1QG8A

Native (magnesium-containing) spsa from bacillus subtilis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
238
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Structure of the nucleotide-diphospho-sugar transferase, SpsA from Bacillus subtilis, in native and nucleotide-complexed forms.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 91
structure length 238
sequence length 255
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qg8A00
4Y6NA 1V84A 1G93A 3ZLKA 1R7YA 2BO7A 2V0LA 3EE5A 3ZLLA 1YP2A 5CQOA 5L6SA 2YQJA 1ZCVA 5CQMX 4L41C 1FXOA 3SX5A 3I0GA 1ZI4A 3OH0A 5EIYA 2NXVA 1FXJA 1GWWA 3PNNA 4CVHA 5C36A 2FYDB 5BXCA 1H5SA 3IOIA 3JUJA 3SXBA 1ZJ3A 1JV3A 2OI6A 2X5SA 1O7QA 3U2WA 2RJ1A 4FRMA 5C1GA 1MP3A 1WT1A 3SX3A 5C49A 2ZU8A 1ON6A 1R80A 3U0XA 3CGXA 3GUEA 3JUKA 5FU0A 3DJ4A 4HCQA 1H4DA 1KWSA 4FRBA 4NANA 5CMIA 4D11C 3T7OA 4ASYA 1LZIA 4Y7VA 5FTSA 1JVDA 1VGWA 2Y4KA 4FCUA 1GX4A 4B4BA 4IRQA 1INJA 1H7EA 1VICA 2QKXA 4Y7UA 4B2XA 1H5TA 3CKQA 1GQ9A 1SS9A 3U0YA 2AH9A 1R81A 3R2WA 2BO6A 1VGTA 1H3MA 2XMHA 1VZUA 2WAWA 2YC3A 3E26A 1WT2A 4BQHA 1K4VA 3K8EA 4CJBA 1JVGA 5HS2A 2PGYA 1NHEB 2WVKA 2FYBA 4HO0A 2JCJA 4EE3A 3I0JA 5C38A 3OGZA 3V0LA 3SXGA 4MYBA 2AGDA 4KRVA 3LW6A 1QGQA 1FWYA 1LZ7A 3V90A 4KNXA 2P73A 2RJ7A 1G1LA 2OEFA 4B4MA 1FO8A 2YQHA 4J18A 3V8YA 1NMMB 4ZDQA 1H5RA 4M2BA 1W55A 1LZJA 3I0IX 1S4OA 1PZYB 4KNRA 1O7OA 4EE4A 1NWGB 1VM8A 2AESA 3I0EA 1S4PA 5AJOA 1S4NA 1VZTA 4G3QA 1LL2A 3V0NA 3E25A 5C3DA 5EJ1A 4EEAA 3R3IA 2RJ6A 3RMVA 4EEOA 2UX8A 4HO3A 3U2XA 3V0OA 4FRDA 5JQQA 2DPWA 4FRAA 4HO4A 3OAMA 2VSHA 4Y63A 1ZCUA 3T7MA 2FYCB 2V0IA 3Q7UA 3V0MA 4EE5A 2ZU7A 4HO6A 2V0JA 4D0ZA 2PA4A 4CJ8A 2YC5A 1H4EA 1FGGA 1G0RA 2OI7A 1WT3A 1HM9A 1I52A 2ZU9A 4KT7A 1VH1A 4YS8A 1GWVA 4FREA 4E1KA 1ON8A 2FFVA 3PKPA 1LZ0A 2YQCA 2MZBA 2VS3A 4LW3A 1O23B 1G3LA 1IINA 3DUVA 3IOJA 5CMHA 2XMEA 4P02A 3SXCA 5C4CA 1H7TA 1JYKA 1VGZA 2Y4JA 5CQLX 2ICYA 5DDVA 4P00A 5DDTA 3OH4A 4B42A 2A8UA 1R7UA 1VH3A 4B3UA 3PKQA 3I0LA 1VZXA 1ZDFA 3CKVA 2AE7A 3ST8A 3SXDA 1ZDGA 3V8ZA 3I0CA 5FV9A 1G2VA 5C3AA 1FRWA 2VXLA 4B4GA 2JCLA 4Y64A 1H5SD 1GX0A 1YP3A 2VS4A 3F1YA 1FZWA 4ASJA 5C8RA 1INIA 1IIMA 3U2UA 3CKNA 3CU0A 2Z86A 2YCMA 1FO9A 3I0FA 2Y6PA 5C47A 4D11A 4JISA 2XWMA 1PZTA 5CQPA 4AYJA 3ZF8A 1WT0A 5CQNX 2YQSA 1G9RA 3TZTA 2Y4MA 2D7RA 1R82A 1JV1A 1HM0A 4D0TA 1XHBA 1ZJ2A 1H4CA 3POLA 3ZGGA 3D98A 1FGXA 3Q4SA 3U2VA 4LW6A 2RIYA 4Y6UA 1O0RA 2WE9A 4FRQA 1LVWA 2FY7A 2WVMA 1ZI5A 2GGQA 1R7VA 1R7XA 3QVBA 2VD4A 1FG5N 2X5ZA 4KPXA 3V0PA 1WSZA 5IFYA 1HV9A 1OMXA 2I5KA 1MC3A 2PGVA 4K6RA 2E3DA 3OH2A 1NQIB 1ZJ0A 5FU8A 3SX7A 1XZ6A 1G95A 1FOAA 3USQA 2WEEA 4IRPA 1QG8A 5CMJA 1H5SB 1JYLA 2X60A 2I7BA 4GBPA 4M2AA 5FUHA 4EVWA 2AM4A 4HO2A 4DDZA 4G3SA 2XWNA 2PX7A 2W0VA 2P6WA 4EEGA 1H7LA 4XWIA 3I0DA 4FRLA 1ZJPA 3TQDA 3O3PA 3RMWA 2WGZA 1HJJA 1HM8A 1QGSA 4M28A 3SXEA 4ECMA 3SPTA 4ARWA 3T7NA 4UEGA 1TZFA 4BMAA 1H5TB 5J49A 2Y7AA 4HO5A 2RIXA 2OEGA 2OI5A 2V0KA 5EJZA 2P72A 2W0WA 1ZCTA 1H5SC 5L6VA 1ZIZA 2AECA 3FWWA 1H7FA 4C2SA 2VXMA 2Z87A 2E8BA 1V82A 2V0HA 2X65A 3RSBA 5AJNA 5C4BA 5C1LA 4HO8A 1FR9A 1NF5B 5C48A 4NAKA 1Z90A 4NAIA 1EZIA 1TVYA 1V83A 1OQMB 1QWJA 4FRPA 1YROB 4DECA 2VSIA 2RITA 5C4DA 3FOQA 4KQLA 1H5RB 1G97A 3N9WA 4R7PA 2RJ0A 