3RSBA

Structure of the archaeal gtp:adocbi-p guanylyltransferase (coby) from methanocaldococcus jannaschii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
191
structure length
177
Chain Sequence
MDALIMATRMGGVEKPLIKLCGRCLIDYVVSPLLKSKVNNIFIATSPNTPKTKEYINSAYKDYKNIVVIEDLNECIGYFSEPFLVVSSDLINLKSKIINSIVDYFYCIKAKTPEALAVMIPKEKYPNPSIDFNGLVPADINVVSPKHGYQKEEIMVIDELIFNINTKDDLKLAEMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosylcobinamide-phosphate guanylyltransferase
publication title Structure and Mutational Analysis of the Archaeal GTP:AdoCbi-P Guanylyltransferase (CobY) from Methanocaldococcus jannaschii: Insights into GTP Binding and Dimerization.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 33
structure length 177
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.62: Adenosylcobinamide-phosphate guanylyltransferase.
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3rsbA00
3D8VA 1FOAA 2NXVA 1OQMB 4HO5A 5JQQA 3DUVA 1MP3A 1OMXA 3V0LA 1FG5N 1JV1A 2RJ0A 2GGQA 2YQJA 2JCLA 2YQCA 4FRLA 4CVHA 3SXCA 3CKQA 2YESA 1ZJPA 1H7HA 3I0HA 2D7IA 1R7TA 3I0JA 3T7NA 3SXAA 1R82A 1WT1A 1ZI1A 2WE9A 1QWJA 4KPZA 1FR9A 4FRHA 3QVBA 1GWWA 4KRVA 1H5TA 2JCKA 2D0JA 5FU8A 1SS9A 4L41C 3CKVA 4HOCA 1H3MA 1R80A 1JVGA 4FRAA 4D11C 1VZXA 4J18A 1H4DA 1H7EA 3FOQA 4P00A 5C1HA 5FYEA 4EEMA 3LW6A 3V8YA 2FY7A 1VM8A 4FQWA 2VS3A 3DK5A 3V0PA 1V84A 4KQLA 1H5SC 1HJLA 2GGOA 1FO8A 3I0DA 3U2UA 1VPAA 1JVDA 2I5EA 4NANA 2RJ8A 3SXBA 1G93A 2V0JA 4G3SA 3OH1A 3TQDA 3RMWA 4JD0A 4BQHA 1NKHB 1FRWA 3JUJA 4CJCA 3CKJA 1H7GA 2ZU7A 4FRMA 3ZF8A 5CQMX 4YS8A 3ZLKA 5FTVA 4IRQA 1VGUA 2ICYA 1EZIA 1YROB 2BO4A 2V0IA 1XHBA 2FFUA 4P02A 4Y7GA 5C3BA 2WEEA 2P72A 4FRPA 3ZGFA 1MP4A 4HO4A 1H5RB 5CMGX 2VSIA 4ECMA 3SX7A 5I1FA 2AM5A 5C3AA 1R7YA 1O7QA 5EIYA 4D0ZA 1JYLA 1S4OA 3SX8A 1LL2A 1PZYB 5BXCA 2E8BA 3USRA 2APCA 1GA8A 4DE7A 1GX0A 3Q4SA 2BO8A 1ZI3A 2BO7A 2P6WA 2VSHA 1W57A 3I0FA 3I0GA 5L6VA 4G87A 2YC5A 1ZCYA 5IFYA 1GWVA 1FXJA 2PA4A 4B4GA 4ZDQA 3SX5A 3V0OA 5AJOA 3K8EA 1E5KA 2RJ9A 2YQSA 2D7RA 2RJ5A 3OGZA 3SPTA 1IINA 4Y7UA 3SX3A 1PZTA 1VZUA 3PKPA 4KNRA 4EE3A 1HM8A 3O3PA 2UX8A 1G3LA 2WVMA 1V83A 2AGDA 5C4EA 2JCJA 1TVYA 1ZCTA 4FRDA 2BO6A 2OEFA 2Y7AA 2A8UA 3SXDA 3U2TA 1H4EA 1HJJA 4AC3A 4B42A 1FWYA 2I7BA 2FYDB 4KC1A 2Y4KA 4B2XA 2RJ7A 5EJ1A 3CKOA 1LL0A 2XMHA 3I0EA 3U2WA 1FGXA 2OI7A 1JV3A 3IOHA 3DJ4A 1HM0A 3PNNA 4FROA 4HO9A 1INJA 4CJBA 1LZJA 3IOIA 1FGGA 3I0CA 1VGZA 1H5SB 5IDSA 5C1LA 4EE4A 1TW1A 1VH3A 3OC9A 3CKNA 5DDTA 4C2SA 3IOJA 4B5BA 1LL3A 2RIYA 2Y4MA 1WT3A 1G1LA 1H5SD 3K8DA 5C8RA 1H4CA 2YC3A 4ARWA 3CGXA 1O23B 3U2VA 1TZFA 4E1KA 5FUHA 3KIAA 1G0RA 1ZDGA 2A8WA 2Z86A 4FRBA 3ZGGA 5C4BA 4IRPA 3OH2A 2WVLA 4KC2A 1G23A 3OKRA 1NHEB 4G3QA 3V90A 4DDZA 1YP2A 1FR8A 4Y6NA 4DECA 2DPWA 2O1GA 2JCOA 5CQLX 1S4NA 2XWLA 3JTJA 3N9WA 1ON8A 1ZCVA 3SXGA 1LZ7A 3GUEA 2VS4A 1FZWA 2WVKA 2X65A 3ZLLA 1ZJ0A 3OH4A 5CMHA 5CQOA 2VD4A 1H7LA 1GX4A 2VFZA 3E25A 1W55A 4HO6A 2ZU8A 3POLA 3NGWA 4Y7VA 1NWGB 5J49A 1YP4A 1TW5A 3BCVA 1S4PA 1XZ6A 4G3PA 2QH5A 1I52A 4EEOA 4HO8A 4AYLA 5C4DA 1H7FA 2RJ1A 5L6SA 4FCUA 3OH0A 5EJZA 2AM3A 5C48A 2V0LA 4R7PA 2FYCB 2PGVA 1R7UA 5DDVA 2O1HA 4NAIA 2VXLA 3E26A 4Y7FA 3JUKA 5CQPA 4M2AA 5C47A 5FV9A 2W0WA 3PKQA 1ZJOA 2Y6PA 3HL3A 1EYRA 1H5RA 5C3DA 2O1FA 1MP5A 4ASYA 1WT0A 4EE5A 3D5NA 5C38A 3U2XA 4AYJA 1ZIZA 1VH1A 3Q7UA 5C4CA 1O0RA 3T7OA 1FXOA 3Q80A 4Y6UA 4HO0A 5HS2A 3F1CA 1HM9A 1JYKA 4JISA 2AE7A 3V0NA 2W0VA 3T7MA 4MNDA 1HV9A 4ASJA 4FCEA 3USQA 2V0HA 1MC3A 4FREA 5CMJA 1IIMA 4FRQA 1R81A 4HO3A 1NQIB 4LW3A 4KXOA 4MYBA 3V8ZA 1ZI4A 2X60A 2AM4A 2OI6A 2E3DA 3D98A 