1QG8A

Native (magnesium-containing) spsa from bacillus subtilis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
238
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Structure of the nucleotide-diphospho-sugar transferase, SpsA from Bacillus subtilis, in native and nucleotide-complexed forms.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 91
structure length 238
sequence length 255
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qg8A00
4EEAA 1I52A 1ZJ0A 3F1YA 2I7BA 1YP2A 3I0FA 4GBPA 2E3DA 5FYEA 4G3PA 1H5SB 1YP4A 5FV9A 2P73A 4C2SA 1TW5A 4HO6A 3DJ4A 4HO4A 2YC5A 1GWVA 5JQQA 1H4DA 1K4VA 2RIXA 4EE5A 4KQLA 5CMJA 1SS9A 2XMHA 4EE4A 1FXOA 2OI6A 2FYBA 3TZTA 3PKPA 2P6WA 1H7EA 1S4PA 1R81A 1H7QA 1KWSA 2VXMA 3JTJA 3R3IA 1FO9A 1VZUA 4JISA 5C4EA 4NAIA 5HS2A 1OMXA 4KT7A 4G87A 4B5BA 2YQSA 3USQA 4FCUA 2OEFA 5EJ1A 2AESA 4YS8A 3ZGGA 3EE5A 3CKOA 1W57A 1JV1A 2BO4A 2Y4KA 3OH2A 1LL0A 4KC1A 1FG5N 3I0GA 4KPZA 3V0OA 4AYLA 1ON6A 2I5EA 1FO8A 2O1GA 4AAWA 4D11C 3KIAA 2YCMA 1O0RA 1H7HA 4HO0A 3SXGA 5C36A 4Y7UA 1H4CA 3BCVA 3GUEA 1H5TB 5L6VA 5CQLX 2AM4A 2Z86A 4AC3A 1G23A 4MNDA 5IFYA 3V0QA 1GA8A 1ZDFA 2VS4A 4G3SA 4ASYA 1GWWA 3RSBA 3DK5A 2QGIA 3CGXA 2FYCB 4EE3A 4G3QA 1LZ0A 1V84A 5C48A 3Q7UA 4AYJA 1O7OA 1WT3A 1VH3A 1EYRA 2AE7A 1YP3A 2JCKA 2WVKA 2ZU7A 1IINA 2RIYA 1VGUA 1H5RA 5CQOA 2RJ8A 3R2WA 2PA4A 1FWYA 1WT1A 4ASJA 2PGYA 3OGZA 4B4BA 2I5KA 2O1HA 3E25A 1WT0A 2BO7A 1NHEB 4EEGA 3SX3A 4IRQA 5C3DA 3SXAA 1LZIA 1MP5A 4EEMA 4KXOA 4FRHA 5C4FA 4NALA 1H7LA 5C1HA 3U2XA 4D11A 2YQHA 2E8BA 2YC3A 3Q80A 4B4MA 2MZBA 2X5ZA 2Y7AA 1YROB 1QG8A 4CJCA 2A8WA 2D7IA 3U2TA 1QWJA 2PGVA 3V0NA 5DDVA 5CMHA 3OKRA 2RIZA 3V8YA 1FR8A 3USRA 1ZJ3A 1OMZA 2Q4JA 4FRBA 1FOAA 4B2WA 2Y4JA 5J49A 1H3MA 1EZIA 2VS3A 3SXEA 3T7NA 1LZJA 3SXBA 1INJA 1HM8A 3I0LA 3IOIA 1TZFA 2RJ0A 5C1GA 3U0XA 5FUHA 2PX7A 2JCLA 2CU2A 3FWWA 1G93A 3V0MA 3JUKA 2AM5A 4EEOA 4DECA 2XWNA 1ZI5A 1ZCTA 3I0CA 3F1CA 2RJ9A 3CU0A 4E1KA 3K8DA 1MC3A 1VZXA 3V8ZA 1FRWA 4HG6A 1HV9A 3NGWA 1NQIB 4HOCA 4KRVA 3V0LA 5C49A 1H4EA 4ZDQA 4J18A 2WVMA 3PNNA 2YESA 3I0IX 2ZU9A 1ZCUA 3TQDA 4Y7GA 2WEEA 5CMFX 3CKVA 2W0VA 2X5SA 2A8UA 3SX5A 2AH9A 2P72A 2RJ5A 3D8VA 1ZI1A 1XZ6A 4B4GA 1NMMB 5CQMX 2OEGA 3QVBA 3ZLLA 4D0ZA 4BQHA 2D7RA 5BXCA 4KPXA 1VICA 4FRQA 4LW6A 1HM9A 1FGXA 4FCEA 3LW6A 1TW1A 2XMEA 4FRLA 2W0WA 1E5KA 1G8OA 3OH3A 4NANA 1ON8A 1TVYA 3PKQA 1ZJPA 2WVLA 5C8RA 1ZDGA 2XWMA 2ICYA 2X60A 2V0HA 1R7UA 1ZCYA 1WVCA 2AM3A 1R7VA 5DDTA 3JUJA 5IDSA 1H5RB 2VFZA 2O1FA 1H5SD 2WE9A 1GQ9A 4HO8A 1ZHJA 3U2WA 3D5NA 4MYBA 2X65A 4NAKA 2FYDB 1LZ7A 1VZTA 2FY7A 3SPTA 1W77A 4Y7VA 4CJBA 1V83A 4FRAA 4HO9A 1H5SC 2V0KA 3ZF8A 1MP3A 4KC2A 2RJ1A 1Z90A 4HCQA 4Y64A 1JV3A 2FYAA 5FTVA 4FQWA 4M28A 1NKHB 3N9WA 1G95A 1PZTA 2YQJA 4Y63A 1G97A 1ZI4A 2APCA 1GX0A 2V0IA 1ZI3A 3V91A 2Y4MA 1VPAA 1LL2A 1LL3A 2FFVA 4M2BA 3U0YA 4D48A 5I1FA 1R80A 2V0LA 2QKXA 4ARWA 1QGQA 1JYKA 5C4BA 4HO3A 2OI5A 2VSHA 2JCOA 2GGQA 1ZCVA 4K6RA 3DUVA 4R7PA 1R7TA 1JYLA 4P00A 1S4NA 4HO2A 3SXDA 5C4DA 3SX8A 3SXCA 5FU0A 1LVWA 3OH1A 4FRDA 4M4KA 2DPWA 5FTSA 3ST8A 4FRPA 5CMGX 2VD4A 1ZIZA 1ZJ2A 4CVHA 3IOJA 3POLA 5C4CA 5CMIA 1GQCA 1O7QA 1VM8A 1NWGB 3I0KA 3K8EA 1FR9A 2Y6PA 1HJLA 4B3UA 1G1LA 1R7XA 4Y6NA 2AGDA 5CQPA 4DDZA 2JCJA 4FREA 1OQMB 1WSZA 4Y9XA 1HJJA 1H5SA 3SX7A 1G9RA 1GX4A 4KNXA 1R82A 4FROA 1S4OA 1O23B 4KC4A 4KNRA 4LW3A 2RJ4A 1G2VA 2NXVA 4L41C 3IOHA 4FRMA 4M2AA 5C3AA 1R7YA 2RITA 5C38A 3CKQA 1JVDA 3V90A 2RJ7A 1G3LA 1H7GA 3I0EA 3CKNA 5EIYA 1JVGA 2BO8A 2QH5A 2RJ6A 2AECA 4Y7FA 4Y6UA 5C47A 4IRPA 2ICXA 3E26A 