  3SXC A;  2AM5 A;  2ICY A;  2PGY A;  1JV3 A;  2P73 A;  3DK5 A;  3T7M A;  2PX7 A;  3NGW A;  4D0Z A;  4O6M A;  2RJ4 A;  2RIT A;  2WVK A;  2YES A;  4NAL A;  3SXG A;  1NKH B;  5C3A A;  2ZU9 A;  3RMW A;  2AH9 A;  3I0F A;  2E8B A;  2BO7 A;  5C8R A;  4NAI A;  3I0E A;  4NAN A;  1YRO B;  1HJJ A;  1VIC A;  5FTV A;  1LL0 A;  1ZI5 A;  3OH2 A;  4KC4 A;  1R82 A;  4ASY A;  4IRQ A;  2CU2 A;  3I0L A;  4AYL A;  5C48 A;  3HL3 A;  2AES A;  3PKP A;  2RJ5 A;  4KC1 A;  3RMV A;  1V82 A;  3O3P A;  5C36 A;  4Q7C A;  4DE7 A;  1ZDF A;  1VGZ A;  3CKN A;  5DDT A;  4ASJ A;  1MC3 A;  3JUK A;  2X60 A;  1H7Q A;  2YQJ A;  1G97 A;  5C3D A;  4HO8 A;  5C1H A;  4CJ8 A;  1G8O A;  1HJL A;  3V91 A;  3IOI A;  1H5R B;  1H5S C;  2D0J A;  4B2X A;  4GBP A;  3OH0 A;  3U0X A;  5L6S A;  1FWY A;  3U2W A;  1INI A;  1VGT A;  4L41 C;  2VS5 A;  1QGQ A;  2JCL A;  4KXO A;  4P00 A;  2NXV A;  3TZT A;  4G87 A;  2YQC A;  4KNX A;  4FQW A;  2P72 A;  4D11 A;  3I0I X;  2OI7 A;  3V8Y A;  2Y4M A;  4Y9X A;  1LZI A;  4ECM A;  3I0D A;  1ZJ2 A;  2APC A;  2J0B A;  4EE4 A;  3Q80 A;  1TW1 A;  3POL A;  5IFY A;  5JQQ A;  1G3L A;  2Z87 A;  4Y7T A;  2WGZ A;  5CMH A;  5C3B A;  1R81 A;  2RIX A;  3D5N A;  2RJ7 A;  4KT7 A;  1GQC A;  3V0O A;  1H7G A;  2AE7 A;  2BO4 A;  4B42 A;  4O6N A;  1YP2 A;  3SPT A;  1XHB A;  1S4O A;  2V0K A;  5FU8 A;  4FRO A;  1PZT A;  5CQP A;  4LW6 A;  2GGQ A;  1G0R A;  2YQS A;  4HO9 A;  4DDZ A;  1JVG A;  3SXA A;  3R2W A;  2I7B A;  1IIM A;  2D7I A;  1FGG A;  1R80 A;  4FRB A;  1W77 A;  3ZLK A;  4FCU A;  4Y62 A;  3OH3 A;  1LL2 A;  3V0M A;  1ZI1 A;  3DJ4 A;  3OH1 A;  4BMA A;  4D0T A;  1QGS A;  4EE3 A;  1S4N A;  3JTJ A;  1SS9 A;  2OI5 A;  3PNN A;  1GWW A;  4HG6 A;  3USR A;  2VXL A;  4C2S A;  1S4P A;  3ZGF A;  1GX0 A;  1VH3 A;  1K4V A;  2VS3 A;  5CMG X;  4FRH A;  2A8W A;  2WEE A;  1R7U A;  2VD4 A;  2QKX A;  2P6W A;  3V90 A;  2BO8 A;  1FXJ A;  5C1L A;  1GWV A;  5C1G A;  4KQL A;  1QG8 A;  3GUE A;  3OKR A;  3TQD A;  2RIY A;  2WVL A;  4HO6 A;  3SX3 A;  3OC9 A;  1H5T A;  1WSZ A;  4ARW A;  1LZJ A;  2Y4J A;  3V0Q A;  1GA8 A;  1EYR A;  3I0H A;  4FRL A;  1O7O A;  1OMZ A;  