1H5TB 4BMAA 2WAWA 3BRKX 3V0MA 1QGQA 2VXMA 4HO2A 2RJ6A 1GQCA 1VGWA 1ON6A 2QKXA 3OH3A 4XWIA 3EE5A 4HCQA 5FTSA 1G97A 4EVWA 1R7VA 2ZU9A 4UEGA 3RSBA 1INIA 2FYAA 3F1YA 1LZIA 2FFVA 2OEGA 2XMEA 5CMFX 1GQ9A 1ZDFA 4LW6A 4D11A 4NALA 5IDTA 2PGYA 3R3IA 2Q4JA 4B4BA 1QG8A 2RJ4A 1W77A 4M28A 1FO9A 4NAKA 4EEAA 1H5SA 1VZTA 3I0LA 1G9RA 3V91A 1H7TA 5CMIA 2X5SA 4KT7A 3R2WA 1ZCUA 5AJPA 4KNXA 1LZ0A 1WVCA 1Z90A 3U0YA 4Y63A 2AECA 4HG6A 4Y7TA 2XWMA 3I0KA 2WGZA 4K6RA 3RMVA 2X5ZA 4KC4A 4CJ8A 1YP3A 4D0TA 1KWSA 1G95A 3U0XA 2ICXA 4Y62A 4M2BA 1WT2A 1R7XA 2QGIA 2Y4JA 2RIZA 5FU0A 2MZBA 3ST8A 4B4MA 4Y9XA 5CQNX 4GBPA 5C4FA 3SXEA 1O7OA 2Y4LA 1VICA 4D48A 3CU0A 3V0QA 2I5KA 2YCMA 1K4VA 2AESA 5C36A 4B2WA 1H7QA 1G2VA 1WSZA 4KPXA 5C49A 2CU2A 2VS5A 1ZJ3A 3OAMA 3FWWA 2FYBA 2RIXA 4AAWA 1ZI5A 5AJNA 1ZHJA 2V0KA 1V82A 1QGSA 5C1GA 3I0IX 1LVWA 1NF5B 2P73A 2XWNA 1NMMB 1ZJ1A 4EEGA 1VGTA 2AH9A 2Z87A 4B3UA 2PX7A 1ZJ2A 2RITA 2YQHA 4M4KA 4Y64A 1OMZA 1G8OA 2OI5A 3TZTA
chains in the Genus database with same CATH superfamily
3D8VA 1FOAA 2NXVA 1OQMB 4HO5A 5JQQA 3DUVA 1MP3A 1OMXA 3V0LA 1FG5N 1JV1A 2RJ0A 2GGQA 2YQJA 2JCLA 2YQCA 4FRLA 4CVHA 3SXCA 3CKQA 2YESA 1ZJPA 1H7HA 3I0HA 2D7IA 1R7TA 3I0JA 3T7NA 3SXAA 1R82A 1WT1A 1ZI1A 2WE9A 1QWJA 4KPZA 1FR9A 4FRHA 3QVBA 1GWWA 4KRVA 1H5TA 2JCKA 2D0JA 5FU8A 1SS9A 4L41C 3CKVA 4HOCA 1H3MA 1R80A 1JVGA 4FRAA 4D11C 1VZXA 4J18A 1H4DA 1H7EA 3FOQA 4P00A 5C1HA 5FYEA 4EEMA 3LW6A 3V8YA 2FY7A 1VM8A 4FQWA 2VS3A 3DK5A 3V0PA 1V84A 4KQLA 1H5SC 1HJLA 2GGOA 1FO8A 3I0DA 3U2UA 1VPAA 1JVDA 2I5EA 4NANA 2RJ8A 3SXBA 1G93A 2V0JA 4G3SA 2C0NA 3OH1A 3TQDA 3RMWA 4JD0A 4BQHA 1NKHB 1FRWA 3JUJA 4CJCA 3CKJA 1H7GA 2ZU7A 4FRMA 3ZF8A 5CQMX 4YS8A 3ZLKA 5FTVA 4IRQA 1VGUA 2ICYA 1EZIA 1YROB 2BO4A 2V0IA 1XHBA 2FFUA 4P02A 4Y7GA 5C3BA 2WEEA 2P72A 4FRPA 3ZGFA 1MP4A 4HO4A 1H5RB 5CMGX 2VSIA 4ECMA 3SX7A 5I1FA 2AM5A 5C3AA 1R7YA 1O7QA 5EIYA 4D0ZA 1JYLA 1S4OA 3SX8A 1LL2A 1PZYB 5BXCA 2E8BA 3USRA 2APCA 1GA8A 4DE7A 1GX0A 3Q4SA 2BO8A 1ZI3A 2BO7A 2P6WA 2VSHA 1W57A 3I0FA 3I0GA 5L6VA 4G87A 2YC5A 1ZCYA 5IFYA 1GWVA 1FXJA 2PA4A 4B4GA 4ZDQA 3SX5A 3V0OA 5AJOA 3K8EA 1E5KA 2RJ9A 2YQSA 2D7RA 2RJ5A 3OGZA 3SPTA 1IINA 4Y7UA 3SX3A 1PZTA 2J0AA 2VK9A 1VZUA 3PKPA 4KNRA 4EE3A 1HM8A 3O3PA 2UX8A 1G3LA 2WVMA 1V83A 2AGDA 5C4EA 2JCJA 1TVYA 1ZCTA 4FRDA 2BO6A 4O6NA 2OEFA 2Y7AA 2A8UA 3SXDA 3U2TA 1H4EA 1HJJA 4AC3A 4B42A 1FWYA 2I7BA 2FYDB 4KC1A 2Y4KA 4B2XA 2RJ7A 5EJ1A 3CKOA 2J0BA 1LL0A 2XMHA 3I0EA 3U2WA 1FGXA 2OI7A 1JV3A 3IOHA 3DJ4A 1HM0A 4Q7CA 3PNNA 4FROA 4HO9A 1INJA 4CJBA 1LZJA 3IOIA 1FGGA 3I0CA 1VGZA 1H5SB 5IDSA 5C1LA 4EE4A 1TW1A 1VH3A 3OC9A 3CKNA 5DDTA 4C2SA 3IOJA 4FIXA 4B5BA 1LL3A 2RIYA 2Y4MA 1WT3A 1G1LA 1H5SD 3K8DA 5C8RA 1H4CA 2YC3A 4ARWA 3CGXA 1O23B 3U2VA 1TZFA 4E1KA 5FUHA 3KIAA 1G0RA 1ZDGA 2A8WA 2Z86A 4FRBA 3ZGGA 5C4BA 4IRPA 3OH2A 2WVLA 4KC2A 1G23A 3OKRA 1NHEB 4G3QA 3V90A 4DDZA 1YP2A 1FR8A 4Y6NA 4DECA 2DPWA 2O1GA 2JCOA 5CQLX 1S4NA 2XWLA 3JTJA 3N9WA 1ON8A 1ZCVA 3SXGA 1LZ7A 3GUEA 2VS4A 1FZWA 2WVKA 2X65A 3ZLLA 1ZJ0A 3OH4A 5CMHA 5CQOA 2VD4A 1H7LA 1GX4A 2VFZA 3E25A 1W55A 4HO6A 2ZU8A 3POLA 3NGWA 4Y7VA 1NWGB 5J49A 1YP4A 1TW5A 3BCVA 1S4PA 1XZ6A 4G3PA 2QH5A 1I52A 4EEOA 4HO8A 4AYLA 5C4DA 1H7FA 2RJ1A 5L6SA 4FCUA 3OH0A 5EJZA 2AM3A 5C48A 2V0LA 4R7PA 2FYCB 2PGVA 1R7UA 5DDVA 2O1HA 4NAIA 2VXLA 3E26A 4Y7FA 3JUKA 5CQPA 4M2AA 5C47A 5FV9A 2W0WA 3PKQA 1ZJOA 2Y6PA 3HL3A 1EYRA 1H5RA 5C3DA 2O1FA 1MP5A 4ASYA 1WT0A 4EE5A 3D5NA 5C38A 3U2XA 4AYJA 1ZIZA 1VH1A 3Q7UA 5C4CA 1O0RA 3T7OA 1FXOA 3Q80A 4Y6UA 4HO0A 5HS2A 3F1CA 1HM9A 1JYKA 4JISA 2AE7A 3V0NA 2W0VA 3T7MA 4MNDA 1HV9A 4ASJA 4FCEA 3USQA 