1H7TA 4Y62A 3OH4A 3FOQA 4HO5A 5FU8A 2Y4LA 1INIA 3U2VA 1W55A 1H7FA 2YQCA 2V0JA 4P02A 1H5TA 4UEGA 4XWIA 2D0JA 3ZGFA 4BMAA 1FXJA 2OI7A 2FFUA 1IIMA 5IDTA 4D0TA 1FGGA 3CKJA 1HM0A 1MP4A 3I0DA 5C1LA 3V0PA 3D98A 1PZYB 1XHBA 3OC9A 2VSIA 3HL3A 3OH0A 4B42A 3OAMA 4DE7A 1QGSA 2BO6A 5AJPA 2WGZA 5L6SA 1ZJOA 2XWLA 1NF5B 1VGZA 5AJNA 5C3BA 1WT2A 2UX8A 2Z87A 3ZLKA 3I0JA 2GGOA 4Y7TA 5EJZA 3Q4SA 1VGTA 3O3PA 2VS5A 2VXLA 4B2XA 4ECMA 3U2UA 1ZJ1A 5CQNX 3BRKX 3RMVA 4JD0A 3RMWA 3T7OA 2ZU8A 4CJ8A 2WAWA 1VGWA 1VH1A 3I0HA 5AJOA 4EVWA 1G0RA 3T7MA 1FZWA 1V82A
chains in the Genus database with same CATH superfamily
4EEAA 1I52A 1ZJ0A 3F1YA 2I7BA 1YP2A 3I0FA 4GBPA 2E3DA 5FYEA 4G3PA 1H5SB 1YP4A 5FV9A 2P73A 4C2SA 1TW5A 4HO6A 3DJ4A 4HO4A 2YC5A 1GWVA 5JQQA 1H4DA 1K4VA 2RIXA 4EE5A 4KQLA 5CMJA 1SS9A 2XMHA 4EE4A 1FXOA 2OI6A 2FYBA 3TZTA 3PKPA 2P6WA 1H7EA 1S4PA 1R81A 1H7QA 1KWSA 2VXMA 3JTJA 3R3IA 1FO9A 1VZUA 4JISA 5C4EA 4NAIA 5HS2A 1OMXA 4KT7A 4G87A 4B5BA 2YQSA 3USQA 4FCUA 2OEFA 5EJ1A 2AESA 4YS8A 3ZGGA 3EE5A 3CKOA 4Q7CA 1W57A 1JV1A 2BO4A 2Y4KA 3OH2A 5D92A 1LL0A 4KC1A 1FG5N 3I0GA 4KPZA 3V0OA 4AYLA 1ON6A 2I5EA 1FO8A 2O1GA 4AAWA 4D11C 3KIAA 2YCMA 1O0RA 1H7HA 4HO0A 3SXGA 5C36A 4Y7UA 1H4CA 4O6MA 3BCVA 3GUEA 1H5TB 5L6VA 5CQLX 2AM4A 2Z86A 4AC3A 1G23A 4MNDA 5IFYA 3V0QA 1GA8A 1ZDFA 2VS4A 4G3SA 4ASYA 1GWWA 3RSBA 3DK5A 2QGIA 3CGXA 2FYCB 4EE3A 4G3QA 1LZ0A 1V84A 5C48A 3Q7UA 4AYJA 1O7OA 1WT3A 1VH3A 1EYRA 2AE7A 1YP3A 2JCKA 2WVKA 2ZU7A 1IINA 2RIYA 1VGUA 1H5RA 5CQOA 2RJ8A 3R2WA 2PA4A 1FWYA 1WT1A 4ASJA 2PGYA 3OGZA 4B4BA 2I5KA 2O1HA 3E25A 1WT0A 2BO7A 1NHEB 4EEGA 3SX3A 4IRQA 5C3DA 2C0NA 3SXAA 1LZIA 1MP5A 4EEMA 4KXOA 4FRHA 5C4FA 4NALA 1H7LA 5C1HA 3U2XA 4D11A 2YQHA 2E8BA 2YC3A 3Q80A 4B4MA 2MZBA 2X5ZA 2Y7AA 1YROB 1QG8A 4CJCA 2A8WA 2D7IA 3U2TA 1QWJA 2PGVA 3V0NA 5DDVA 5CMHA 3OKRA 2RIZA 3V8YA 1FR8A 3USRA 1ZJ3A 1OMZA 2Q4JA 4FRBA 1FOAA 4B2WA 2Y4JA 5J49A 1H3MA 1EZIA 2VS3A 3SXEA 3T7NA 1LZJA 3SXBA 1INJA 1HM8A 3I0LA 3IOIA 1TZFA 2RJ0A 5C1GA 3U0XA 5FUHA 2PX7A 2JCLA 2CU2A 3FWWA 1G93A 4FIXA 3V0MA 3JUKA 2AM5A 4EEOA 4DECA 2XWNA 1ZI5A 1ZCTA 3I0CA 3F1CA 2RJ9A 3CU0A 4E1KA 2J0BA 3K8DA 1MC3A 1VZXA 3V8ZA 1FRWA 4HG6A 1HV9A 3NGWA 1NQIB 4HOCA 4KRVA 3V0LA 5C49A 1H4EA 4ZDQA 4J18A 2WVMA 3PNNA 2YESA 3I0IX 2ZU9A 1ZCUA 3TQDA 4Y7GA 2WEEA 5CMFX 3CKVA 2W0VA 2X5SA 2A8UA 3SX5A 2AH9A 2P72A 2RJ5A 3D8VA 1ZI1A 1XZ6A 4B4GA 1NMMB 5CQMX 2OEGA 3QVBA 4FIYA 3ZLLA 4D0ZA 4BQHA 2D7RA 5BXCA 4KPXA 1VICA 4FRQA 4LW6A 1HM9A 1FGXA 4FCEA 3LW6A 1TW1A 2XMEA 4FRLA 2W0WA 1E5KA 1G8OA 3OH3A 4NANA 1ON8A 1TVYA 3PKQA 1ZJPA 2WVLA 5C8RA 1ZDGA 2XWMA 2ICYA 2X60A 2V0HA 1R7UA 1ZCYA 1WVCA 2AM3A 1R7VA 5DDTA 3JUJA 5IDSA 1H5RB 2VFZA 2O1FA 1H5SD 2WE9A 1GQ9A 2VK9A 4HO8A 1ZHJA 3U2WA 3D5NA 4MYBA 2X65A 4NAKA 2FYDB 1LZ7A 1VZTA 2FY7A 3SPTA 1W77A 4Y7VA 4CJBA 1V83A 4FRAA 4HO9A 1H5SC 2V0KA 3ZF8A 1MP3A 4KC2A 2RJ1A 1Z90A 4HCQA 4Y64A 1JV3A 2FYAA 5FTVA 4MIXA 4FQWA 4M28A 1NKHB 3N9WA 1G95A 1PZTA 2YQJA 4Y63A 1G97A 1ZI4A 2APCA 1GX0A 2V0IA 1ZI3A 3V91A 2Y4MA 1VPAA 1LL2A 1LL3A 2FFVA 4M2BA 3U0YA 4D48A 5I1FA 1R80A 2V0LA 2QKXA 4ARWA 1QGQA 1JYKA 5C4BA 4HO3A 2OI5A 2VSHA 2JCOA 2GGQA 1ZCVA 4K6RA 3DUVA 4R7PA 1R7TA 1JYLA 4P00A 1S4NA 4HO2A 3SXDA 5C4DA 3SX8A 3SXCA 5FU0A 1LVWA 3OH1A 4FRDA 4M4KA 2DPWA 5FTSA 3ST8A 4FRPA 5CMGX 2VD4A 1ZIZA 1ZJ2A 4CVHA 3IOJA 3POLA 5C4CA 5CMIA 1GQCA 1O7QA 1VM8A 1NWGB 3I0KA 3K8EA 1FR9A 2Y6PA 1HJLA 4B3UA 1G1LA 1R7XA 4Y6NA 2AGDA 5CQPA 4DDZA 2JCJA 4FREA 1OQMB 1WSZA 4Y9XA 1HJJA 1H5SA 3SX7A 1G9RA 1GX4A 4KNXA 1R82A 4FROA 1S4OA 1O23B 4KC4A 4KNRA 4LW3A 2RJ4A 