2VFZ A;  2QGI A;  2O1H A;  1HM9 A;  4EEM A;  1QWJ A;  1NQI B;  1WT1 A;  3R3I A;  1H4C A;  1FR8 A;  1ZCT A;  4B2W A;  3KIA A;  4D48 A;  5FYE A;  5C4C A;  1MP4 A;  1LVW A;  1R7X A;  3CKJ A;  4FRD A;  2D7R A;  4J18 A;  2PGV A;  1NHE B;  2WVM A;  3I0J A;  2VXM A;  1FG5 N;  4AC3 A;  5IDS A;  4HO2 A;  1MP3 A;  1H7T A;  1H5S D;  1VGW A;  4Y7V A;  1FOA A;  2O1G A;  2Y4L A;  3EE5 A;  3I0K A;  2WAW A;  1EZI A;  4XWI A;  5IDT A;  1G9R A;  1FGX A;  2GGO A;  3SXB A;  1H4E A;  5FV9 A;  4M2A A;  4MND A;  5AJP A;  1JVD A;  4HO4 A;  5CQN X;  1ZJO A;  2C0N A;  1JYK A;  4HCQ A;  3IOH A;  1H3M A;  1ON6 A;  3CKQ A;  3E25 A;  2AM4 A;  3K8D A;  3V0P A;  2X65 A;  5J49 A;  3E26 A;  2YC3 A;  3N9W A;  1G93 A;  1ZCY A;  4FIX A;  5CMF X;  3Q4S A;  5I1F A;  1G95 A; 
#chains in the Genus database with same CATH homology
 2OEF A;  1O23 B;  5C4D A;  2XWN A;  1ZJP A;  4IRP A;  4AYJ A;  4MIX A;  5CQM X;  4ZDQ A;  1I52 A;  1TVY A;  2AM3 A;  4BQH A;  4Y6N A;  5AJO A;  1H7H A;  2E3D A;  3DUV A;  1WT3 A;  1H5T B;  2FYA A;  3U2V A;  2FFU A;  3I0C A;  3ZLL A;  5D92 A;  1JV1 A;  2A8U A;  3IOJ A;  1TZF A;  2V0J A;  4M2B A;  2X5S A;  1H7E A;  5DDV A;  1H5S A;  3SX5 A;  3I0G A;  4CVH A;  2YCM A;  1HM8 A;  3V0N A;  1LL3 A;  2XME A;  1FR9 A;  1G2V A;  2PA4 A;  4MYB A;  2OI6 A;  1W57 A;  1VZX A;  2JCO A;  5FTS A;  4B4B A;  2V0H A;  1LZ7 A;  5D91 A;  2ICX A;  3Q7U A;  4Y64 A;  4KPZ A;  1VH1 A;  1HM0 A;  3CGX A;  1VGU A;  1FO8 A;  1INJ A;  5CMI A;  4M4K A;  3ZF8 A;  4HOC A;  4G3S A;  2V0I A;  2Q4J A;  4KC2 A;  2FY7 A;  2Z86 A;  5HS2 A;  1FXO A;  2X5Z A;  2VK9 A;  1WT2 A;  1ZDG A;  5CQL X;  1OMX A;  1H7F A;  5EIY A;  2XWL A;  4EVW A;  4D11 C;  1ZCU A;  1G23 A;  2FYD B;  1R7Y A;  3F1C A;  2RIZ A;  1ZJ0 A;  1VZT A;  4M28 A;  2RJ9 A;  4Y7G A;  3OAM A;  4EEA A;  1YP4 A;  1G1L A;  1GX4 A;  1ZI3 A;  2RJ0 A;  5C38 A;  1V83 A;  4Y7F A;  3SX8 A;  1PZY B;  2YC5 A;  3QVB A;  1O7Q A;  3RSB A;  1R7T A;  3T7N A;  5CQO A;  4FRM A;  3U2T A;  2ZU7 A;  1JYL A;  3USQ A;  2FYB A;  3PKQ A;  5EJZ A;  2UX8 A;  4JIS A;  1WVC A;  1ZHJ A;  3CKO A;  4HO3 A;  3V0L A;  4B3U A;  4HO5 