2V0HA 1MC3A 4FREA 5CMJA 1IIMA 4FRQA 1R81A 4HO3A 1NQIB 4LW3A 4KXOA 4MYBA 3V8ZA 1ZI4A 2X60A 2AM4A 2OI6A 2E3DA 3D98A 1H5TB 4BMAA 2WAWA 3BRKX 3V0MA 1QGQA 2VXMA 4HO2A 2RJ6A 1GQCA 1VGWA 1ON6A 2QKXA 3OH3A 4XWIA 3EE5A 4HCQA 5D92A 5FTSA 1G97A 4EVWA 1R7VA 2ZU9A 4UEGA 3RSBA 1INIA 2FYAA 3F1YA 1LZIA 2FFVA 2OEGA 2XMEA 5CMFX 1GQ9A 1ZDFA 4LW6A 4D11A 4NALA 5IDTA 2PGYA 3R3IA 2Q4JA 4B4BA 1QG8A 2RJ4A 1W77A 4M28A 1FO9A 4NAKA 4EEAA 1H5SA 1VZTA 3I0LA 1G9RA 3V91A 1H7TA 5CMIA 2X5SA 4MIXA 4KT7A 3R2WA 1ZCUA 5AJPA 4KNXA 1LZ0A 1WVCA 1Z90A 3U0YA 4Y63A 2AECA 4HG6A 4Y7TA 2XWMA 3I0KA 2WGZA 4K6RA 3RMVA 2X5ZA 4KC4A 4CJ8A 1YP3A 5D91A 4D0TA 1KWSA 1G95A 3U0XA 2ICXA 4Y62A 4M2BA 1WT2A 1R7XA 2QGIA 2Y4JA 2RIZA 5FU0A 2MZBA 3ST8A 4B4MA 4Y9XA 5CQNX 4GBPA 5C4FA 3SXEA 1O7OA 2Y4LA 1VICA 4D48A 3CU0A 3V0QA 2I5KA 2YCMA 1K4VA 2AESA 5C36A 4B2WA 1H7QA 1G2VA 1WSZA 4KPXA 5C49A 2CU2A 4O6MA 2VS5A 1ZJ3A 3OAMA 3FWWA 2FYBA 2RIXA 4AAWA 1ZI5A 5AJNA 1ZHJA 2V0KA 1V82A 1QGSA 5C1GA 3I0IX 1LVWA 1NF5B 2P73A 2XWNA 1NMMB 1ZJ1A 4EEGA 1VGTA 2AH9A 2Z87A 4B3UA 2PX7A 1ZJ2A 2RITA 2YQHA 4M4KA 4Y64A 1OMZA 1G8OA 2OI5A 4FIYA 3TZTA
chains in the Genus database with same CATH topology
3D8VA 1FOAA 2NXVA 1OQMB 4HO5A 5JQQA 3DUVA 1MP3A 1OMXA 3V0LA 1FG5N 1JV1A 2RJ0A 2GGQA 2YQJA 2JCLA 2YQCA 4FRLA 4CVHA 3SXCA 3CKQA 2YESA 1ZJPA 1H7HA 3I0HA 2D7IA 1R7TA 3I0JA 3T7NA 3SXAA 1R82A 1WT1A 1ZI1A 2WE9A 1QWJA 4KPZA 1FR9A 4FRHA 3QVBA 1GWWA 4KRVA 1H5TA 2JCKA 2D0JA 5FU8A 1SS9A 4L41C 3CKVA 4HOCA 1H3MA 1R80A 1JVGA 4FRAA 4D11C 1VZXA 4J18A 1H4DA 1H7EA 3FOQA 4P00A 5C1HA 5FYEA 4EEMA 3LW6A 3V8YA 2FY7A 1VM8A 4FQWA 2VS3A 3DK5A 3V0PA 1V84A 4KQLA 1H5SC 1HJLA 2GGOA 1FO8A 3I0DA 3U2UA 1VPAA 1JVDA 2I5EA 4NANA 2RJ8A 3SXBA 1G93A 2V0JA 4G3SA 2C0NA 3OH1A 3TQDA 3RMWA 4JD0A 4BQHA 1NKHB 1FRWA 3JUJA 4CJCA 3CKJA 1H7GA 2ZU7A 4FRMA 3ZF8A 5CQMX 4YS8A 3ZLKA 5FTVA 4IRQA 1VGUA 2ICYA 1EZIA 1YROB 2BO4A 2V0IA 1XHBA 2FFUA 4P02A 4Y7GA 5C3BA 2WEEA 2P72A 4FRPA 3ZGFA 1MP4A 4HO4A 1H5RB 5CMGX 2VSIA 4ECMA 3SX7A 5I1FA 2AM5A 5C3AA 1R7YA 1O7QA 5EIYA 4D0ZA 1JYLA 1S4OA 3SX8A 1LL2A 1PZYB 5BXCA 2E8BA 3USRA 2APCA 1GA8A 4DE7A 1GX0A 3Q4SA 2BO8A 1ZI3A 2BO7A 2P6WA 2VSHA 1W57A 3I0FA 3I0GA 5L6VA 4G87A 2YC5A 1ZCYA 5IFYA 1GWVA 1FXJA 2PA4A 4B4GA 4ZDQA 3SX5A 3V0OA 5AJOA 3K8EA 1E5KA 2RJ9A 2YQSA 2D7RA 2RJ5A 3OGZA 3SPTA 1IINA 4Y7UA 3SX3A 1PZTA 2J0AA 2VK9A 1VZUA 3PKPA 4KNRA 4EE3A 1HM8A 3O3PA 2UX8A 1G3LA 2WVMA 1V83A 2AGDA 5C4EA 2JCJA 1TVYA 1ZCTA 4FRDA 2BO6A 4O6NA 2OEFA 2Y7AA 2A8UA 3SXDA 3U2TA 1H4EA 1HJJA 4AC3A 4B42A 1FWYA 2I7BA 2FYDB 4KC1A 2Y4KA 4B2XA 2RJ7A 5EJ1A 3CKOA 2J0BA 1LL0A 2XMHA 3I0EA 3U2WA 1FGXA 2OI7A 1JV3A 3IOHA 3DJ4A 1HM0A 4Q7CA 3PNNA 4FROA 4HO9A 1INJA 4CJBA 1LZJA 3IOIA 1FGGA 3I0CA 1VGZA 1H5SB 5IDSA 5C1LA 4EE4A 1TW1A 1VH3A 3OC9A 3CKNA 5DDTA 4C2SA 3IOJA 4FIXA 4B5BA 1LL3A 2RIYA 2Y4MA 1WT3A 1G1LA 1H5SD 3K8DA 5C8RA 1H4CA 2YC3A 4ARWA 3CGXA 1O23B 3U2VA 1TZFA 4E1KA 5FUHA 3KIAA 1G0RA 1ZDGA 2A8WA 2Z86A 4FRBA 3ZGGA 5C4BA 4IRPA 3OH2A 2WVLA 4KC2A 1G23A 3OKRA 1NHEB 4G3QA 3V90A 4DDZA 1YP2A 1FR8A 4Y6NA 4DECA 2DPWA 2O1GA 2JCOA 5CQLX 1S4NA 2XWLA 3JTJA 3N9WA 1ON8A 1ZCVA 3SXGA 1LZ7A 3GUEA 2VS4A 1FZWA 2WVKA 2X65A 3ZLLA 1ZJ0A 3OH4A 5CMHA 5CQOA 2VD4A 1H7LA 1GX4A 2VFZA 3E25A 1W55A 4HO6A 2ZU8A 3POLA 3NGWA 4Y7VA 1NWGB 5J49A 1YP4A 1TW5A 3BCVA 1S4PA 1XZ6A 4G3PA 2QH5A 1I52A 4EEOA 4HO8A 4AYLA 5C4DA 1H7FA 2RJ1A 5L6SA 4FCUA 3OH0A 5EJZA 2AM3A 5C48A 2V0LA 4R7PA 2FYCB 2PGVA 1R7UA 5DDVA 2O1HA 4NAIA 2VXLA 3E26A 4Y7FA 3JUKA 5CQPA 4M2AA 5C47A 5FV9A 2W0WA 3PKQA 1ZJOA 2Y6PA 3HL3A 1EYRA 1H5RA 5C3DA 2O1FA 1MP5A 4ASYA 1WT0A 4EE5A 3D5NA 5C38A 3U2XA 4AYJA 