2RJ8A 1ZJOA 1HJLA 3OH3A 2I5EA 4KC4A 3IOHA 1OMZA 2QH5A 4FRHA 2BO8A 1R7TA 3CKOA 1ZI3A 3OH1A 2ICXA 3F1CA 4FQWA 2YESA 4Y7TA 1FR8A 5FYEA 1GQCA 1VPAA 4D48A 3OC9A 4KPZA 1W77A 3SXAA 5CMFX 1G8OA 5IDSA 2AM3A 3D5NA 4MNDA 2VFZA 4KC2A 4CJCA 1ZCYA 1WVCA 2BO4A 4Y9XA 1GA8A 2A8WA 2XWLA 1ZI1A 4HO9A 4B2WA 2CU2A 4AC3A 3KIAA 3NGWA 4HG6A 4G87A 5AJPA 1H7QA 1VGUA 3I0KA 3Q80A 5C4EA 3CKJA 5I1FA 2APCA 1EYRA 3HL3A 2Y4LA 1H7GA 4AYLA 2VS5A 4FCEA 4JD0A 2RJ4A 1W57A 3BRKX 3V91A 4FROA 2GGOA 4G3PA 5C4FA 4KXOA 2D0JA 1NKHB 3D8VA 3I0HA 1YP4A 1TW1A 4NALA 4EEMA 2RJ9A 1MP5A 3DK5A 4KC1A 1H7HA 5C1HA 4HOCA 1G23A 4Y7FA 3V0QA 4B5BA 2WVLA 2O1HA 4M4KA 1MP4A 2O1GA 2RJ5A 2Q4JA 2QGIA 2FFUA 5FTVA 1LL3A 5C3BA 5CMGX 4AAWA 3OKRA 2D7IA 2JCOA 2JCKA 4Y62A 3U2TA 3ZGFA 1E5KA 3JTJA 3K8DA 3USRA 2O1FA 1LL0A 3BCVA 3SX8A 4Y7GA 2RIZA 1ZHJA 4DE7A 5IDTA 1ZJ1A 1TW5A 2AM5A 2FYAA
chains in the Genus database with same CATH superfamily
4Y6NA 1V84A 1G93A 3ZLKA 1R7YA 2BO7A 2V0LA 3EE5A 3ZLLA 1YP2A 5CQOA 5L6SA 2YQJA 1ZCVA 5CQMX 4L41C 1FXOA 3SX5A 3I0GA 1ZI4A 3OH0A 5EIYA 2NXVA 1FXJA 1GWWA 3PNNA 4CVHA 5C36A 2FYDB 5BXCA 1H5SA 3IOIA 3JUJA 3SXBA 1ZJ3A 1JV3A 2OI6A 2X5SA 1O7QA 3U2WA 2RJ1A 4FRMA 5C1GA 1MP3A 1WT1A 3SX3A 5C49A 2ZU8A 1ON6A 1R80A 3U0XA 4O6NA 3CGXA 3GUEA 3JUKA 5FU0A 3DJ4A 4HCQA 1H4DA 1KWSA 4FRBA 4NANA 5CMIA 4D11C 3T7OA 4ASYA 1LZIA 4Y7VA 5FTSA 1JVDA 1VGWA 2Y4KA 4FCUA 1GX4A 4B4BA 4IRQA 1INJA 1H7EA 1VICA 2QKXA 4Y7UA 4B2XA 1H5TA 3CKQA 1GQ9A 5D92A 1SS9A 3U0YA 2AH9A 1R81A 3R2WA 2J0BA 2BO6A 1VGTA 1H3MA 2XMHA 4FIYA 1VZUA 2WAWA 2YC3A 3E26A 1WT2A 4BQHA 1K4VA 3K8EA 4CJBA 1JVGA 5HS2A 2VK9A 2PGYA 1NHEB 2WVKA 2FYBA 4HO0A 2JCJA 4EE3A 3I0JA 5C38A 3OGZA 3V0LA 3SXGA 4MYBA 2AGDA 4KRVA 3LW6A 1QGQA 1FWYA 1LZ7A 3V90A 4KNXA 2P73A 2RJ7A 1G1LA 2OEFA 4B4MA 1FO8A 2YQHA 4J18A 3V8YA 1NMMB 4ZDQA 1H5RA 4M2BA 1W55A 1LZJA 3I0IX 1S4OA 1PZYB 4KNRA 1O7OA 4FIXA 4EE4A 1NWGB 1VM8A 2AESA 3I0EA 1S4PA 5AJOA 1S4NA 1VZTA 4G3QA 1LL2A 3V0NA 3E25A 5C3DA 5EJ1A 4EEAA 3R3IA 2RJ6A 3RMVA 4EEOA 2UX8A 4HO3A 3U2XA 3V0OA 4FRDA 5JQQA 2DPWA 4FRAA 4HO4A 3OAMA 2VSHA 4Y63A 1ZCUA 3T7MA 2FYCB 2V0IA 3Q7UA 3V0MA 4EE5A 2ZU7A 4HO6A 2V0JA 4D0ZA 2PA4A 4CJ8A 2YC5A 1H4EA 1FGGA 1G0RA 2OI7A 1WT3A 1HM9A 1I52A 2ZU9A 4KT7A 1VH1A 4YS8A 1GWVA 4FREA 4E1KA 1ON8A 2FFVA 3PKPA 1LZ0A 2YQCA 2MZBA 2VS3A 4LW3A 1O23B 1G3LA 1IINA 3DUVA 3IOJA 5CMHA 2XMEA 4P02A 3SXCA 5C4CA 1H7TA 1JYKA 1VGZA 2Y4JA 5CQLX 2ICYA 5DDVA 4P00A 5DDTA 3OH4A 4B42A 2A8UA 1R7UA 1VH3A 4B3UA 3PKQA 3I0LA 1VZXA 1ZDFA 3CKVA 2AE7A 3ST8A 3SXDA 1ZDGA 3V8ZA 3I0CA 5FV9A 1G2VA 5C3AA 1FRWA 2VXLA 4B4GA 2JCLA 4Y64A 1H5SD 1GX0A 1YP3A 2VS4A 3F1YA 1FZWA 4ASJA 5C8RA 1INIA 1IIMA 3U2UA 3CKNA 3CU0A 2Z86A 2YCMA 1FO9A 3I0FA 2Y6PA 5C47A 4D11A 4JISA 2XWMA 1PZTA 5CQPA 4AYJA 3ZF8A 1WT0A 5CQNX 2YQSA 1G9RA 3TZTA 2Y4MA 2D7RA 1R82A 1JV1A 1HM0A 4D0TA 1XHBA 1ZJ2A 1H4CA 3POLA 3ZGGA 3D98A 1FGXA 3Q4SA 3U2VA 4LW6A 2RIYA 4Y6UA 1O0RA 2WE9A 4FRQA 1LVWA 2FY7A 2WVMA 1ZI5A 2GGQA 1R7VA 1R7XA 3QVBA 2VD4A 1FG5N 2X5ZA 4KPXA 3V0PA 1WSZA 5IFYA 1HV9A 1OMXA 2I5KA 1MC3A 2PGVA 4K6RA 2E3DA 3OH2A 1NQIB 1ZJ0A 5FU8A 3SX7A 1XZ6A 1G95A 1FOAA 3USQA 2WEEA 4IRPA 1QG8A 5CMJA 1H5SB 1JYLA 2X60A 2I7BA 4GBPA 4M2AA 5FUHA 4EVWA 2AM4A 4HO2A 4MIXA 4DDZA 4G3SA 2XWNA 2PX7A 2W0VA 