1G2VA 2NXVA 4L41C 3IOHA 4FRMA 4M2AA 5C3AA 1R7YA 2RITA 5C38A 3CKQA 1JVDA 3V90A 2RJ7A 1G3LA 1H7GA 3I0EA 3CKNA 5EIYA 1JVGA 2BO8A 2QH5A 2RJ6A 2AECA 4Y7FA 4Y6UA 5C47A 4IRPA 2ICXA 3E26A 1H7TA 4Y62A 3OH4A 3FOQA 4HO5A 5FU8A 2Y4LA 1INIA 3U2VA 1W55A 1H7FA 2YQCA 2V0JA 4P02A 5D91A 1H5TA 4UEGA 4XWIA 2D0JA 3ZGFA 4BMAA 1FXJA 2OI7A 2FFUA 1IIMA 5IDTA 4D0TA 1FGGA 3CKJA 1HM0A 1MP4A 3I0DA 5C1LA 3V0PA 4O6NA 2J0AA 3D98A 1PZYB 1XHBA 3OC9A 2VSIA 3HL3A 3OH0A 4B42A 3OAMA 4DE7A 1QGSA 2BO6A 5AJPA 2WGZA 5L6SA 1ZJOA 2XWLA 1NF5B 1VGZA 5AJNA 5C3BA 1WT2A 2UX8A 2Z87A 3ZLKA 3I0JA 2GGOA 4Y7TA 5EJZA 3Q4SA 1VGTA 3O3PA 2VS5A 2VXLA 4B2XA 4ECMA 3U2UA 1ZJ1A 5CQNX 3BRKX 3RMVA 4JD0A 3RMWA 3T7OA 2ZU8A 4CJ8A 2WAWA 1VGWA 1VH1A 3I0HA 5AJOA 4EVWA 1G0RA 3T7MA 1FZWA 1V82A
chains in the Genus database with same CATH topology
4EEAA 1I52A 1ZJ0A 3F1YA 2I7BA 1YP2A 3I0FA 4GBPA 2E3DA 5FYEA 4G3PA 1H5SB 1YP4A 5FV9A 2P73A 4C2SA 1TW5A 4HO6A 3DJ4A 4HO4A 2YC5A 1GWVA 5JQQA 1H4DA 1K4VA 2RIXA 4EE5A 4KQLA 5CMJA 1SS9A 2XMHA 4EE4A 1FXOA 2OI6A 2FYBA 3TZTA 3PKPA 2P6WA 1H7EA 1S4PA 1R81A 1H7QA 1KWSA 2VXMA 3JTJA 3R3IA 1FO9A 1VZUA 4JISA 5C4EA 4NAIA 5HS2A 1OMXA 4KT7A 4G87A 4B5BA 2YQSA 3USQA 4FCUA 2OEFA 5EJ1A 2AESA 4YS8A 3ZGGA 3EE5A 3CKOA 4Q7CA 1W57A 1JV1A 2BO4A 2Y4KA 3OH2A 5D92A 1LL0A 4KC1A 1FG5N 3I0GA 4KPZA 3V0OA 4AYLA 1ON6A 2I5EA 1FO8A 2O1GA 4AAWA 4D11C 3KIAA 2YCMA 1O0RA 1H7HA 4HO0A 3SXGA 5C36A 4Y7UA 1H4CA 4O6MA 3BCVA 3GUEA 1H5TB 5L6VA 5CQLX 2AM4A 2Z86A 4AC3A 1G23A 4MNDA 5IFYA 3V0QA 1GA8A 1ZDFA 2VS4A 4G3SA 4ASYA 1GWWA 3RSBA 3DK5A 2QGIA 3CGXA 2FYCB 4EE3A 4G3QA 1LZ0A 1V84A 5C48A 3Q7UA 4AYJA 1O7OA 1WT3A 1VH3A 1EYRA 2AE7A 1YP3A 2JCKA 2WVKA 2ZU7A 1IINA 2RIYA 1VGUA 1H5RA 5CQOA 2RJ8A 3R2WA 2PA4A 1FWYA 1WT1A 4ASJA 2PGYA 3OGZA 4B4BA 2I5KA 2O1HA 3E25A 1WT0A 2BO7A 1NHEB 4EEGA 3SX3A 4IRQA 5C3DA 2C0NA 3SXAA 1LZIA 1MP5A 4EEMA 4KXOA 4FRHA 5C4FA 4NALA 1H7LA 5C1HA 3U2XA 4D11A 2YQHA 2E8BA 2YC3A 3Q80A 4B4MA 2MZBA 2X5ZA 2Y7AA 1YROB 1QG8A 4CJCA 2A8WA 2D7IA 3U2TA 1QWJA 2PGVA 3V0NA 5DDVA 5CMHA 3OKRA 2RIZA 3V8YA 1FR8A 3USRA 1ZJ3A 1OMZA 2Q4JA 4FRBA 1FOAA 4B2WA 2Y4JA 5J49A 1H3MA 1EZIA 2VS3A 3SXEA 3T7NA 1LZJA 3SXBA 1INJA 1HM8A 3I0LA 3IOIA 1TZFA 2RJ0A 5C1GA 3U0XA 5FUHA 2PX7A 2JCLA 2CU2A 3FWWA 1G93A 4FIXA 3V0MA 3JUKA 2AM5A 4EEOA 4DECA 2XWNA 1ZI5A 1ZCTA 3I0CA 3F1CA 2RJ9A 3CU0A 4E1KA 2J0BA 3K8DA 1MC3A 1VZXA 3V8ZA 1FRWA 4HG6A 1HV9A 3NGWA 1NQIB 4HOCA 4KRVA 3V0LA 5C49A 1H4EA 4ZDQA 4J18A 2WVMA 3PNNA 2YESA 3I0IX 2ZU9A 1ZCUA 3TQDA 4Y7GA 2WEEA 5CMFX 3CKVA 2W0VA 2X5SA 2A8UA 3SX5A 2AH9A 2P72A 2RJ5A 3D8VA 1ZI1A 1XZ6A 4B4GA 1NMMB 5CQMX 2OEGA 3QVBA 4FIYA 3ZLLA 4D0ZA 4BQHA 2D7RA 5BXCA 4KPXA 1VICA 4FRQA 4LW6A 1HM9A 1FGXA 4FCEA 3LW6A 1TW1A 2XMEA 4FRLA 2W0WA 1E5KA 1G8OA 3OH3A 4NANA 1ON8A 1TVYA 3PKQA 1ZJPA 2WVLA 5C8RA 1ZDGA 2XWMA 2ICYA 2X60A 2V0HA 1R7UA 1ZCYA 1WVCA 2AM3A 1R7VA 5DDTA 3JUJA 5IDSA 1H5RB 2VFZA 2O1FA 1H5SD 2WE9A 1GQ9A 2VK9A 4HO8A 1ZHJA 3U2WA 3D5NA 4MYBA 2X65A 4NAKA 2FYDB 1LZ7A 1VZTA 2FY7A 3SPTA 1W77A 4Y7VA 4CJBA 1V83A 4FRAA 4HO9A 1H5SC 2V0KA 3ZF8A 1MP3A 4KC2A 2RJ1A 1Z90A 4HCQA 4Y64A 1JV3A 2FYAA 5FTVA 4MIXA 4FQWA 4M28A 1NKHB 3N9WA 1G95A 1PZTA 2YQJA 4Y63A 1G97A 1ZI4A 2APCA 1GX0A 2V0IA 1ZI3A 3V91A 2Y4MA 1VPAA 1LL2A 1LL3A 2FFVA 4M2BA 3U0YA 4D48A 5I1FA 1R80A 2V0LA 2QKXA 4ARWA 1QGQA 1JYKA 5C4BA 4HO3A 2OI5A 2VSHA 2JCOA 2GGQA 1ZCVA 4K6RA 3DUVA 4R7PA 1R7TA 1JYLA 4P00A 1S4NA 4HO2A 3SXDA 5C4DA 3SX8A 3SXCA 5FU0A 1LVWA 3OH1A 4FRDA 4M4KA 2DPWA 5FTSA 3ST8A 4FRPA 5CMGX 2VD4A 1ZIZA 1ZJ2A 4CVHA 3IOJA 3POLA 5C4CA 5CMIA 1GQCA 1O7QA 