A;  1E5K A;  3OH4 A;  2W0W A;  3T7O A;  4FRA A;  4EEO A;  3D8V A;  2VSH A;  2MZB A;  2YQH A;  2RJ6 A;  4CJB A;  2FFV A;  4Y7U A;  1YP3 A;  4K6R A;  1H5S B;  4EEG A;  4Y6U A;  5C4E A;  5L6V A;  4DEC A;  5FU0 A;  2RJ8 A;  1KWS A;  1ZJ3 A;  1ON8 A;  4YS8 A;  4E1K A;  3K8E A;  4AAW A;  4FIY A;  1IIN A;  4Y63 A;  2FYC B;  4NAK A;  3LW6 A;  3SXD A;  1ZJ1 A;  5AJN A;  4B4G A;  5C4B A;  1VM8 A;  3U0Y A;  1NMM B;  2VS4 A;  4UEG A;  3SXE A;  4KPX A;  4FRE A;  3FOQ A;  1TW5 A;  1GQ9 A;  1WT0 A;  4G3P A;  1NWG B;  1VZU A;  4JD0 A;  5FUH A;  1OQM B;  1NF5 B;  1R7V A;  4FRQ A;  2AEC A;  2XWM A;  3ST8 A;  1MP5 A;  2JCJ A;  1Z90 A;  2AGD A;  2I5E A;  5CMJ A;  5EJ1 A;  1HV9 A;  3FWW A;  1XZ6 A;  5C49 A;  3D98 A;  3V8Z A;  2J0A A;  1ZI4 A;  4B4M A;  2W0V A;  3CKV A;  4KRV A;  4KNR A;  2VSI A;  2RJ1 A;  2QH5 A;  1H5R A;  4CJC A;  5BXC A;  4HO0 A;  1FZW A;  2JCK A;  2O1F A;  4B5B A;  2V0L A;  3U2U A;  1FRW A;  1V84 A;  2WE9 A;  4G3Q A;  1W55 A;  1LZ0 A;  2Y6P A;  1VPA A;  3CU0 A;  3ZGG A;  1H4D A;  2ZU8 A;  4R7P A;  4LW3 A;  2I5K A;  2Y4K A;  4P02 A;  2Y7A A;  2XMH A;  5C47 A;  1H7L A;  2BO6 A;  1ZCV A;  4FRP A;  3U2X A;  3BCV A;  1FO9 A;  1ZIZ A;  3F1Y A;  3SX7 A;  4FCE A;  3OGZ A;  2OEG A;  3BRK X;  1O0R A;  3JUJ A;  2DPW A;  5C4F A;  4EE5 A;  3SXC A;  2AM5 A;  2ICY A;  2PGY A;  1JV3 A;  2P73 A;  3DK5 A;  3T7M A;  2PX7 A;  3NGW A;  4D0Z A;  4O6M A;  2RJ4 A;  2RIT A;  2WVK A;  2YES A;  4NAL A;  3SXG A;  1NKH B;  5C3A A;  2ZU9 A;  3RMW A;  2AH9 A;  3I0F A;  2E8B A;  2BO7 A;  5C8R A;  4NAI A;  3I0E A;  4NAN A;  1YRO B;  1HJJ A;  1VIC A;  5FTV A;  1LL0 A;  1ZI5 A;  3OH2 A;  4KC4 A;  1R82 A;  4ASY A;  4IRQ A;  2CU2 A;  3I0L A;  4AYL A;  5C48 A;  3HL3 A;  2AES A;  3PKP A;  2RJ5 A;  4KC1 A;  3RMV A;  1V82 A;  3O3P A;  5C36 A;  4Q7C A;  4DE7 A;  1ZDF A;  1VGZ A;  3CKN A;  5DDT A;  4ASJ A;  1MC3 A;  3JUK A;  2X60 A;  1H7Q A;  2YQJ A;  1G97 A;  5C3D A;  4HO8 A;  5C1H A;  4CJ8 A;  1G8O A;  1HJL A;  3V91 A;  3IOI A;  1H5R B;  1H5S C;  2D0J A;  4B2X A;  4GBP A;  3OH0 A;  3U0X A;  5L6S A;  1FWY A;  3U2W A;  1INI A;  1VGT A;  4L41 C;  