2P6WA 4EEGA 1H7LA 4XWIA 3I0DA 4FRLA 5D91A 1ZJPA 3TQDA 3O3PA 3RMWA 2WGZA 2J0AA 1HJJA 1HM8A 1QGSA 4M28A 3SXEA 4ECMA 3SPTA 4ARWA 3T7NA 4UEGA 1TZFA 4BMAA 1H5TB 5J49A 2Y7AA 4HO5A 2RIXA 2OEGA 2OI5A 2V0KA 5EJZA 2P72A 2W0WA 1ZCTA 1H5SC 5L6VA 2C0NA 1ZIZA 2AECA 3FWWA 1H7FA 4C2SA 2VXMA 2Z87A 2E8BA 1V82A 2V0HA 2X65A 3RSBA 5AJNA 5C4BA 5C1LA 4HO8A 1FR9A 1NF5B 5C48A 4NAKA 1Z90A 4NAIA 1EZIA 1TVYA 1V83A 1OQMB 1QWJA 4FRPA 1YROB 4DECA 2VSIA 2RITA 5C4DA 3FOQA 4KQLA 1H5RB 1G97A 3N9WA 4R7PA 2RJ0A 2RJ8A 1ZJOA 1HJLA 3OH3A 2I5EA 4KC4A 3IOHA 1OMZA 2QH5A 4FRHA 2BO8A 1R7TA 3CKOA 1ZI3A 3OH1A 2ICXA 3F1CA 4FQWA 2YESA 4Y7TA 4O6MA 1FR8A 5FYEA 1GQCA 1VPAA 4D48A 3OC9A 4KPZA 1W77A 3SXAA 5CMFX 1G8OA 5IDSA 2AM3A 3D5NA 4MNDA 2VFZA 4KC2A 4CJCA 1ZCYA 1WVCA 2BO4A 4Y9XA 1GA8A 2A8WA 2XWLA 1ZI1A 4HO9A 4B2WA 2CU2A 4AC3A 3KIAA 3NGWA 4HG6A 4G87A 5AJPA 1H7QA 1VGUA 3I0KA 3Q80A 5C4EA 3CKJA 5I1FA 2APCA 1EYRA 3HL3A 2Y4LA 1H7GA 4AYLA 2VS5A 4FCEA 4JD0A 2RJ4A 1W57A 3BRKX 3V91A 4FROA 2GGOA 4G3PA 5C4FA 4KXOA 2D0JA 1NKHB 3D8VA 3I0HA 1YP4A 1TW1A 4NALA 4EEMA 2RJ9A 1MP5A 3DK5A 4KC1A 1H7HA 5C1HA 4HOCA 1G23A 4Y7FA 3V0QA 4B5BA 2WVLA 2O1HA 4M4KA 4Q7CA 1MP4A 2O1GA 2RJ5A 2Q4JA 2QGIA 2FFUA 5FTVA 1LL3A 5C3BA 5CMGX 4AAWA 3OKRA 2D7IA 2JCOA 2JCKA 4Y62A 3U2TA 3ZGFA 1E5KA 3JTJA 3K8DA 3USRA 2O1FA 1LL0A 3BCVA 3SX8A 4Y7GA 2RIZA 1ZHJA 4DE7A 5IDTA 1ZJ1A 1TW5A 2AM5A 2FYAA
chains in the Genus database with same CATH topology
4Y6NA 1V84A 1G93A 3ZLKA 1R7YA 2BO7A 2V0LA 3EE5A 3ZLLA 1YP2A 5CQOA 5L6SA 2YQJA 1ZCVA 5CQMX 4L41C 1FXOA 3SX5A 3I0GA 1ZI4A 3OH0A 5EIYA 2NXVA 1FXJA 1GWWA 3PNNA 4CVHA 5C36A 2FYDB 5BXCA 1H5SA 3IOIA 3JUJA 3SXBA 1ZJ3A 1JV3A 2OI6A 2X5SA 1O7QA 3U2WA 2RJ1A 4FRMA 5C1GA 1MP3A 1WT1A 3SX3A 5C49A 2ZU8A 1ON6A 1R80A 3U0XA 4O6NA 3CGXA 3GUEA 3JUKA 5FU0A 3DJ4A 4HCQA 1H4DA 1KWSA 4FRBA 4NANA 5CMIA 4D11C 3T7OA 4ASYA 1LZIA 4Y7VA 5FTSA 1JVDA 1VGWA 2Y4KA 4FCUA 1GX4A 4B4BA 4IRQA 1INJA 1H7EA 1VICA 2QKXA 4Y7UA 4B2XA 1H5TA 3CKQA 1GQ9A 5D92A 1SS9A 3U0YA 2AH9A 1R81A 3R2WA 2J0BA 2BO6A 1VGTA 1H3MA 2XMHA 4FIYA 1VZUA 2WAWA 2YC3A 3E26A 1WT2A 4BQHA 1K4VA 3K8EA 4CJBA 1JVGA 5HS2A 2VK9A 2PGYA 1NHEB 2WVKA 2FYBA 4HO0A 2JCJA 4EE3A 3I0JA 5C38A 3OGZA 3V0LA 3SXGA 4MYBA 2AGDA 4KRVA 3LW6A 1QGQA 1FWYA 1LZ7A 3V90A 4KNXA 2P73A 2RJ7A 1G1LA 2OEFA 4B4MA 1FO8A 2YQHA 4J18A 3V8YA 1NMMB 4ZDQA 1H5RA 4M2BA 1W55A 1LZJA 3I0IX 1S4OA 1PZYB 4KNRA 1O7OA 4FIXA 4EE4A 1NWGB 1VM8A 2AESA 3I0EA 1S4PA 5AJOA 1S4NA 1VZTA 4G3QA 1LL2A 3V0NA 3E25A 5C3DA 5EJ1A 4EEAA 3R3IA 2RJ6A 3RMVA 4EEOA 2UX8A 4HO3A 3U2XA 3V0OA 4FRDA 5JQQA 2DPWA 4FRAA 4HO4A 3OAMA 2VSHA 4Y63A 1ZCUA 3T7MA 2FYCB 2V0IA 3Q7UA 3V0MA 4EE5A 2ZU7A 4HO6A 2V0JA 4D0ZA 2PA4A 4CJ8A 2YC5A 1H4EA 1FGGA 1G0RA 2OI7A 1WT3A 1HM9A 1I52A 2ZU9A 4KT7A 1VH1A 4YS8A 1GWVA 4FREA 4E1KA 1ON8A 2FFVA 3PKPA 1LZ0A 2YQCA 2MZBA 2VS3A 4LW3A 1O23B 1G3LA 1IINA 3DUVA 3IOJA 5CMHA 2XMEA 4P02A 3SXCA 5C4CA 1H7TA 1JYKA 1VGZA 2Y4JA 5CQLX 2ICYA 5DDVA 4P00A 5DDTA 3OH4A 4B42A 2A8UA 1R7UA 1VH3A 4B3UA 3PKQA 3I0LA 1VZXA 1ZDFA 3CKVA 2AE7A 3ST8A 3SXDA 1ZDGA 3V8ZA 3I0CA 5FV9A 1G2VA 5C3AA 1FRWA 2VXLA 4B4GA 2JCLA 4Y64A 1H5SD 1GX0A 1YP3A 2VS4A 3F1YA 1FZWA 4ASJA 5C8RA 1INIA 1IIMA 3U2UA 3CKNA 3CU0A 2Z86A 2YCMA 1FO9A 3I0FA 2Y6PA 5C47A 4D11A 4JISA 2XWMA 