1VM8A 1NWGB 3I0KA 3K8EA 1FR9A 2Y6PA 1HJLA 4B3UA 1G1LA 1R7XA 4Y6NA 2AGDA 5CQPA 4DDZA 2JCJA 4FREA 1OQMB 1WSZA 4Y9XA 1HJJA 1H5SA 3SX7A 1G9RA 1GX4A 4KNXA 1R82A 4FROA 1S4OA 1O23B 4KC4A 4KNRA 4LW3A 2RJ4A 1G2VA 2NXVA 4L41C 3IOHA 4FRMA 4M2AA 5C3AA 1R7YA 2RITA 5C38A 3CKQA 1JVDA 3V90A 2RJ7A 1G3LA 1H7GA 3I0EA 3CKNA 5EIYA 1JVGA 2BO8A 2QH5A 2RJ6A 2AECA 4Y7FA 4Y6UA 5C47A 4IRPA 2ICXA 3E26A 1H7TA 4Y62A 3OH4A 3FOQA 4HO5A 5FU8A 2Y4LA 1INIA 3U2VA 1W55A 1H7FA 2YQCA 2V0JA 4P02A 5D91A 1H5TA 4UEGA 4XWIA 2D0JA 3ZGFA 4BMAA 1FXJA 2OI7A 2FFUA 1IIMA 5IDTA 4D0TA 1FGGA 3CKJA 1HM0A 1MP4A 3I0DA 5C1LA 3V0PA 4O6NA 2J0AA 3D98A 1PZYB 1XHBA 3OC9A 2VSIA 3HL3A 3OH0A 4B42A 3OAMA 4DE7A 1QGSA 2BO6A 5AJPA 2WGZA 5L6SA 1ZJOA 2XWLA 1NF5B 1VGZA 5AJNA 5C3BA 1WT2A 2UX8A 2Z87A 3ZLKA 3I0JA 2GGOA 4Y7TA 5EJZA 3Q4SA 1VGTA 3O3PA 2VS5A 2VXLA 4B2XA 4ECMA 3U2UA 1ZJ1A 5CQNX 3BRKX 3RMVA 4JD0A 3RMWA 3T7OA 2ZU8A 4CJ8A 2WAWA 1VGWA 1VH1A 3I0HA 5AJOA 4EVWA 1G0RA 3T7MA 1FZWA 1V82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEA A;  1I52 A;  1ZJ0 A;  3F1Y A;  2I7B A;  1YP2 A;  3I0F A;  4GBP A;  2E3D A;  5FYE A;  4G3P A;  1H5S B;  1YP4 A;  5FV9 A;  2P73 A;  4C2S A;  1TW5 A;  4HO6 A;  3DJ4 A;  4HO4 A;  2YC5 A;  1GWV A;  5JQQ A;  1H4D A;  1K4V A;  2RIX A;  4EE5 A;  4KQL A;  5CMJ A;  1SS9 A;  2XMH A;  4EE4 A;  1FXO A;  2OI6 A;  2FYB A;  3TZT A;  3PKP A;  2P6W A;  1H7E A;  1S4P A;  1R81 A;  1H7Q A;  1KWS A;  2VXM A;  3JTJ A;  3R3I A;  1FO9 A;  1VZU A;  4JIS A;  5C4E A;  4NAI A;  5HS2 A;  1OMX A;  4KT7 A;  4G87 A;  4B5B A;  2YQS A;  3USQ A;  4FCU A;  2OEF A;  5EJ1 A;  2AES A;  4YS8 A;  3ZGG A;  3EE5 A;  3CKO A;  1W57 A;  1JV1 A;  2BO4 A;  2Y4K A;  3OH2 A;  1LL0 A;  4KC1 A;  1FG5 N;  3I0G A;  4KPZ A;  3V0O A;  4AYL A;  1ON6 A;  2I5E A;  1FO8 A;  2O1G A;  4AAW A;  4D11 C;  3KIA A;  2YCM A;  1O0R A;  1H7H A;  4HO0 A;  3SXG A;  5C36 A;  4Y7U A;  1H4C A;  3BCV A;  3GUE A;  1H5T B;  5L6V A;  5CQL X;  2AM4 A;  2Z86 A;  4AC3 A;  1G23 A;  4MND A;  5IFY A;  3V0Q A;  1GA8 A;  1ZDF A;  2VS4 A;  4G3S A;  4ASY A;  1GWW A;  3RSB A;  3DK5 A;  2QGI A;  3CGX A;  2FYC B;  4EE3 A;  4G3Q A;  1LZ0 A;  1V84 A;  5C48 A;  3Q7U A;  4AYJ A;  1O7O A;  1WT3 A;  1VH3 A;  1EYR A;  2AE7 A;  1YP3 A;  2JCK A;  2WVK A;  2ZU7 A;  1IIN A;  2RIY A;  1VGU A;  1H5R A;  5CQO A;  2RJ8 A;  3R2W A;  2PA4 A;  1FWY A;  1WT1 A;  4ASJ A;  2PGY A;  3OGZ A;  4B4B A;  2I5K A;  2O1H A;  3E25 A;  1WT0 A;  2BO7 A;  1NHE B;  4EEG A;  3SX3 A;  4IRQ A;  5C3D A;  3SXA A;  1LZI A;  1MP5 A;  4EEM A;  4KXO A;  4FRH A;  5C4F A;  4NAL A;  1H7L A;  5C1H A;  3U2X A;  4D11 A;  2YQH A;  2E8B A;  2YC3 A;  3Q80 A;  4B4M A;  2MZB A;  2X5Z A;  2Y7A A;  1YRO B;  1QG8 A;  4CJC A;  2A8W A;  2D7I A;  3U2T A;  1QWJ A;  2PGV A;  3V0N A;  5DDV A;  5CMH A;  3OKR A;  2RIZ A;  3V8Y A;  1FR8 A;  3USR A;  1ZJ3 A;  1OMZ A;  2Q4J A;  4FRB A;  1FOA A;  4B2W A;  2Y4J A;  5J49 A;  1H3M A;  1EZI A;  2VS3 A;  3SXE A;  3T7N A;  1LZJ A;  3SXB A;  1INJ A;  1HM8 A;  3I0L A;  3IOI A;  1TZF A;  2RJ0 A;  5C1G A;  3U0X A;  5FUH A;  2PX7 A;  2JCL A;  2CU2 A;  3FWW A;  1G93 A;  3V0M A;  3JUK A;  2AM5 A;  4EEO A;  4DEC A;  2XWN A;  1ZI5 A;  1ZCT A;  3I0C A;  3F1C A;  2RJ9 A;  3CU0 A;  4E1K A;  3K8D A;  1MC3 A;  1VZX A;  3V8Z A;  1FRW A;  4HG6 A;  1HV9 A;  3NGW A;  1NQI B;  4HOC A;  4KRV A;  3V0L A;  5C49 A;  1H4E A;  4ZDQ A;  4J18 A;  2WVM A;  3PNN A;  2YES A;  3I0I X;  2ZU9 A;  1ZCU A;  3TQD A;  4Y7G A;  2WEE A;  5CMF X;  3CKV A;  2W0V A;  2X5S A;  2A8U A;  3SX5 A;  