1ZIZA 1VH1A 3Q7UA 5C4CA 1O0RA 3T7OA 1FXOA 3Q80A 4Y6UA 4HO0A 5HS2A 3F1CA 1HM9A 1JYKA 4JISA 2AE7A 3V0NA 2W0VA 3T7MA 4MNDA 1HV9A 4ASJA 4FCEA 3USQA 2V0HA 1MC3A 4FREA 5CMJA 1IIMA 4FRQA 1R81A 4HO3A 1NQIB 4LW3A 4KXOA 4MYBA 3V8ZA 1ZI4A 2X60A 2AM4A 2OI6A 2E3DA 3D98A 1H5TB 4BMAA 2WAWA 3BRKX 3V0MA 1QGQA 2VXMA 4HO2A 2RJ6A 1GQCA 1VGWA 1ON6A 2QKXA 3OH3A 4XWIA 3EE5A 4HCQA 5D92A 5FTSA 1G97A 4EVWA 1R7VA 2ZU9A 4UEGA 3RSBA 1INIA 2FYAA 3F1YA 1LZIA 2FFVA 2OEGA 2XMEA 5CMFX 1GQ9A 1ZDFA 4LW6A 4D11A 4NALA 5IDTA 2PGYA 3R3IA 2Q4JA 4B4BA 1QG8A 2RJ4A 1W77A 4M28A 1FO9A 4NAKA 4EEAA 1H5SA 1VZTA 3I0LA 1G9RA 3V91A 1H7TA 5CMIA 2X5SA 4MIXA 4KT7A 3R2WA 1ZCUA 5AJPA 4KNXA 1LZ0A 1WVCA 1Z90A 3U0YA 4Y63A 2AECA 4HG6A 4Y7TA 2XWMA 3I0KA 2WGZA 4K6RA 3RMVA 2X5ZA 4KC4A 4CJ8A 1YP3A 5D91A 4D0TA 1KWSA 1G95A 3U0XA 2ICXA 4Y62A 4M2BA 1WT2A 1R7XA 2QGIA 2Y4JA 2RIZA 5FU0A 2MZBA 3ST8A 4B4MA 4Y9XA 5CQNX 4GBPA 5C4FA 3SXEA 1O7OA 2Y4LA 1VICA 4D48A 3CU0A 3V0QA 2I5KA 2YCMA 1K4VA 2AESA 5C36A 4B2WA 1H7QA 1G2VA 1WSZA 4KPXA 5C49A 2CU2A 4O6MA 2VS5A 1ZJ3A 3OAMA 3FWWA 2FYBA 2RIXA 4AAWA 1ZI5A 5AJNA 1ZHJA 2V0KA 1V82A 1QGSA 5C1GA 3I0IX 1LVWA 1NF5B 2P73A 2XWNA 1NMMB 1ZJ1A 4EEGA 1VGTA 2AH9A 2Z87A 4B3UA 2PX7A 1ZJ2A 2RITA 2YQHA 4M4KA 4Y64A 1OMZA 1G8OA 2OI5A 4FIYA 3TZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8V A;  1FOA A;  2NXV A;  1OQM B;  4HO5 A;  5JQQ A;  3DUV A;  1MP3 A;  1OMX A;  3V0L A;  1FG5 N;  1JV1 A;  2RJ0 A;  2GGQ A;  2YQJ A;  2JCL A;  2YQC A;  4FRL A;  4CVH A;  3SXC A;  3CKQ A;  2YES A;  1ZJP A;  1H7H A;  3I0H A;  2D7I A;  1R7T A;  3I0J A;  3T7N A;  3SXA A;  1R82 A;  1WT1 A;  1ZI1 A;  2WE9 A;  1QWJ A;  4KPZ A;  1FR9 A;  4FRH A;  3QVB A;  1GWW A;  4KRV A;  1H5T A;  2JCK A;  2D0J A;  5FU8 A;  1SS9 A;  4L41 C;  3CKV A;  4HOC A;  1H3M A;  1R80 A;  1JVG A;  4FRA A;  4D11 C;  1VZX A;  4J18 A;  1H4D A;  1H7E A;  3FOQ A;  4P00 A;  5C1H A;  5FYE A;  4EEM A;  3LW6 A;  3V8Y A;  2FY7 A;  1VM8 A;  4FQW A;  2VS3 A;  3DK5 A;  3V0P A;  1V84 A;  4KQL A;  1H5S C;  1HJL A;  2GGO A;  1FO8 A;  3I0D A;  3U2U A;  1VPA A;  1JVD A;  2I5E A;  4NAN A;  2RJ8 A;  3SXB A;  1G93 A;  2V0J A;  4G3S A;  3OH1 A;  3TQD A;  3RMW A;  4JD0 A;  4BQH A;  1NKH B;  1FRW A;  3JUJ A;  4CJC A;  3CKJ A;  1H7G A;  2ZU7 A;  4FRM A;  3ZF8 A;  5CQM X;  4YS8 A;  3ZLK A;  5FTV A;  4IRQ A;  1VGU A;  2ICY A;  1EZI A;  1YRO B;  2BO4 A;  2V0I A;  1XHB A;  2FFU A;  4P02 A;  4Y7G A;  5C3B A;  2WEE A;  2P72 A;  4FRP A;  3ZGF A;  1MP4 A;  4HO4 A;  1H5R B;  5CMG X;  2VSI A;  4ECM A;  3SX7 A;  5I1F A;  2AM5 A;  5C3A A;  1R7Y A;  1O7Q A;  5EIY A;  4D0Z A;  1JYL A;  1S4O A;  3SX8 A;  1LL2 A;  1PZY B;  5BXC A;  2E8B A;  3USR A;  2APC A;  1GA8 A;  4DE7 A;  1GX0 A;  3Q4S A;  2BO8 A;  1ZI3 A;  2BO7 A;  2P6W A;  2VSH A;  1W57 A;  3I0F A;  3I0G A;  5L6V A;  4G87 A;  2YC5 A;  1ZCY A;  5IFY A;  1GWV A;  1FXJ A;  2PA4 A;  4B4G A;  4ZDQ A;  3SX5 A;  3V0O A;  5AJO A;  3K8E A;  1E5K A;  2RJ9 A;  2YQS A;  2D7R A;  2RJ5 A;  3OGZ A;  3SPT A;  1IIN A;  4Y7U A;  3SX3 A;  1PZT A;  1VZU A;  3PKP A;  4KNR A;  4EE3 A;  1HM8 A;  3O3P A;  2UX8 A;  1G3L A;  2WVM A;  1V83 A;  2AGD A;  5C4E A;  2JCJ A;  1TVY A;  1ZCT A;  4FRD A;  2BO6 A;  2OEF A;  2Y7A A;  2A8U A;  3SXD A;  3U2T A;  1H4E A;  1HJJ A;  4AC3 A;  4B42 A;  1FWY A;  2I7B A;  2FYD B;  4KC1 A;  2Y4K A;  4B2X A;  2RJ7 A;  5EJ1 A;  3CKO A;  1LL0 A;  2XMH A;  3I0E A;  3U2W A;  1FGX A;  2OI7 A;  1JV3 A;  3IOH A;  3DJ4 A;  1HM0 A;  3PNN A;  4FRO A;  4HO9 A;  1INJ A;  4CJB A;  1LZJ A;  3IOI A;  1FGG A;  3I0C A;  1VGZ A;  1H5S B;  5IDS A;  5C1L A;  