1PZTA 5CQPA 4AYJA 3ZF8A 1WT0A 5CQNX 2YQSA 1G9RA 3TZTA 2Y4MA 2D7RA 1R82A 1JV1A 1HM0A 4D0TA 1XHBA 1ZJ2A 1H4CA 3POLA 3ZGGA 3D98A 1FGXA 3Q4SA 3U2VA 4LW6A 2RIYA 4Y6UA 1O0RA 2WE9A 4FRQA 1LVWA 2FY7A 2WVMA 1ZI5A 2GGQA 1R7VA 1R7XA 3QVBA 2VD4A 1FG5N 2X5ZA 4KPXA 3V0PA 1WSZA 5IFYA 1HV9A 1OMXA 2I5KA 1MC3A 2PGVA 4K6RA 2E3DA 3OH2A 1NQIB 1ZJ0A 5FU8A 3SX7A 1XZ6A 1G95A 1FOAA 3USQA 2WEEA 4IRPA 1QG8A 5CMJA 1H5SB 1JYLA 2X60A 2I7BA 4GBPA 4M2AA 5FUHA 4EVWA 2AM4A 4HO2A 4MIXA 4DDZA 4G3SA 2XWNA 2PX7A 2W0VA 2P6WA 4EEGA 1H7LA 4XWIA 3I0DA 4FRLA 5D91A 1ZJPA 3TQDA 3O3PA 3RMWA 2WGZA 2J0AA 1HJJA 1HM8A 1QGSA 4M28A 3SXEA 4ECMA 3SPTA 4ARWA 3T7NA 4UEGA 1TZFA 4BMAA 1H5TB 5J49A 2Y7AA 4HO5A 2RIXA 2OEGA 2OI5A 2V0KA 5EJZA 2P72A 2W0WA 1ZCTA 1H5SC 5L6VA 2C0NA 1ZIZA 2AECA 3FWWA 1H7FA 4C2SA 2VXMA 2Z87A 2E8BA 1V82A 2V0HA 2X65A 3RSBA 5AJNA 5C4BA 5C1LA 4HO8A 1FR9A 1NF5B 5C48A 4NAKA 1Z90A 4NAIA 1EZIA 1TVYA 1V83A 1OQMB 1QWJA 4FRPA 1YROB 4DECA 2VSIA 2RITA 5C4DA 3FOQA 4KQLA 1H5RB 1G97A 3N9WA 4R7PA 2RJ0A 2RJ8A 1ZJOA 1HJLA 3OH3A 2I5EA 4KC4A 3IOHA 1OMZA 2QH5A 4FRHA 2BO8A 1R7TA 3CKOA 1ZI3A 3OH1A 2ICXA 3F1CA 4FQWA 2YESA 4Y7TA 4O6MA 1FR8A 5FYEA 1GQCA 1VPAA 4D48A 3OC9A 4KPZA 1W77A 3SXAA 5CMFX 1G8OA 5IDSA 2AM3A 3D5NA 4MNDA 2VFZA 4KC2A 4CJCA 1ZCYA 1WVCA 2BO4A 4Y9XA 1GA8A 2A8WA 2XWLA 1ZI1A 4HO9A 4B2WA 2CU2A 4AC3A 3KIAA 3NGWA 4HG6A 4G87A 5AJPA 1H7QA 1VGUA 3I0KA 3Q80A 5C4EA 3CKJA 5I1FA 2APCA 1EYRA 3HL3A 2Y4LA 1H7GA 4AYLA 2VS5A 4FCEA 4JD0A 2RJ4A 1W57A 3BRKX 3V91A 4FROA 2GGOA 4G3PA 5C4FA 4KXOA 2D0JA 1NKHB 3D8VA 3I0HA 1YP4A 1TW1A 4NALA 4EEMA 2RJ9A 1MP5A 3DK5A 4KC1A 1H7HA 5C1HA 4HOCA 1G23A 4Y7FA 3V0QA 4B5BA 2WVLA 2O1HA 4M4KA 4Q7CA 1MP4A 2O1GA 2RJ5A 2Q4JA 2QGIA 2FFUA 5FTVA 1LL3A 5C3BA 5CMGX 4AAWA 3OKRA 2D7IA 2JCOA 2JCKA 4Y62A 3U2TA 3ZGFA 1E5KA 3JTJA 3K8DA 3USRA 2O1FA 1LL0A 3BCVA 3SX8A 4Y7GA 2RIZA 1ZHJA 4DE7A 5IDTA 1ZJ1A 1TW5A 2AM5A 2FYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6N A;  1V84 A;  1G93 A;  3ZLK A;  1R7Y A;  2BO7 A;  2V0L A;  3EE5 A;  3ZLL A;  1YP2 A;  5CQO A;  5L6S A;  2YQJ A;  1ZCV A;  5CQM X;  4L41 C;  1FXO A;  3SX5 A;  3I0G A;  1ZI4 A;  3OH0 A;  5EIY A;  2NXV A;  1FXJ A;  1GWW A;  3PNN A;  4CVH A;  5C36 A;  2FYD B;  5BXC A;  1H5S A;  3IOI A;  3JUJ A;  3SXB A;  1ZJ3 A;  1JV3 A;  2OI6 A;  2X5S A;  1O7Q A;  3U2W A;  2RJ1 A;  4FRM A;  5C1G A;  1MP3 A;  1WT1 A;  3SX3 A;  5C49 A;  2ZU8 A;  1ON6 A;  1R80 A;  3U0X A;  3CGX A;  3GUE A;  3JUK A;  5FU0 A;  3DJ4 A;  4HCQ A;  1H4D A;  1KWS A;  4FRB A;  4NAN A;  5CMI A;  4D11 C;  3T7O A;  4ASY A;  1LZI A;  4Y7V A;  5FTS A;  1JVD A;  1VGW A;  2Y4K A;  4FCU A;  1GX4 A;  4B4B A;  4IRQ A;  1INJ A;  1H7E A;  1VIC A;  2QKX A;  4Y7U A;  4B2X A;  1H5T A;  3CKQ A;  1GQ9 A;  1SS9 A;  3U0Y A;  2AH9 A;  1R81 A;  3R2W A;  2BO6 A;  1VGT A;  1H3M A;  2XMH A;  1VZU A;  2WAW A;  2YC3 A;  3E26 A;  1WT2 A;  4BQH A;  1K4V A;  3K8E A;  4CJB A;  1JVG A;  5HS2 A;  2PGY A;  1NHE B;  2WVK A;  2FYB A;  4HO0 A;  2JCJ A;  4EE3 A;  3I0J A;  5C38 A;  3OGZ A;  3V0L A;  3SXG A;  4MYB A;  2AGD A;  4KRV A;  3LW6 A;  1QGQ A;  1FWY A;  1LZ7 A;  3V90 A;  4KNX A;  2P73 A;  2RJ7 A;  1G1L A;  2OEF A;  4B4M A;  1FO8 A;  2YQH A;  4J18 A;  3V8Y A;  1NMM B;  4ZDQ A;  1H5R