2AH9 A;  2P72 A;  2RJ5 A;  3D8V A;  1ZI1 A;  1XZ6 A;  4B4G A;  1NMM B;  5CQM X;  2OEG A;  3QVB A;  3ZLL A;  4D0Z A;  4BQH A;  2D7R A;  5BXC A;  4KPX A;  1VIC A;  4FRQ A;  4LW6 A;  1HM9 A;  1FGX A;  4FCE A;  3LW6 A;  1TW1 A;  2XME A;  4FRL A;  2W0W A;  1E5K A;  1G8O A;  3OH3 A;  4NAN A;  1ON8 A;  1TVY A;  3PKQ A;  1ZJP A;  2WVL A;  5C8R A;  1ZDG A;  2XWM A;  2ICY A;  2X60 A;  2V0H A;  1R7U A;  1ZCY A;  1WVC A;  2AM3 A;  1R7V A;  5DDT A;  3JUJ A;  5IDS A;  1H5R B;  2VFZ A;  2O1F A;  1H5S D;  2WE9 A;  1GQ9 A;  4HO8 A;  1ZHJ A;  3U2W A;  3D5N A;  4MYB A;  2X65 A;  4NAK A;  2FYD B;  1LZ7 A;  1VZT A;  2FY7 A;  3SPT A;  1W77 A;  4Y7V A;  4CJB A;  1V83 A;  4FRA A;  4HO9 A;  1H5S C;  2V0K A;  3ZF8 A;  1MP3 A;  4KC2 A;  2RJ1 A;  1Z90 A;  4HCQ A;  4Y64 A;  1JV3 A;  2FYA A;  5FTV A;  4FQW A;  4M28 A;  1NKH B;  3N9W A;  1G95 A;  1PZT A;  2YQJ A;  4Y63 A;  1G97 A;  1ZI4 A;  2APC A;  1GX0 A;  2V0I A;  1ZI3 A;  3V91 A;  2Y4M A;  1VPA A;  1LL2 A;  1LL3 A;  2FFV A;  4M2B A;  3U0Y A;  4D48 A;  5I1F A;  1R80 A;  2V0L A;  2QKX A;  4ARW A;  1QGQ A;  1JYK A;  5C4B A;  4HO3 A;  2OI5 A;  2VSH A;  2JCO A;  2GGQ A;  1ZCV A;  4K6R A;  3DUV A;  4R7P A;  1R7T A;  1JYL A;  4P00 A;  1S4N A;  4HO2 A;  3SXD A;  5C4D A;  3SX8 A;  3SXC A;  5FU0 A;  1LVW A;  3OH1 A;  4FRD A;  4M4K A;  2DPW A;  5FTS A;  3ST8 A;  4FRP A;  5CMG X;  2VD4 A;  1ZIZ A;  1ZJ2 A;  4CVH A;  3IOJ A;  3POL A;  5C4C A;  5CMI A;  1GQC A;  1O7Q A;  1VM8 A;  1NWG B;  3I0K A;  3K8E A;  1FR9 A;  2Y6P A;  1HJL A;  4B3U A;  1G1L A;  1R7X A;  4Y6N A;  2AGD A;  5CQP A;  4DDZ A;  2JCJ A;  4FRE A;  1OQM B;  1WSZ A;  4Y9X A;  1HJJ A;  1H5S A;  3SX7 A;  1G9R A;  1GX4 A;  4KNX A;  1R82 A;  4FRO A;  1S4O A;  1O23 B;  4KC4 A;  4KNR A;  4LW3 A;  2RJ4 A;  1G2V A;  2NXV A;  4L41 C;  3IOH A;  4FRM A;  4M2A A;  5C3A A;  1R7Y A;  2RIT A;  5C38 A;  3CKQ A;  1JVD A;  3V90 A;  2RJ7 A;  1G3L A;  1H7G A;  3I0E A;  3CKN A;  5EIY A;  1JVG A;  2BO8 A;  2QH5 A;  2RJ6 A;  2AEC A;  4Y7F A;  4Y6U A;  5C47 A;  4IRP A;  2ICX A;  3E26 A;  1H7T A;  4Y62 A;  3OH4 A;  3FOQ A;  4HO5 A;  5FU8 A;  2Y4L A;  1INI A;  3U2V A;  1W55 A;  1H7F A;  2YQC A;  2V0J A;  4P02 A;  1H5T A;  4UEG A;  4XWI A;  2D0J A;  3ZGF A;  4BMA A;  1FXJ A;  2OI7 A;  2FFU A;  1IIM A;  5IDT A;  4D0T A;  1FGG A;  3CKJ A;  1HM0 A;  1MP4 A;  3I0D A;  5C1L A;  3V0P A;  3D98 A;  1PZY B;  1XHB A;  3OC9 A;  2VSI A;  3HL3 A;  3OH0 A;  4B42 A;  3OAM A;  4DE7 A;  1QGS A;  2BO6 A;  5AJP A;  2WGZ A;  5L6S A;  1ZJO A;  2XWL A;  1NF5 B;  1VGZ A;  5AJN A;  5C3B A;  1WT2 A;  2UX8 A;  2Z87 A;  3ZLK A;  3I0J A;  2GGO A;  4Y7T A;  5EJZ A;  3Q4S A;  1VGT A;  3O3P A;  2VS5 A;  2VXL A;  4B2X A;  4ECM A;  3U2U A;  1ZJ1 A;  5CQN X;  3BRK X;  3RMV A;  4JD0 A;  3RMW A;  3T7O A;  2ZU8 A;  4CJ8 A;  2WAW A;  1VGW A;  1VH1 A;  3I0H A;  5AJO A;  4EVW A;  1G0R A;  3T7M A;  1FZW A;  1V82 A; 
#chains in the Genus database with same CATH topology
 4EEA A;  1I52 A;  1ZJ0 A;  3F1Y A;  2I7B A;  1YP2 A;  3I0F A;  4GBP A;  2E3D A;  5FYE A;  4G3P A;  1H5S B;  1YP4 A;  5FV9 A;  2P73 A;  4C2S A;  1TW5 A;  4HO6 A;  3DJ4 A;  4HO4 A;  2YC5 A;  1GWV A;  5JQQ A;  1H4D A;  1K4V A;  2RIX A;  4EE5 A;  4KQL A;  5CMJ A;  1SS9 A;  2XMH A;  4EE4 A;  1FXO A;  2OI6 A;  2FYB A;  3TZT A;  3PKP A;  2P6W A;  1H7E A;  1S4P A;  1R81 A;  1H7Q A;  1KWS A;  2VXM A;  3JTJ A;  3R3I A;  1FO9 A;  1VZU A;  4JIS A;  5C4E A;  4NAI A;  5HS2 A;  1OMX A;  4KT7 A;  4G87 A;  4B5B A;  2YQS A;  3USQ A;  4FCU A;  2OEF A;  