4EE4 A;  1TW1 A;  1VH3 A;  3OC9 A;  3CKN A;  5DDT A;  4C2S A;  3IOJ A;  4B5B A;  1LL3 A;  2RIY A;  2Y4M A;  1WT3 A;  1G1L A;  1H5S D;  3K8D A;  5C8R A;  1H4C A;  2YC3 A;  4ARW A;  3CGX A;  1O23 B;  3U2V A;  1TZF A;  4E1K A;  5FUH A;  3KIA A;  1G0R A;  1ZDG A;  2A8W A;  2Z86 A;  4FRB A;  3ZGG A;  5C4B A;  4IRP A;  3OH2 A;  2WVL A;  4KC2 A;  1G23 A;  3OKR A;  1NHE B;  4G3Q A;  3V90 A;  4DDZ A;  1YP2 A;  1FR8 A;  4Y6N A;  4DEC A;  2DPW A;  2O1G A;  2JCO A;  5CQL X;  1S4N A;  2XWL A;  3JTJ A;  3N9W A;  1ON8 A;  1ZCV A;  3SXG A;  1LZ7 A;  3GUE A;  2VS4 A;  1FZW A;  2WVK A;  2X65 A;  3ZLL A;  1ZJ0 A;  3OH4 A;  5CMH A;  5CQO A;  2VD4 A;  1H7L A;  1GX4 A;  2VFZ A;  3E25 A;  1W55 A;  4HO6 A;  2ZU8 A;  3POL A;  3NGW A;  4Y7V A;  1NWG B;  5J49 A;  1YP4 A;  1TW5 A;  3BCV A;  1S4P A;  1XZ6 A;  4G3P A;  2QH5 A;  1I52 A;  4EEO A;  4HO8 A;  4AYL A;  5C4D A;  1H7F A;  2RJ1 A;  5L6S A;  4FCU A;  3OH0 A;  5EJZ A;  2AM3 A;  5C48 A;  2V0L A;  4R7P A;  2FYC B;  2PGV A;  1R7U A;  5DDV A;  2O1H A;  4NAI A;  2VXL A;  3E26 A;  4Y7F A;  3JUK A;  5CQP A;  4M2A A;  5C47 A;  5FV9 A;  2W0W A;  3PKQ A;  1ZJO A;  2Y6P A;  3HL3 A;  1EYR A;  1H5R A;  5C3D A;  2O1F A;  1MP5 A;  4ASY A;  1WT0 A;  4EE5 A;  3D5N A;  5C38 A;  3U2X A;  4AYJ A;  1ZIZ A;  1VH1 A;  3Q7U A;  5C4C A;  1O0R A;  3T7O A;  1FXO A;  3Q80 A;  4Y6U A;  4HO0 A;  5HS2 A;  3F1C A;  1HM9 A;  1JYK A;  4JIS A;  2AE7 A;  3V0N A;  2W0V A;  3T7M A;  4MND A;  1HV9 A;  4ASJ A;  4FCE A;  3USQ A;  2V0H A;  1MC3 A;  4FRE A;  5CMJ A;  1IIM A;  4FRQ A;  1R81 A;  4HO3 A;  1NQI B;  4LW3 A;  4KXO A;  4MYB A;  3V8Z A;  1ZI4 A;  2X60 A;  2AM4 A;  2OI6 A;  2E3D A;  3D98 A;  1H5T B;  4BMA A;  2WAW A;  3BRK X;  3V0M A;  1QGQ A;  2VXM A;  4HO2 A;  2RJ6 A;  1GQC A;  1VGW A;  1ON6 A;  2QKX A;  3OH3 A;  4XWI A;  3EE5 A;  4HCQ A;  5FTS A;  1G97 A;  4EVW A;  1R7V A;  2ZU9 A;  4UEG A;  3RSB A;  1INI A;  2FYA A;  3F1Y A;  1LZI A;  2FFV A;  2OEG A;  2XME A;  5CMF X;  1GQ9 A;  1ZDF A;  4LW6 A;  4D11 A;  4NAL A;  5IDT A;  2PGY A;  3R3I A;  2Q4J A;  4B4B A;  1QG8 A;  2RJ4 A;  1W77 A;  4M28 A;  1FO9 A;  4NAK A;  4EEA A;  1H5S A;  1VZT A;  3I0L A;  1G9R A;  3V91 A;  1H7T A;  5CMI A;  2X5S A;  4KT7 A;  3R2W A;  1ZCU A;  5AJP A;  4KNX A;  1LZ0 A;  1WVC A;  1Z90 A;  3U0Y A;  4Y63 A;  2AEC A;  4HG6 A;  4Y7T A;  2XWM A;  3I0K A;  2WGZ A;  4K6R A;  3RMV A;  2X5Z A;  4KC4 A;  4CJ8 A;  1YP3 A;  4D0T A;  1KWS A;  1G95 A;  3U0X A;  2ICX A;  4Y62 A;  4M2B A;  1WT2 A;  1R7X A;  2QGI A;  2Y4J A;  2RIZ A;  5FU0 A;  2MZB A;  3ST8 A;  4B4M A;  4Y9X A;  5CQN X;  4GBP A;  5C4F A;  3SXE A;  1O7O A;  2Y4L A;  1VIC A;  4D48 A;  3CU0 A;  3V0Q A;  2I5K A;  2YCM A;  1K4V A;  2AES A;  5C36 A;  4B2W A;  1H7Q A;  1G2V A;  1WSZ A;  4KPX A;  5C49 A;  2CU2 A;  2VS5 A;  1ZJ3 A;  3OAM A;  3FWW A;  2FYB A;  2RIX A;  4AAW A;  1ZI5 A;  5AJN A;  1ZHJ A;  2V0K A;  1V82 A;  1QGS A;  5C1G A;  3I0I X;  1LVW A;  1NF5 B;  2P73 A;  2XWN A;  1NMM B;  1ZJ1 A;  4EEG A;  1VGT A;  2AH9 A;  2Z87 A;  4B3U A;  2PX7 A;  1ZJ2 A;  2RIT A;  2YQH A;  4M4K A;  4Y64 A;  1OMZ A;  1G8O A;  2OI5 A;  3TZT A; 
#chains in the Genus database with same CATH topology