A;  4M2B A;  1W55 A;  1LZJ A;  3I0I X;  1S4O A;  1PZY B;  4KNR A;  1O7O A;  4EE4 A;  1NWG B;  1VM8 A;  2AES A;  3I0E A;  1S4P A;  5AJO A;  1S4N A;  1VZT A;  4G3Q A;  1LL2 A;  3V0N A;  3E25 A;  5C3D A;  5EJ1 A;  4EEA A;  3R3I A;  2RJ6 A;  3RMV A;  4EEO A;  2UX8 A;  4HO3 A;  3U2X A;  3V0O A;  4FRD A;  5JQQ A;  2DPW A;  4FRA A;  4HO4 A;  3OAM A;  2VSH A;  4Y63 A;  1ZCU A;  3T7M A;  2FYC B;  2V0I A;  3Q7U A;  3V0M A;  4EE5 A;  2ZU7 A;  4HO6 A;  2V0J A;  4D0Z A;  2PA4 A;  4CJ8 A;  2YC5 A;  1H4E A;  1FGG A;  1G0R A;  2OI7 A;  1WT3 A;  1HM9 A;  1I52 A;  2ZU9 A;  4KT7 A;  1VH1 A;  4YS8 A;  1GWV A;  4FRE A;  4E1K A;  1ON8 A;  2FFV A;  3PKP A;  1LZ0 A;  2YQC A;  2MZB A;  2VS3 A;  4LW3 A;  1O23 B;  1G3L A;  1IIN A;  3DUV A;  3IOJ A;  5CMH A;  2XME A;  4P02 A;  3SXC A;  5C4C A;  1H7T A;  1JYK A;  1VGZ A;  2Y4J A;  5CQL X;  2ICY A;  5DDV A;  4P00 A;  5DDT A;  3OH4 A;  4B42 A;  2A8U A;  1R7U A;  1VH3 A;  4B3U A;  3PKQ A;  3I0L A;  1VZX A;  1ZDF A;  3CKV A;  2AE7 A;  3ST8 A;  3SXD A;  1ZDG A;  3V8Z A;  3I0C A;  5FV9 A;  1G2V A;  5C3A A;  1FRW A;  2VXL A;  4B4G A;  2JCL A;  4Y64 A;  1H5S D;  1GX0 A;  1YP3 A;  2VS4 A;  3F1Y A;  1FZW A;  4ASJ A;  5C8R A;  1INI A;  1IIM A;  3U2U A;  3CKN A;  3CU0 A;  2Z86 A;  2YCM A;  1FO9 A;  3I0F A;  2Y6P A;  5C47 A;  4D11 A;  4JIS A;  2XWM A;  1PZT A;  5CQP A;  4AYJ A;  3ZF8 A;  1WT0 A;  5CQN X;  2YQS A;  1G9R A;  3TZT A;  2Y4M A;  2D7R A;  1R82 A;  1JV1 A;  1HM0 A;  4D0T A;  1XHB A;  1ZJ2 A;  1H4C A;  3POL A;  3ZGG A;  3D98 A;  1FGX A;  3Q4S A;  3U2V A;  4LW6 A;  2RIY A;  4Y6U A;  1O0R A;  2WE9 A;  4FRQ A;  1LVW A;  2FY7 A;  2WVM A;  1ZI5 A;  2GGQ A;  1R7V A;  1R7X A;  3QVB A;  2VD4 A;  1FG5 N;  2X5Z A;  4KPX A;  3V0P A;  1WSZ A;  5IFY A;  1HV9 A;  1OMX A;  2I5K A;  1MC3 A;  2PGV A;  4K6R A;  2E3D A;  3OH2 A;  1NQI B;  1ZJ0 A;  5FU8 A;  3SX7 A;  1XZ6 A;  1G95 A;  1FOA A;  3USQ A;  2WEE A;  4IRP A;  1QG8 A;  5CMJ A;  1H5S B;  1JYL A;  2X60 A;  2I7B A;  4GBP A;  4M2A A;  5FUH A;  4EVW A;  2AM4 A;  4HO2 A;  4DDZ A;  4G3S A;  2XWN A;  2PX7 A;  2W0V A;  2P6W A;  4EEG A;  1H7L A;  4XWI A;  3I0D A;  4FRL A;  1ZJP A;  3TQD A;  3O3P A;  3RMW A;  2WGZ A;  1HJJ A;  1HM8 A;  1QGS A;  4M28 A;  3SXE A;  4ECM A;  3SPT A;  4ARW A;  3T7N A;  4UEG A;  1TZF A;  4BMA A;  1H5T B;  5J49 A;  2Y7A A;  4HO5 A;  2RIX A;  2OEG A;  2OI5 A;  2V0K A;  5EJZ A;  2P72 A;  2W0W A;  1ZCT A;  1H5S C;  5L6V A;  1ZIZ A;  2AEC A;  3FWW A;  1H7F A;  4C2S A;  2VXM A;  2Z87 A;  2E8B A;  1V82 A;  2V0H A;  2X65 A;  3RSB A;  5AJN A;  5C4B A;  5C1L A;  4HO8 A;  1FR9 A;  1NF5 B;  5C48 A;  4NAK A;  1Z90 A;  4NAI A;  1EZI A;  1TVY A;  1V83 A;  1OQM B;  1QWJ A;  4FRP A;  1YRO B;  4DEC A;  2VSI A;  2RIT A;  5C4D A;  3FOQ A;  4KQL A;  1H5R B;  1G97 A;  3N9W A;  4R7P A;  2RJ0 A;  2RJ8 A;  1ZJO A;  1HJL A;  3OH3 A;  2I5E A;  4KC4 A;  3IOH A;  1OMZ A;  2QH5 A;  4FRH A;  2BO8 A;  1R7T A;  3CKO A;  1ZI3 A;  3OH1 A;  2ICX A;  3F1C A;  4FQW A;  2YES A;  4Y7T A;  1FR8 A;  5FYE A;  1GQC A;  1VPA A;  4D48 A;  3OC9 A;  4KPZ A;  1W77 A;  3SXA A;  5CMF X;  1G8O A;  5IDS A;  2AM3 A;  3D5N A;  4MND A;  2VFZ A;  4KC2 A;  4CJC A;  1ZCY A;  1WVC A;  2BO4 A;  4Y9X A;  1GA8 