5EJ1 A;  2AES A;  4YS8 A;  3ZGG A;  3EE5 A;  3CKO A;  4Q7C A;  1W57 A;  1JV1 A;  2BO4 A;  2Y4K A;  3OH2 A;  5D92 A;  1LL0 A;  4KC1 A;  1FG5 N;  3I0G A;  4KPZ A;  3V0O A;  4AYL A;  1ON6 A;  2I5E A;  1FO8 A;  2O1G A;  4AAW A;  4D11 C;  3KIA A;  2YCM A;  1O0R A;  1H7H A;  4HO0 A;  3SXG A;  5C36 A;  4Y7U A;  1H4C A;  4O6M A;  3BCV A;  3GUE A;  1H5T B;  5L6V A;  5CQL X;  2AM4 A;  2Z86 A;  4AC3 A;  1G23 A;  4MND A;  5IFY A;  3V0Q A;  1GA8 A;  1ZDF A;  2VS4 A;  4G3S A;  4ASY A;  1GWW A;  3RSB A;  3DK5 A;  2QGI A;  3CGX A;  2FYC B;  4EE3 A;  4G3Q A;  1LZ0 A;  1V84 A;  5C48 A;  3Q7U A;  4AYJ A;  1O7O A;  1WT3 A;  1VH3 A;  1EYR A;  2AE7 A;  1YP3 A;  2JCK A;  2WVK A;  2ZU7 A;  1IIN A;  2RIY A;  1VGU A;  1H5R A;  5CQO A;  2RJ8 A;  3R2W A;  2PA4 A;  1FWY A;  1WT1 A;  4ASJ A;  2PGY A;  3OGZ A;  4B4B A;  2I5K A;  2O1H A;  3E25 A;  1WT0 A;  2BO7 A;  1NHE B;  4EEG A;  3SX3 A;  4IRQ A;  5C3D A;  2C0N A;  3SXA A;  1LZI A;  1MP5 A;  4EEM A;  4KXO A;  4FRH A;  5C4F A;  4NAL A;  1H7L A;  5C1H A;  3U2X A;  4D11 A;  2YQH A;  2E8B A;  2YC3 A;  3Q80 A;  4B4M A;  2MZB A;  2X5Z A;  2Y7A A;  1YRO B;  1QG8 A;  4CJC A;  2A8W A;  2D7I A;  3U2T A;  1QWJ A;  2PGV A;  3V0N A;  5DDV A;  5CMH A;  3OKR A;  2RIZ A;  3V8Y A;  1FR8 A;  3USR A;  1ZJ3 A;  1OMZ A;  2Q4J A;  4FRB A;  1FOA A;  4B2W A;  2Y4J A;  5J49 A;  1H3M A;  1EZI A;  2VS3 A;  3SXE A;  3T7N A;  1LZJ A;  3SXB A;  1INJ A;  1HM8 A;  3I0L A;  3IOI A;  1TZF A;  2RJ0 A;  5C1G A;  3U0X A;  5FUH A;  2PX7 A;  2JCL A;  2CU2 A;  3FWW A;  1G93 A;  4FIX A;  3V0M A;  3JUK A;  2AM5 A;  4EEO A;  4DEC A;  2XWN A;  1ZI5 A;  1ZCT A;  3I0C A;  3F1C A;  2RJ9 A;  3CU0 A;  4E1K A;  2J0B A;  3K8D A;  1MC3 A;  1VZX A;  3V8Z A;  1FRW A;  4HG6 A;  1HV9 A;  3NGW A;  1NQI B;  4HOC A;  4KRV A;  3V0L A;  5C49 A;  1H4E A;  4ZDQ A;  4J18 A;  2WVM A;  3PNN A;  2YES A;  3I0I X;  2ZU9 A;  1ZCU A;  3TQD A;  4Y7G A;  2WEE A;  5CMF X;  3CKV A;  2W0V A;  2X5S A;  2A8U A;  3SX5 A;  2AH9 A;  2P72 A;  2RJ5 A;  3D8V A;  1ZI1 A;  1XZ6 A;  4B4G A;  1NMM B;  5CQM X;  2OEG A;  3QVB A;  4FIY A;  3ZLL A;  4D0Z A;  4BQH A;  2D7R A;  5BXC A;  4KPX A;  1VIC A;  4FRQ A;  4LW6 A;  1HM9 A;  1FGX A;  4FCE A;  3LW6 A;  1TW1 A;  2XME A;  4FRL A;  2W0W A;  1E5K A;  1G8O A;  3OH3 A;  4NAN A;  1ON8 A;  1TVY A;  3PKQ A;  1ZJP A;  2WVL A;  5C8R A;  1ZDG A;  2XWM A;  2ICY A;  2X60 A;  2V0H A;  1R7U A;  1ZCY A;  1WVC A;  2AM3 A;  1R7V A;  5DDT A;  3JUJ A;  5IDS A;  1H5R B;  2VFZ A;  2O1F A;  1H5S D;  2WE9 A;  1GQ9 A;  2VK9 A;  4HO8 A;  1ZHJ A;  3U2W A;  3D5N A;  4MYB A;  2X65 A;  4NAK A;  2FYD B;  1LZ7 A;  1VZT A;  2FY7 A;  3SPT A;  1W77 A;  4Y7V A;  4CJB A;  1V83 A;  4FRA A;  4HO9 A;  1H5S C;  2V0K A;  3ZF8 A;  1MP3 A;  4KC2 A;  2RJ1 A;  1Z90 A;  4HCQ A;  4Y64 A;  1JV3 A;  2FYA A;  5FTV A;  4MIX A;  4FQW A;  4M28 A;  1NKH B;  3N9W A;  1G95 A;  1PZT A;  2YQJ A;  4Y63 A;  1G97 A;  1ZI4 A;  2APC A;  1GX0 A;  2V0I A;  1ZI3 A;  3V91 A;  2Y4M A;  1VPA A;  1LL2 A;  1LL3 A;  2FFV A;  4M2B A;  3U0Y A;  4D48 A;  5I1F A;  1R80 A;  2V0L A;  2QKX A;  4ARW A;  1QGQ A;  1JYK A;  5C4B A;  4HO3 A;  2OI5 A;  2VSH A;  2JCO A;  2GGQ A;  1ZCV A;  4K6R A;  3DUV A;  4R7P A;  1R7T A;  1JYL A;  4P00 A;  1S4N A;  4HO2 A;  3SXD A;  5C4D A;  3SX8 A;  3SXC A;  5FU0 A;  1LVW A;  3OH1 A;  4FRD A;  4M4K A;  2DPW A;  5FTS A;  3ST8 A;  4FRP A;  5CMG X;  2VD4 A;  1ZIZ A;  1ZJ2 A;  4CVH A;  3IOJ A;  3POL A;  5C4C A;  5CMI A;  1GQC A;  1O7Q A;  1VM8 A;  1NWG B;  3I0K A;  3K8E A;  