 3D8V A;  1FOA A;  2NXV A;  1OQM B;  4HO5 A;  5JQQ A;  3DUV A;  1MP3 A;  1OMX A;  3V0L A;  1FG5 N;  1JV1 A;  2RJ0 A;  2GGQ A;  2YQJ A;  2JCL A;  2YQC A;  4FRL A;  4CVH A;  3SXC A;  3CKQ A;  2YES A;  1ZJP A;  1H7H A;  3I0H A;  2D7I A;  1R7T A;  3I0J A;  3T7N A;  3SXA A;  1R82 A;  1WT1 A;  1ZI1 A;  2WE9 A;  1QWJ A;  4KPZ A;  1FR9 A;  4FRH A;  3QVB A;  1GWW A;  4KRV A;  1H5T A;  2JCK A;  2D0J A;  5FU8 A;  1SS9 A;  4L41 C;  3CKV A;  4HOC A;  1H3M A;  1R80 A;  1JVG A;  4FRA A;  4D11 C;  1VZX A;  4J18 A;  1H4D A;  1H7E A;  3FOQ A;  4P00 A;  5C1H A;  5FYE A;  4EEM A;  3LW6 A;  3V8Y A;  2FY7 A;  1VM8 A;  4FQW A;  2VS3 A;  3DK5 A;  3V0P A;  1V84 A;  4KQL A;  1H5S C;  1HJL A;  2GGO A;  1FO8 A;  3I0D A;  3U2U A;  1VPA A;  1JVD A;  2I5E A;  4NAN A;  2RJ8 A;  3SXB A;  1G93 A;  2V0J A;  4G3S A;  2C0N A;  3OH1 A;  3TQD A;  3RMW A;  4JD0 A;  4BQH A;  1NKH B;  1FRW A;  3JUJ A;  4CJC A;  3CKJ A;  1H7G A;  2ZU7 A;  4FRM A;  3ZF8 A;  5CQM X;  4YS8 A;  3ZLK A;  5FTV A;  4IRQ A;  1VGU A;  2ICY A;  1EZI A;  1YRO B;  2BO4 A;  2V0I A;  1XHB A;  2FFU A;  4P02 A;  4Y7G A;  5C3B A;  2WEE A;  2P72 A;  4FRP A;  3ZGF A;  1MP4 A;  4HO4 A;  1H5R B;  5CMG X;  2VSI A;  4ECM A;  3SX7 A;  5I1F A;  2AM5 A;  5C3A A;  1R7Y A;  1O7Q A;  5EIY A;  4D0Z A;  1JYL A;  1S4O A;  3SX8 A;  1LL2 A;  1PZY B;  5BXC A;  2E8B A;  3USR A;  2APC A;  1GA8 A;  4DE7 A;  1GX0 A;  3Q4S A;  2BO8 A;  1ZI3 A;  2BO7 A;  2P6W A;  2VSH A;  1W57 A;  3I0F A;  3I0G A;  5L6V A;  4G87 A;  2YC5 A;  1ZCY A;  5IFY A;  1GWV A;  1FXJ A;  2PA4 A;  4B4G A;  4ZDQ A;  3SX5 A;  3V0O A;  5AJO A;  3K8E A;  1E5K A;  2RJ9 A;  2YQS A;  2D7R A;  2RJ5 A;  3OGZ A;  3SPT A;  1IIN A;  4Y7U A;  3SX3 A;  1PZT A;  2J0A A;  2VK9 A;  1VZU A;  3PKP A;  4KNR A;  4EE3 A;  1HM8 A;  3O3P A;  2UX8 A;  1G3L A;  2WVM A;  1V83 A;  2AGD A;  5C4E A;  2JCJ A;  1TVY A;  1ZCT A;  4FRD A;  2BO6 A;  4O6N A;  2OEF A;  2Y7A A;  2A8U A;  3SXD A;  3U2T A;  1H4E A;  1HJJ A;  4AC3 A;  4B42 A;  1FWY A;  2I7B A;  2FYD B;  4KC1 A;  2Y4K A;  4B2X A;  2RJ7 A;  5EJ1 A;  3CKO A;  2J0B A;  1LL0 A;  2XMH A;  3I0E A;  3U2W A;  1FGX A;  2OI7 A;  1JV3 A;  3IOH A;  3DJ4 A;  1HM0 A;  4Q7C A;  3PNN A;  4FRO A;  4HO9 A;  1INJ A;  4CJB A;  1LZJ A;  3IOI A;  1FGG A;  3I0C A;  1VGZ A;  1H5S B;  5IDS A;  5C1L A;  4EE4 A;  1TW1 A;  1VH3 A;  3OC9 A;  3CKN A;  5DDT A;  4C2S A;  3IOJ A;  4FIX A;  4B5B A;  1LL3 A;  2RIY A;  2Y4M A;  1WT3 A;  1G1L A;  1H5S D;  3K8D A;  5C8R A;  1H4C A;  2YC3 A;  4ARW A;  3CGX A;  1O23 B;  3U2V A;  1TZF A;  4E1K A;  5FUH A;  3KIA A;  1G0R A;  1ZDG A;  2A8W A;  2Z86 A;  4FRB A;  3ZGG A;  5C4B A;  4IRP A;  3OH2 A;  2WVL A;  4KC2 A;  1G23 A;  3OKR A;  1NHE B;  4G3Q A;  3V90 A;  4DDZ A;  1YP2 A;  1FR8 A;  4Y6N A;  4DEC A;  2DPW A;  2O1G A;  2JCO A;  5CQL X;  1S4N A;  2XWL A;  3JTJ A;  3N9W A;  1ON8 A;  1ZCV A;  3SXG A;  1LZ7 A;  3GUE A;  2VS4 A;  1FZW A;  2WVK A;  2X65 A;  3ZLL A;  1ZJ0 A;  3OH4 A;  5CMH A;  5CQO A;  2VD4 A;  1H7L A;  1GX4 A;  2VFZ A;  3E25 A;  1W55 A;  4HO6 A;  2ZU8 A;  3POL A;  3NGW A;  4Y7V A;  1NWG B;  5J49 A;  1YP4 A;  1TW5 A;  3BCV A;  1S4P A;  1XZ6 A;  4G3P A;  2QH5 A;  1I52 A;  4EEO A;  4HO8 A;  4AYL A;  5C4D A;  1H7F A;  2RJ1 A;  5L6S A;  4FCU A;  3OH0 A;  5EJZ A;  2AM3 A;  5C48 A;  2V0L A;  4R7P A;  2FYC B;  2PGV A;  1R7U A;  5DDV A;  2O1H A;  4NAI A;  2VXL A;  3E26 A;  4Y7F A;  3JUK A;  5CQP A;  4M2A A;  5C47 A;  5FV9 A;  2W0W A;  3PKQ A;  1ZJO A;  2Y6P A;  3HL3 A;  1EYR A;  1H5R A;  5C3D A;  2O1F A;  1MP5 A;  4ASY A;  1WT0 A;  4EE5 A;  3D5N A;  5C38 A;  3U2X A;  4AYJ A;  1ZIZ A;  1VH1 A;  3Q7U A;  5C4C A;  1O0R A;  3T7O A;  1FXO A;  3Q80 A;  4Y6U A;  4HO0 A;  5HS2 A;  3F1C A;  1HM9 A;  1JYK A;  4JIS A;  2AE7 A;  3V0N A;  2W0V A;  3T7M A;  4MND A;  1HV9 A;  4ASJ A;  4FCE A;  3USQ A;  2V0H A;  1MC3 A;  4FRE A;  5CMJ A;  1IIM A;  4FRQ A;  1R81 A;  4HO3 A;  1NQI B;  4LW3 A;  4KXO A;  4MYB A;  3V8Z A;  1ZI4 A;  2X60 