A;  2A8W A;  2XWL A;  1ZI1 A;  4HO9 A;  4B2W A;  2CU2 A;  4AC3 A;  3KIA A;  3NGW A;  4HG6 A;  4G87 A;  5AJP A;  1H7Q A;  1VGU A;  3I0K A;  3Q80 A;  5C4E A;  3CKJ A;  5I1F A;  2APC A;  1EYR A;  3HL3 A;  2Y4L A;  1H7G A;  4AYL A;  2VS5 A;  4FCE A;  4JD0 A;  2RJ4 A;  1W57 A;  3BRK X;  3V91 A;  4FRO A;  2GGO A;  4G3P A;  5C4F A;  4KXO A;  2D0J A;  1NKH B;  3D8V A;  3I0H A;  1YP4 A;  1TW1 A;  4NAL A;  4EEM A;  2RJ9 A;  1MP5 A;  3DK5 A;  4KC1 A;  1H7H A;  5C1H A;  4HOC A;  1G23 A;  4Y7F A;  3V0Q A;  4B5B A;  2WVL A;  2O1H A;  4M4K A;  1MP4 A;  2O1G A;  2RJ5 A;  2Q4J A;  2QGI A;  2FFU A;  5FTV A;  1LL3 A;  5C3B A;  5CMG X;  4AAW A;  3OKR A;  2D7I A;  2JCO A;  2JCK A;  4Y62 A;  3U2T A;  3ZGF A;  1E5K A;  3JTJ A;  3K8D A;  3USR A;  2O1F A;  1LL0 A;  3BCV A;  3SX8 A;  4Y7G A;  2RIZ A;  1ZHJ A;  4DE7 A;  5IDT A;  1ZJ1 A;  1TW5 A;  2AM5 A;  2FYA A; 
#chains in the Genus database with same CATH topology
 4Y6N A;  1V84 A;  1G93 A;  3ZLK A;  1R7Y A;  2BO7 A;  2V0L A;  3EE5 A;  3ZLL A;  1YP2 A;  5CQO A;  5L6S A;  2YQJ A;  1ZCV A;  5CQM X;  4L41 C;  1FXO A;  3SX5 A;  3I0G A;  1ZI4 A;  3OH0 A;  5EIY A;  2NXV A;  1FXJ A;  1GWW A;  3PNN A;  4CVH A;  5C36 A;  2FYD B;  5BXC A;  1H5S A;  3IOI A;  3JUJ A;  3SXB A;  1ZJ3 A;  1JV3 A;  2OI6 A;  2X5S A;  1O7Q A;  3U2W A;  2RJ1 A;  4FRM A;  5C1G A;  1MP3 A;  1WT1 A;  3SX3 A;  5C49 A;  2ZU8 A;  1ON6 A;  1R80 A;  3U0X A;  4O6N A;  3CGX A;  3GUE A;  3JUK A;  5FU0 A;  3DJ4 A;  4HCQ A;  1H4D A;  1KWS A;  4FRB A;  4NAN A;  5CMI A;  4D11 C;  3T7O A;  4ASY A;  1LZI A;  4Y7V A;  5FTS A;  1JVD A;  1VGW A;  2Y4K A;  4FCU A;  1GX4 A;  4B4B A;  4IRQ A;  1INJ A;  1H7E A;  1VIC A;  2QKX A;  4Y7U A;  4B2X A;  1H5T A;  3CKQ A;  1GQ9 A;  5D92 A;  1SS9 A;  3U0Y A;  2AH9 A;  1R81 A;  3R2W A;  2J0B A;  2BO6 A;  1VGT A;  1H3M A;  2XMH A;  4FIY A;  1VZU A;  2WAW A;  2YC3 A;  3E26 A;  1WT2 A;  4BQH A;  1K4V A;  3K8E A;  4CJB A;  1JVG A;  5HS2 A;  2VK9 A;  2PGY A;  1NHE B;  2WVK A;  2FYB A;  4HO0 A;  2JCJ A;  4EE3 A;  3I0J A;  5C38 A;  3OGZ A;  3V0L A;  3SXG A;  4MYB A;  2AGD A;  4KRV A;  3LW6 A;  1QGQ A;  1FWY A;  1LZ7 A;  3V90 A;  4KNX A;  2P73 A;  2RJ7 A;  1G1L A;  2OEF A;  4B4M A;  1FO8 A;  2YQH A;  4J18 A;  3V8Y A;  1NMM B;  4ZDQ A;  1H5R A;  4M2B A;  1W55 A;  1LZJ A;  3I0I X;  1S4O A;  1PZY B;  4KNR A;  1O7O A;  4FIX A;  4EE4 A;  1NWG B;  1VM8 A;  2AES A;  3I0E A;  1S4P A;  5AJO A;  1S4N A;  1VZT A;  4G3Q A;  1LL2 A;  3V0N A;  3E25 A;  5C3D A;  5EJ1 A;  4EEA A;  3R3I A;  2RJ6 A;  3RMV A;  4EEO A;  2UX8 A;  4HO3 A;  3U2X A;  3V0O A;  4FRD A;  5JQQ A;  2DPW A;  4FRA A;  4HO4 A;  3OAM A;  2VSH A;  4Y63 A;  1ZCU A;  3T7M A;  2FYC B;  2V0I A;  3Q7U A;  3V0M A;  4EE5 A;  2ZU7 A;  4HO6 A;  2V0J A;  4D0Z A;  2PA4 A;  4CJ8 A;  2YC5 A;  1H4E A;  1FGG A;  1G0R A;  2OI7 A;  1WT3 A;  1HM9 A;  1I52 A;  2ZU9 A;  4KT7 A;  1VH1 A;  4YS8 A;  1GWV A;  4FRE A;  4E1K A;  1ON8 A;  2FFV A;  3PKP A;  1LZ0 A;  2YQC A;  2MZB A;  2VS3 A;  4LW3 A;  1O23 B;  1G3L A;  1IIN A;  3DUV A;  3IOJ A;  5CMH A;  2XME A;  4P02 A;  3SXC A;  5C4C A;  1H7T A;  1JYK A;  1VGZ A;  2Y4J A;  5CQL X;  2ICY A;  5DDV A;  4P00 A;  5DDT A;  3OH4 A;  4B42 A;  2A8U A;  