1FR9 A;  2Y6P A;  1HJL A;  4B3U A;  1G1L A;  1R7X A;  4Y6N A;  2AGD A;  5CQP A;  4DDZ A;  2JCJ A;  4FRE A;  1OQM B;  1WSZ A;  4Y9X A;  1HJJ A;  1H5S A;  3SX7 A;  1G9R A;  1GX4 A;  4KNX A;  1R82 A;  4FRO A;  1S4O A;  1O23 B;  4KC4 A;  4KNR A;  4LW3 A;  2RJ4 A;  1G2V A;  2NXV A;  4L41 C;  3IOH A;  4FRM A;  4M2A A;  5C3A A;  1R7Y A;  2RIT A;  5C38 A;  3CKQ A;  1JVD A;  3V90 A;  2RJ7 A;  1G3L A;  1H7G A;  3I0E A;  3CKN A;  5EIY A;  1JVG A;  2BO8 A;  2QH5 A;  2RJ6 A;  2AEC A;  4Y7F A;  4Y6U A;  5C47 A;  4IRP A;  2ICX A;  3E26 A;  1H7T A;  4Y62 A;  3OH4 A;  3FOQ A;  4HO5 A;  5FU8 A;  2Y4L A;  1INI A;  3U2V A;  1W55 A;  1H7F A;  2YQC A;  2V0J A;  4P02 A;  5D91 A;  1H5T A;  4UEG A;  4XWI A;  2D0J A;  3ZGF A;  4BMA A;  1FXJ A;  2OI7 A;  2FFU A;  1IIM A;  5IDT A;  4D0T A;  1FGG A;  3CKJ A;  1HM0 A;  1MP4 A;  3I0D A;  5C1L A;  3V0P A;  4O6N A;  2J0A A;  3D98 A;  1PZY B;  1XHB A;  3OC9 A;  2VSI A;  3HL3 A;  3OH0 A;  4B42 A;  3OAM A;  4DE7 A;  1QGS A;  2BO6 A;  5AJP A;  2WGZ A;  5L6S A;  1ZJO A;  2XWL A;  1NF5 B;  1VGZ A;  5AJN A;  5C3B A;  1WT2 A;  2UX8 A;  2Z87 A;  3ZLK A;  3I0J A;  2GGO A;  4Y7T A;  5EJZ A;  3Q4S A;  1VGT A;  3O3P A;  2VS5 A;  2VXL A;  4B2X A;  4ECM A;  3U2U A;  1ZJ1 A;  5CQN X;  3BRK X;  3RMV A;  4JD0 A;  3RMW A;  3T7O A;  2ZU8 A;  4CJ8 A;  2WAW A;  1VGW A;  1VH1 A;  3I0H A;  5AJO A;  4EVW A;  1G0R A;  3T7M A;  1FZW A;  1V82 A; 
#chains in the Genus database with same CATH homology
 4EEA A;  1I52 A;  1ZJ0 A;  3F1Y A;  2I7B A;  1YP2 A;  3I0F A;  4GBP A;  2E3D A;  5FYE A;  4G3P A;  1H5S B;  1YP4 A;  5FV9 A;  2P73 A;  4C2S A;  1TW5 A;  4HO6 A;  3DJ4 A;  4HO4 A;  2YC5 A;  1GWV A;  5JQQ A;  1H4D A;  1K4V A;  2RIX A;  4EE5 A;  4KQL A;  5CMJ A;  1SS9 A;  2XMH A;  4EE4 A;  1FXO A;  2OI6 A;  2FYB A;  3TZT A;  3PKP A;  2P6W A;  1H7E A;  1S4P A;  1R81 A;  1H7Q A;  1KWS A;  2VXM A;  3JTJ A;  3R3I A;  1FO9 A;  1VZU A;  4JIS A;  5C4E A;  4NAI A;  5HS2 A;  1OMX A;  4KT7 A;  4G87 A;  4B5B A;  2YQS A;  3USQ A;  4FCU A;  2OEF A;  5EJ1 A;  2AES A;  4YS8 A;  3ZGG A;  3EE5 A;  3CKO A;  4Q7C A;  1W57 A;  1JV1 A;  2BO4 A;  2Y4K A;  3OH2 A;  5D92 A;  1LL0 A;  4KC1 A;  1FG5 N;  3I0G A;  4KPZ A;  3V0O A;  4AYL A;  1ON6 A;  2I5E A;  1FO8 A;  2O1G A;  4AAW A;  4D11 C;  3KIA A;  2YCM A;  1O0R A;  1H7H A;  4HO0 A;  3SXG A;  5C36 A;  4Y7U A;  1H4C A;  4O6M A;  3BCV A;  3GUE A;  1H5T B;  5L6V A;  5CQL X;  2AM4 A;  2Z86 A;  4AC3 A;  1G23 A;  4MND A;  5IFY A;  3V0Q A;  1GA8 A;  1ZDF A;  2VS4 A;  4G3S A;  4ASY A;  1GWW A;  3RSB A;  3DK5 A;  2QGI A;  3CGX A;  2FYC B;  4EE3 A;  4G3Q A;  1LZ0 A;  1V84 A;  5C48 A;  3Q7U A;  4AYJ A;  1O7O A;  1WT3 A;  1VH3 A;  1EYR A;  2AE7 A;  1YP3 A;  2JCK A;  2WVK A;  2ZU7 A;  1IIN A;  2RIY A;  1VGU A;  1H5R A;  5CQO A;  2RJ8 A;  3R2W A;  2PA4 A;  1FWY A;  1WT1 A;  4ASJ A;  2PGY A;  3OGZ A;  4B4B A;  2I5K A;  2O1H A;  3E25 A;  1WT0 A;  2BO7 A;  1NHE B;  4EEG A;  3SX3 A;  4IRQ A;  5C3D A;  2C0N A;  3SXA A;  1LZI A;  1MP5 A;  4EEM A;  4KXO A;  4FRH A;  5C4F A;  4NAL A;  1H7L A;  5C1H A;  3U2X A;  4D11 A;  2YQH A;  2E8B A;  2YC3 A;  3Q80 A;  4B4M A;  2MZB A;  2X5Z A;  2Y7A A;  1YRO B;  1QG8 A;  4CJC A;  2A8W A;  2D7I A;  3U2T A;  1QWJ A;  2PGV A;  3V0N A;  5DDV A;  5CMH A;  3OKR A;  2RIZ A;  3V8Y A;  1FR8 A;  3USR A;  1ZJ3 A;  1OMZ A;  2Q4J A;  4FRB A;  1FOA A;  4B2W A;  2Y4J A;  5J49 A;  1H3M A;  1EZI A;  2VS3 A;  3SXE A;  3T7N A;  1LZJ A;  3SXB A;  1INJ A;  1HM8 A;  3I0L A;  3IOI A;  1TZF A;  2RJ0 