2VS5 A;  1QGQ A;  2JCL A;  4KXO A;  4P00 A;  2NXV A;  3TZT A;  4G87 A;  2YQC A;  4KNX A;  4FQW A;  2P72 A;  4D11 A;  3I0I X;  2OI7 A;  3V8Y A;  2Y4M A;  4Y9X A;  1LZI A;  4ECM A;  3I0D A;  1ZJ2 A;  2APC A;  2J0B A;  4EE4 A;  3Q80 A;  1TW1 A;  3POL A;  5IFY A;  5JQQ A;  1G3L A;  2Z87 A;  4Y7T A;  2WGZ A;  5CMH A;  5C3B A;  1R81 A;  2RIX A;  3D5N A;  2RJ7 A;  4KT7 A;  1GQC A;  3V0O A;  1H7G A;  2AE7 A;  2BO4 A;  4B42 A;  4O6N A;  1YP2 A;  3SPT A;  1XHB A;  1S4O A;  2V0K A;  5FU8 A;  4FRO A;  1PZT A;  5CQP A;  4LW6 A;  2GGQ A;  1G0R A;  2YQS A;  4HO9 A;  4DDZ A;  1JVG A;  3SXA A;  3R2W A;  2I7B A;  1IIM A;  2D7I A;  1FGG A;  1R80 A;  4FRB A;  1W77 A;  3ZLK A;  4FCU A;  4Y62 A;  3OH3 A;  1LL2 A;  3V0M A;  1ZI1 A;  3DJ4 A;  3OH1 A;  4BMA A;  4D0T A;  1QGS A;  4EE3 A;  1S4N A;  3JTJ A;  1SS9 A;  2OI5 A;  3PNN A;  1GWW A;  4HG6 A;  3USR A;  2VXL A;  4C2S A;  1S4P A;  3ZGF A;  1GX0 A;  1VH3 A;  1K4V A;  2VS3 A;  5CMG X;  4FRH A;  2A8W A;  2WEE A;  1R7U A;  2VD4 A;  2QKX A;  2P6W A;  3V90 A;  2BO8 A;  1FXJ A;  5C1L A;  1GWV A;  5C1G A;  4KQL A;  1QG8 A;  3GUE A;  3OKR A;  3TQD A;  2RIY A;  2WVL A;  4HO6 A;  3SX3 A;  3OC9 A;  1H5T A;  1WSZ A;  4ARW A;  1LZJ A;  2Y4J A;  3V0Q A;  1GA8 A;  1EYR A;  3I0H A;  4FRL A;  1O7O A;  1OMZ A;  2VFZ A;  2QGI A;  2O1H A;  1HM9 A;  4EEM A;  1QWJ A;  1NQI B;  1WT1 A;  3R3I A;  1H4C A;  1FR8 A;  1ZCT A;  4B2W A;  3KIA A;  4D48 A;  5FYE A;  5C4C A;  1MP4 A;  1LVW A;  1R7X A;  3CKJ A;  4FRD A;  2D7R A;  4J18 A;  2PGV A;  1NHE B;  2WVM A;  3I0J A;  2VXM A;  1FG5 N;  4AC3 A;  5IDS A;  4HO2 A;  1MP3 A;  1H7T A;  1H5S D;  1VGW A;  4Y7V A;  1FOA A;  2O1G A;  2Y4L A;  3EE5 A;  3I0K A;  2WAW A;  1EZI A;  4XWI A;  5IDT A;  1G9R A;  1FGX A;  2GGO A;  3SXB A;  1H4E A;  5FV9 A;  4M2A A;  4MND A;  5AJP A;  1JVD A;  4HO4 A;  5CQN X;  1ZJO A;  2C0N A;  1JYK A;  4HCQ A;  3IOH A;  1H3M A;  1ON6 A;  3CKQ A;  3E25 A;  2AM4 A;  3K8D A;  3V0P A;  2X65 A;  5J49 A;  3E26 A;  2YC3 A;  3N9W A;  1G93 A;  1ZCY A;  4FIX A;  5CMF X;  3Q4S A;  5I1F A;  1G95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...