1R7U A;  1VH3 A;  4B3U A;  3PKQ A;  3I0L A;  1VZX A;  1ZDF A;  3CKV A;  2AE7 A;  3ST8 A;  3SXD A;  1ZDG A;  3V8Z A;  3I0C A;  5FV9 A;  1G2V A;  5C3A A;  1FRW A;  2VXL A;  4B4G A;  2JCL A;  4Y64 A;  1H5S D;  1GX0 A;  1YP3 A;  2VS4 A;  3F1Y A;  1FZW A;  4ASJ A;  5C8R A;  1INI A;  1IIM A;  3U2U A;  3CKN A;  3CU0 A;  2Z86 A;  2YCM A;  1FO9 A;  3I0F A;  2Y6P A;  5C47 A;  4D11 A;  4JIS A;  2XWM A;  1PZT A;  5CQP A;  4AYJ A;  3ZF8 A;  1WT0 A;  5CQN X;  2YQS A;  1G9R A;  3TZT A;  2Y4M A;  2D7R A;  1R82 A;  1JV1 A;  1HM0 A;  4D0T A;  1XHB A;  1ZJ2 A;  1H4C A;  3POL A;  3ZGG A;  3D98 A;  1FGX A;  3Q4S A;  3U2V A;  4LW6 A;  2RIY A;  4Y6U A;  1O0R A;  2WE9 A;  4FRQ A;  1LVW A;  2FY7 A;  2WVM A;  1ZI5 A;  2GGQ A;  1R7V A;  1R7X A;  3QVB A;  2VD4 A;  1FG5 N;  2X5Z A;  4KPX A;  3V0P A;  1WSZ A;  5IFY A;  1HV9 A;  1OMX A;  2I5K A;  1MC3 A;  2PGV A;  4K6R A;  2E3D A;  3OH2 A;  1NQI B;  1ZJ0 A;  5FU8 A;  3SX7 A;  1XZ6 A;  1G95 A;  1FOA A;  3USQ A;  2WEE A;  4IRP A;  1QG8 A;  5CMJ A;  1H5S B;  1JYL A;  2X60 A;  2I7B A;  4GBP A;  4M2A A;  5FUH A;  4EVW A;  2AM4 A;  4HO2 A;  4MIX A;  4DDZ A;  4G3S A;  2XWN A;  2PX7 A;  2W0V A;  2P6W A;  4EEG A;  1H7L A;  4XWI A;  3I0D A;  4FRL A;  5D91 A;  1ZJP A;  3TQD A;  3O3P A;  3RMW A;  2WGZ A;  2J0A A;  1HJJ A;  1HM8 A;  1QGS A;  4M28 A;  3SXE A;  4ECM A;  3SPT A;  4ARW A;  3T7N A;  4UEG A;  1TZF A;  4BMA A;  1H5T B;  5J49 A;  2Y7A A;  4HO5 A;  2RIX A;  2OEG A;  2OI5 A;  2V0K A;  5EJZ A;  2P72 A;  2W0W A;  1ZCT A;  1H5S C;  5L6V A;  2C0N A;  1ZIZ A;  2AEC A;  3FWW A;  1H7F A;  4C2S A;  2VXM A;  2Z87 A;  2E8B A;  1V82 A;  2V0H A;  2X65 A;  3RSB A;  5AJN A;  5C4B A;  5C1L A;  4HO8 A;  1FR9 A;  1NF5 B;  5C48 A;  4NAK A;  1Z90 A;  4NAI A;  1EZI A;  1TVY A;  1V83 A;  1OQM B;  1QWJ A;  4FRP A;  1YRO B;  4DEC A;  2VSI A;  2RIT A;  5C4D A;  3FOQ A;  4KQL A;  1H5R B;  1G97 A;  3N9W A;  4R7P A;  2RJ0 A;  2RJ8 A;  1ZJO A;  1HJL A;  3OH3 A;  2I5E A;  4KC4 A;  3IOH A;  1OMZ A;  2QH5 A;  4FRH A;  2BO8 A;  1R7T A;  3CKO A;  1ZI3 A;  3OH1 A;  2ICX A;  3F1C A;  4FQW A;  2YES A;  4Y7T A;  4O6M A;  1FR8 A;  5FYE A;  1GQC A;  1VPA A;  4D48 A;  3OC9 A;  4KPZ A;  1W77 A;  3SXA A;  5CMF X;  1G8O A;  5IDS A;  2AM3 A;  3D5N A;  4MND A;  2VFZ A;  4KC2 A;  4CJC A;  1ZCY A;  1WVC A;  2BO4 A;  4Y9X A;  1GA8 A;  2A8W A;  2XWL A;  1ZI1 A;  4HO9 A;  4B2W A;  2CU2 A;  4AC3 A;  3KIA A;  3NGW A;  4HG6 A;  4G87 A;  5AJP A;  1H7Q A;  1VGU A;  3I0K A;  3Q80 A;  5C4E A;  3CKJ A;  5I1F A;  2APC A;  1EYR A;  3HL3 A;  2Y4L A;  1H7G A;  4AYL A;  2VS5 A;  4FCE A;  4JD0 A;  2RJ4 A;  1W57 A;  3BRK X;  3V91 A;  4FRO A;  2GGO A;  4G3P A;  5C4F A;  4KXO A;  2D0J A;  1NKH B;  3D8V A;  3I0H A;  1YP4 A;  1TW1 A;  4NAL A;  4EEM A;  2RJ9 A;  1MP5 A;  3DK5 A;  4KC1 A;  1H7H A;  5C1H A;  4HOC A;  1G23 A;  4Y7F A;  3V0Q A;  4B5B A;  2WVL A;  2O1H A;  4M4K A;  4Q7C A;  1MP4 A;  2O1G A;  2RJ5 A;  2Q4J A;  2QGI A;  2FFU A;  5FTV A;  1LL3 A;  5C3B A;  5CMG X;  4AAW A;  3OKR A;  2D7I A;  2JCO A;  2JCK A;  4Y62 A;  3U2T A;  3ZGF A;  1E5K A;  3JTJ A;  3K8D A;  3USR A;  2O1F A;  1LL0 A;  3BCV A;  3SX8 A;  4Y7G A;  2RIZ A;  1ZHJ A;  4DE7 A;  5IDT A;  1ZJ1 A;  1TW5 A;  2AM5 A;  2FYA A; 