A;  5C1G A;  3U0X A;  5FUH A;  2PX7 A;  2JCL A;  2CU2 A;  3FWW A;  1G93 A;  4FIX A;  3V0M A;  3JUK A;  2AM5 A;  4EEO A;  4DEC A;  2XWN A;  1ZI5 A;  1ZCT A;  3I0C A;  3F1C A;  2RJ9 A;  3CU0 A;  4E1K A;  2J0B A;  3K8D A;  1MC3 A;  1VZX A;  3V8Z A;  1FRW A;  4HG6 A;  1HV9 A;  3NGW A;  1NQI B;  4HOC A;  4KRV A;  3V0L A;  5C49 A;  1H4E A;  4ZDQ A;  4J18 A;  2WVM A;  3PNN A;  2YES A;  3I0I X;  2ZU9 A;  1ZCU A;  3TQD A;  4Y7G A;  2WEE A;  5CMF X;  3CKV A;  2W0V A;  2X5S A;  2A8U A;  3SX5 A;  2AH9 A;  2P72 A;  2RJ5 A;  3D8V A;  1ZI1 A;  1XZ6 A;  4B4G A;  1NMM B;  5CQM X;  2OEG A;  3QVB A;  4FIY A;  3ZLL A;  4D0Z A;  4BQH A;  2D7R A;  5BXC A;  4KPX A;  1VIC A;  4FRQ A;  4LW6 A;  1HM9 A;  1FGX A;  4FCE A;  3LW6 A;  1TW1 A;  2XME A;  4FRL A;  2W0W A;  1E5K A;  1G8O A;  3OH3 A;  4NAN A;  1ON8 A;  1TVY A;  3PKQ A;  1ZJP A;  2WVL A;  5C8R A;  1ZDG A;  2XWM A;  2ICY A;  2X60 A;  2V0H A;  1R7U A;  1ZCY A;  1WVC A;  2AM3 A;  1R7V A;  5DDT A;  3JUJ A;  5IDS A;  1H5R B;  2VFZ A;  2O1F A;  1H5S D;  2WE9 A;  1GQ9 A;  2VK9 A;  4HO8 A;  1ZHJ A;  3U2W A;  3D5N A;  4MYB A;  2X65 A;  4NAK A;  2FYD B;  1LZ7 A;  1VZT A;  2FY7 A;  3SPT A;  1W77 A;  4Y7V A;  4CJB A;  1V83 A;  4FRA A;  4HO9 A;  1H5S C;  2V0K A;  3ZF8 A;  1MP3 A;  4KC2 A;  2RJ1 A;  1Z90 A;  4HCQ A;  4Y64 A;  1JV3 A;  2FYA A;  5FTV A;  4MIX A;  4FQW A;  4M28 A;  1NKH B;  3N9W A;  1G95 A;  1PZT A;  2YQJ A;  4Y63 A;  1G97 A;  1ZI4 A;  2APC A;  1GX0 A;  2V0I A;  1ZI3 A;  3V91 A;  2Y4M A;  1VPA A;  1LL2 A;  1LL3 A;  2FFV A;  4M2B A;  3U0Y A;  4D48 A;  5I1F A;  1R80 A;  2V0L A;  2QKX A;  4ARW A;  1QGQ A;  1JYK A;  5C4B A;  4HO3 A;  2OI5 A;  2VSH A;  2JCO A;  2GGQ A;  1ZCV A;  4K6R A;  3DUV A;  4R7P A;  1R7T A;  1JYL A;  4P00 A;  1S4N A;  4HO2 A;  3SXD A;  5C4D A;  3SX8 A;  3SXC A;  5FU0 A;  1LVW A;  3OH1 A;  4FRD A;  4M4K A;  2DPW A;  5FTS A;  3ST8 A;  4FRP A;  5CMG X;  2VD4 A;  1ZIZ A;  1ZJ2 A;  4CVH A;  3IOJ A;  3POL A;  5C4C A;  5CMI A;  1GQC A;  1O7Q A;  1VM8 A;  1NWG B;  3I0K A;  3K8E A;  1FR9 A;  2Y6P A;  1HJL A;  4B3U A;  1G1L A;  1R7X A;  4Y6N A;  2AGD A;  5CQP A;  4DDZ A;  2JCJ A;  4FRE A;  1OQM B;  1WSZ A;  4Y9X A;  1HJJ A;  1H5S A;  3SX7 A;  1G9R A;  1GX4 A;  4KNX A;  1R82 A;  4FRO A;  1S4O A;  1O23 B;  4KC4 A;  4KNR A;  4LW3 A;  2RJ4 A;  1G2V A;  2NXV A;  4L41 C;  3IOH A;  4FRM A;  4M2A A;  5C3A A;  1R7Y A;  2RIT A;  5C38 A;  3CKQ A;  1JVD A;  3V90 A;  2RJ7 A;  1G3L A;  1H7G A;  3I0E A;  3CKN A;  5EIY A;  1JVG A;  2BO8 A;  2QH5 A;  2RJ6 A;  2AEC A;  4Y7F A;  4Y6U A;  5C47 A;  4IRP A;  2ICX A;  3E26 A;  1H7T A;  4Y62 A;  3OH4 A;  3FOQ A;  4HO5 A;  5FU8 A;  2Y4L A;  1INI A;  3U2V A;  1W55 A;  1H7F A;  2YQC A;  2V0J A;  4P02 A;  5D91 A;  1H5T A;  4UEG A;  4XWI A;  2D0J A;  3ZGF A;  4BMA A;  1FXJ A;  2OI7 A;  2FFU A;  1IIM A;  5IDT A;  4D0T A;  1FGG A;  3CKJ A;  1HM0 A;  1MP4 A;  3I0D A;  5C1L A;  3V0P A;  4O6N A;  2J0A A;  3D98 A;  1PZY B;  1XHB A;  3OC9 A;  2VSI A;  3HL3 A;  3OH0 A;  4B42 A;  3OAM A;  4DE7 A;  1QGS A;  2BO6 A;  5AJP A;  2WGZ A;  5L6S A;  1ZJO A;  2XWL A;  1NF5 B;  1VGZ A;  5AJN A;  5C3B A;  1WT2 A;  2UX8 A;  2Z87 A;  3ZLK A;  3I0J A;  2GGO A;  4Y7T A;  5EJZ A;  3Q4S A;  1VGT A;  3O3P A;  2VS5 A;  2VXL A;  4B2X A;  4ECM A;  3U2U A;  1ZJ1 A;  5CQN X;  3BRK X;  3RMV A;  4JD0 A;  3RMW A;  3T7O A;  2ZU8 A;  4CJ8 A;  2WAW A;  1VGW A;  1VH1 A;  3I0H A;  5AJO A;  4EVW A;  1G0R A;  3T7M A;  1FZW A;  1V82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...