A;  2AM4 A;  2OI6 A;  2E3D A;  3D98 A;  1H5T B;  4BMA A;  2WAW A;  3BRK X;  3V0M A;  1QGQ A;  2VXM A;  4HO2 A;  2RJ6 A;  1GQC A;  1VGW A;  1ON6 A;  2QKX A;  3OH3 A;  4XWI A;  3EE5 A;  4HCQ A;  5D92 A;  5FTS A;  1G97 A;  4EVW A;  1R7V A;  2ZU9 A;  4UEG A;  3RSB A;  1INI A;  2FYA A;  3F1Y A;  1LZI A;  2FFV A;  2OEG A;  2XME A;  5CMF X;  1GQ9 A;  1ZDF A;  4LW6 A;  4D11 A;  4NAL A;  5IDT A;  2PGY A;  3R3I A;  2Q4J A;  4B4B A;  1QG8 A;  2RJ4 A;  1W77 A;  4M28 A;  1FO9 A;  4NAK A;  4EEA A;  1H5S A;  1VZT A;  3I0L A;  1G9R A;  3V91 A;  1H7T A;  5CMI A;  2X5S A;  4MIX A;  4KT7 A;  3R2W A;  1ZCU A;  5AJP A;  4KNX A;  1LZ0 A;  1WVC A;  1Z90 A;  3U0Y A;  4Y63 A;  2AEC A;  4HG6 A;  4Y7T A;  2XWM A;  3I0K A;  2WGZ A;  4K6R A;  3RMV A;  2X5Z A;  4KC4 A;  4CJ8 A;  1YP3 A;  5D91 A;  4D0T A;  1KWS A;  1G95 A;  3U0X A;  2ICX A;  4Y62 A;  4M2B A;  1WT2 A;  1R7X A;  2QGI A;  2Y4J A;  2RIZ A;  5FU0 A;  2MZB A;  3ST8 A;  4B4M A;  4Y9X A;  5CQN X;  4GBP A;  5C4F A;  3SXE A;  1O7O A;  2Y4L A;  1VIC A;  4D48 A;  3CU0 A;  3V0Q A;  2I5K A;  2YCM A;  1K4V A;  2AES A;  5C36 A;  4B2W A;  1H7Q A;  1G2V A;  1WSZ A;  4KPX A;  5C49 A;  2CU2 A;  4O6M A;  2VS5 A;  1ZJ3 A;  3OAM A;  3FWW A;  2FYB A;  2RIX A;  4AAW A;  1ZI5 A;  5AJN A;  1ZHJ A;  2V0K A;  1V82 A;  1QGS A;  5C1G A;  3I0I X;  1LVW A;  1NF5 B;  2P73 A;  2XWN A;  1NMM B;  1ZJ1 A;  4EEG A;  1VGT A;  2AH9 A;  2Z87 A;  4B3U A;  2PX7 A;  1ZJ2 A;  2RIT A;  2YQH A;  4M4K A;  4Y64 A;  1OMZ A;  1G8O A;  2OI5 A;  4FIY A;  3TZT A; 
#chains in the Genus database with same CATH homology
 3D8V A;  1FOA A;  2NXV A;  1OQM B;  4HO5 A;  5JQQ A;  3DUV A;  1MP3 A;  1OMX A;  3V0L A;  1FG5 N;  1JV1 A;  2RJ0 A;  2GGQ A;  2YQJ A;  2JCL A;  2YQC A;  4FRL A;  4CVH A;  3SXC A;  3CKQ A;  2YES A;  1ZJP A;  1H7H A;  3I0H A;  2D7I A;  1R7T A;  3I0J A;  3T7N A;  3SXA A;  1R82 A;  1WT1 A;  1ZI1 A;  2WE9 A;  1QWJ A;  4KPZ A;  1FR9 A;  4FRH A;  3QVB A;  1GWW A;  4KRV A;  1H5T A;  2JCK A;  2D0J A;  5FU8 A;  1SS9 A;  4L41 C;  3CKV A;  4HOC A;  1H3M A;  1R80 A;  1JVG A;  4FRA A;  4D11 C;  1VZX A;  4J18 A;  1H4D A;  1H7E A;  3FOQ A;  4P00 A;  5C1H A;  5FYE A;  4EEM A;  3LW6 A;  3V8Y A;  2FY7 A;  1VM8 A;  4FQW A;  2VS3 A;  3DK5 A;  3V0P A;  1V84 A;  4KQL A;  1H5S C;  1HJL A;  2GGO A;  1FO8 A;  3I0D A;  3U2U A;  1VPA A;  1JVD A;  2I5E A;  4NAN A;  2RJ8 A;  3SXB A;  1G93 A;  2V0J A;  4G3S A;  2C0N A;  3OH1 A;  3TQD A;  3RMW A;  4JD0 A;  4BQH A;  1NKH B;  1FRW A;  3JUJ A;  4CJC A;  3CKJ A;  1H7G A;  2ZU7 A;  4FRM A;  3ZF8 A;  5CQM X;  4YS8 A;  3ZLK A;  5FTV A;  4IRQ A;  1VGU A;  2ICY A;  1EZI A;  1YRO B;  2BO4 A;  2V0I A;  1XHB A;  2FFU A;  4P02 A;  4Y7G A;  5C3B A;  2WEE A;  2P72 A;  4FRP A;  3ZGF A;  1MP4 A;  4HO4 A;  1H5R B;  5CMG X;  2VSI A;  4ECM A;  3SX7 A;  5I1F A;  2AM5 A;  5C3A A;  1R7Y A;  1O7Q A;  5EIY A;  4D0Z A;  1JYL A;  1S4O A;  3SX8 A;  1LL2 A;  1PZY B;  5BXC A;  2E8B A;  3USR A;  2APC A;  1GA8 A;  4DE7 A;  1GX0 A;  3Q4S A;  2BO8 A;  1ZI3 A;  2BO7 A;  2P6W A;  2VSH A;  1W57 A;  3I0F A;  3I0G A;  5L6V A;  4G87 A;  2YC5 A;  1ZCY A;  5IFY A;  1GWV A;  1FXJ A;  2PA4 A;  4B4G A;  4ZDQ A;  3SX5 A;  3V0O A;  5AJO A;  3K8E A;  1E5K A;  2RJ9 A;  2YQS A;  2D7R A;  2RJ5 A;  3OGZ A;  3SPT A;  1IIN A;  4Y7U A;  3SX3 A;  1PZT A;  2J0A A;  2VK9 A;  1VZU A;  3PKP A;  4KNR A;  4EE3 A;  1HM8 A;  3O3P A;  2UX8 A;  1G3L A;  2WVM A;  1V83 A;  2AGD A;  5C4E A;  2JCJ A;  1TVY A;  1ZCT A;  4FRD A;  2BO6 A;  4O6N A;  2OEF A;  2Y7A A;  2A8U A;  3SXD A;  3U2T A;  1H4E A;  1HJJ A;  4AC3 A;  4B42 A;  1FWY A;  2I7B A;  2FYD B;  4KC1 A;  2Y4K A;  4B2X A;  2RJ7 A;  5EJ1 A;  3CKO A;  2J0B A;  1LL0 A;  2XMH A;  3I0E A;  3U2W A;  1FGX A;  2OI7 A;  1JV3 A;  3IOH A;  3DJ4 A;  1HM0 A;  4Q7C A;  3PNN A;  4FRO A;  4HO9 A;  1INJ A;  4CJB A;  1LZJ A;  3IOI A;  1FGG A;  3I0C A;  1VGZ A;  1H5S B;  5IDS A;  5C1L A;  4EE4 A;  1TW1 A;  1VH3 A;  3OC9 A;  3CKN A;  5DDT A;  4C2S A;  3IOJ A;  4FIX A;  4B5B A;  1LL3 A;  2RIY A;  2Y4M A;  1WT3 A;  1G1L A;  1H5S D;  3K8D A;  5C8R A;  1H4C A;  2YC3 A;  4ARW A;  3CGX A;  1O23 B;  3U2V A;  1TZF A;  4E1K A;  5FUH A;  3KIA A;  1G0R A;  1ZDG A;  2A8W A;  2Z86 A;  4FRB A;  3ZGG A;  5C4B A;  4IRP A;  3OH2 A;  2WVL A;  4KC2 A;  1G23 A;  3OKR A;  1NHE B;  4G3Q A;  3V90 A;  4DDZ A;  1YP2 A;  1FR8 A;  4Y6N A;  4DEC A;  2DPW A;  2O1G A;  2JCO A;  5CQL X;  1S4N A;  2XWL A;  3JTJ A;  3N9W A;  1ON8 A;  1ZCV A;  3SXG A;  1LZ7 A;  3GUE A;  2VS4 A;  1FZW A;  2WVK A;  2X65 A;  3ZLL A;  1ZJ0 A;  3OH4 A;  5CMH A;  5CQO A;  2VD4 A;  1H7L A;  1GX4 A;  2VFZ A;  3E25 A;  1W55 A;  4HO6 A;  2ZU8 A;  3POL A;  3NGW A;  4Y7V A;  1NWG B;  5J49 A;  1YP4 A;  1TW5 A;  3BCV A;  1S4P A;  1XZ6 A;  4G3P A;  2QH5 A;  1I52 A;  4EEO A;  4HO8 A;  4AYL A;  5C4D A;  1H7F A;  2RJ1 A;  5L6S A;  4FCU A;  3OH0 A;  5EJZ A;  2AM3 A;  5C48 A;  2V0L A;  4R7P A;  2FYC B;  2PGV A;  1R7U A;  5DDV A;  2O1H A;  4NAI A;  2VXL A;  3E26 A;  4Y7F A;  3JUK A;  5CQP A;  4M2A A;  5C47 A;  5FV9 A;  2W0W A;  3PKQ A;  1ZJO A;  2Y6P A;  3HL3 A;  1EYR A;  1H5R A;  5C3D A;  2O1F A;  1MP5 A;  4ASY A;  1WT0 A;  4EE5 A;  3D5N A;  5C38 A;  3U2X A;  4AYJ A;  1ZIZ A;  1VH1 A;  3Q7U A;  5C4C A;  1O0R A;  3T7O A;  1FXO A;  3Q80 A;  4Y6U A;  4HO0 A;  5HS2 A;  3F1C A;  1HM9 A;  1JYK A;  4JIS A;  2AE7 A;  3V0N A;  2W0V A;  3T7M A;  4MND A;  1HV9 A;  4ASJ A;  4FCE A;  3USQ A;  2V0H A;  1MC3 A;  4FRE A;  5CMJ A;  1IIM A;  4FRQ A;  1R81 A;  4HO3 A;  1NQI B;  4LW3 A;  4KXO A;  4MYB A;  3V8Z A;  1ZI4 A;  2X60 A;  2AM4 A;  2OI6 A;  2E3D A;  3D98 A;  1H5T B;  4BMA A;  2WAW A;  3BRK X;  3V0M A;  1QGQ A;  2VXM A;  4HO2 A;  2RJ6 A;  1GQC A;  1VGW A;  1ON6 A;  2QKX A;  3OH3 A;  4XWI A;  3EE5 A;  4HCQ A;  5D92 A;  5FTS A;  1G97 A;  4EVW A;  1R7V A;  2ZU9 A;  4UEG A;  3RSB A;  1INI A;  2FYA A;  3F1Y A;  1LZI A;  2FFV A;  2OEG A;  2XME A;  5CMF X;  1GQ9 A;  1ZDF A;  4LW6 A;  4D11 A;  4NAL A;  5IDT A;  2PGY A;  3R3I A;  2Q4J A;  4B4B A;  1QG8 A;  2RJ4 A;  1W77 A;  4M28 A;  1FO9 A;  4NAK A;  4EEA A;  1H5S A;  1VZT A;  3I0L A;  1G9R A;  3V91 A;  1H7T A;  5CMI A;  2X5S A;  4MIX A;  4KT7 A;  3R2W A;  1ZCU A;  5AJP A;  4KNX A;  1LZ0 A;  1WVC A;  1Z90 A;  3U0Y A;  4Y63 A;  2AEC A;  4HG6 A;  4Y7T A;  2XWM A;  3I0K A;  2WGZ A;  4K6R A;  3RMV A;  2X5Z A;  4KC4 A;  4CJ8 A;  1YP3 A;  5D91 A;  4D0T A;  1KWS A;  1G95 A;  3U0X A;  2ICX A;  4Y62 A;  4M2B A;  1WT2 A;  1R7X A;  2QGI A;  2Y4J A;  2RIZ A;  5FU0 A;  2MZB A;  3ST8 A;  4B4M A;  4Y9X A;  5CQN X;  4GBP A;  5C4F A;  3SXE A;  1O7O A;  2Y4L A;  1VIC A;  4D48 A;  3CU0 A;  3V0Q A;  2I5K A;  2YCM A;  1K4V A;  2AES A;  5C36 A;  4B2W A;  1H7Q A;  1G2V A;  1WSZ A;  4KPX A;  5C49 A;  2CU2 A;  4O6M A;  2VS5 A;  1ZJ3 A;  3OAM A;  3FWW A;  2FYB A;  2RIX A;  4AAW A;  1ZI5 A;  5AJN A;  1ZHJ A;  2V0K A;  1V82 A;  1QGS A;  5C1G A;  3I0I X;  1LVW A;  1NF5 B;  2P73 A;  2XWN A;  1NMM B;  1ZJ1 A;  4EEG A;  1VGT A;  2AH9 A;  2Z87 A;  4B3U A;  2PX7 A;  1ZJ2 A;  2RIT A;  2YQH A;  4M4K A;  4Y64 A;  1OMZ A;  1G8O A;  2OI5 A;  4FIY A;  3TZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...