#chains in the Genus database with same CATH homology
 4Y6N A;  1V84 A;  1G93 A;  3ZLK A;  1R7Y A;  2BO7 A;  2V0L A;  3EE5 A;  3ZLL A;  1YP2 A;  5CQO A;  5L6S A;  2YQJ A;  1ZCV A;  5CQM X;  4L41 C;  1FXO A;  3SX5 A;  3I0G A;  1ZI4 A;  3OH0 A;  5EIY A;  2NXV A;  1FXJ A;  1GWW A;  3PNN A;  4CVH A;  5C36 A;  2FYD B;  5BXC A;  1H5S A;  3IOI A;  3JUJ A;  3SXB A;  1ZJ3 A;  1JV3 A;  2OI6 A;  2X5S A;  1O7Q A;  3U2W A;  2RJ1 A;  4FRM A;  5C1G A;  1MP3 A;  1WT1 A;  3SX3 A;  5C49 A;  2ZU8 A;  1ON6 A;  1R80 A;  3U0X A;  4O6N A;  3CGX A;  3GUE A;  3JUK A;  5FU0 A;  3DJ4 A;  4HCQ A;  1H4D A;  1KWS A;  4FRB A;  4NAN A;  5CMI A;  4D11 C;  3T7O A;  4ASY A;  1LZI A;  4Y7V A;  5FTS A;  1JVD A;  1VGW A;  2Y4K A;  4FCU A;  1GX4 A;  4B4B A;  4IRQ A;  1INJ A;  1H7E A;  1VIC A;  2QKX A;  4Y7U A;  4B2X A;  1H5T A;  3CKQ A;  1GQ9 A;  5D92 A;  1SS9 A;  3U0Y A;  2AH9 A;  1R81 A;  3R2W A;  2J0B A;  2BO6 A;  1VGT A;  1H3M A;  2XMH A;  4FIY A;  1VZU A;  2WAW A;  2YC3 A;  3E26 A;  1WT2 A;  4BQH A;  1K4V A;  3K8E A;  4CJB A;  1JVG A;  5HS2 A;  2VK9 A;  2PGY A;  1NHE B;  2WVK A;  2FYB A;  4HO0 A;  2JCJ A;  4EE3 A;  3I0J A;  5C38 A;  3OGZ A;  3V0L A;  3SXG A;  4MYB A;  2AGD A;  4KRV A;  3LW6 A;  1QGQ A;  1FWY A;  1LZ7 A;  3V90 A;  4KNX A;  2P73 A;  2RJ7 A;  1G1L A;  2OEF A;  4B4M A;  1FO8 A;  2YQH A;  4J18 A;  3V8Y A;  1NMM B;  4ZDQ A;  1H5R A;  4M2B A;  1W55 A;  1LZJ A;  3I0I X;  1S4O A;  1PZY B;  4KNR A;  1O7O A;  4FIX A;  4EE4 A;  1NWG B;  1VM8 A;  2AES A;  3I0E A;  1S4P A;  5AJO A;  1S4N A;  1VZT A;  4G3Q A;  1LL2 A;  3V0N A;  3E25 A;  5C3D A;  5EJ1 A;  4EEA A;  3R3I A;  2RJ6 A;  3RMV A;  4EEO A;  2UX8 A;  4HO3 A;  3U2X A;  3V0O A;  4FRD A;  5JQQ A;  2DPW A;  4FRA A;  4HO4 A;  3OAM A;  2VSH A;  4Y63 A;  1ZCU A;  3T7M A;  2FYC B;  2V0I A;  3Q7U A;  3V0M A;  4EE5 A;  2ZU7 A;  4HO6 A;  2V0J A;  4D0Z A;  2PA4 A;  4CJ8 A;  2YC5 A;  1H4E A;  1FGG A;  1G0R A;  2OI7 A;  1WT3 A;  1HM9 A;  1I52 A;  2ZU9 A;  4KT7 A;  1VH1 A;  4YS8 A;  1GWV A;  4FRE A;  4E1K A;  1ON8 A;  2FFV A;  3PKP A;  1LZ0 A;  2YQC A;  2MZB A;  2VS3 A;  4LW3 A;  1O23 B;  1G3L A;  1IIN A;  3DUV A;  3IOJ A;  5CMH A;  2XME A;  4P02 A;  3SXC A;  5C4C A;  1H7T A;  1JYK A;  1VGZ A;  2Y4J A;  5CQL X;  2ICY A;  5DDV A;  4P00 A;  5DDT A;  3OH4 A;  4B42 A;  2A8U A;  1R7U A;  1VH3 A;  4B3U A;  3PKQ A;  3I0L A;  1VZX A;  1ZDF A;  3CKV A;  2AE7 A;  3ST8 A;  3SXD A;  1ZDG A;  3V8Z A;  3I0C A;  5FV9 A;  1G2V A;  5C3A A;  1FRW A;  2VXL A;  4B4G A;  2JCL A;  4Y64 A;  1H5S D;  1GX0 A;  1YP3 A;  2VS4 A;  3F1Y A;  1FZW A;  4ASJ A;  5C8R A;  1INI A;  1IIM A;  3U2U A;  3CKN A;  3CU0 A;  2Z86 A;  2YCM A;  1FO9 A;  3I0F A;  2Y6P A;  5C47 A;  4D11 A;  4JIS A;  2XWM A;  1PZT A;  5CQP A;  4AYJ A;  3ZF8 A;  1WT0 A;  5CQN X;  2YQS A;  1G9R A;  3TZT A;  2Y4M A;  2D7R A;  1R82 A;  1JV1 A;  1HM0 A;  4D0T A;  1XHB A;  1ZJ2 A;  1H4C A;  3POL A;  3ZGG A;  3D98 A;  1FGX A;  3Q4S A;  3U2V A;  4LW6 A;  2RIY A;  4Y6U A;  1O0R A;  2WE9 A;  4FRQ A;  1LVW A;  2FY7 A;  2WVM A;  1ZI5 A;  2GGQ A;  1R7V A;  1R7X A;  3QVB A;  2VD4 A;  1FG5 N;  2X5Z A;  4KPX A;  3V0P A;  1WSZ A;  5IFY A;  1HV9 A;  1OMX A;  2I5K A;  1MC3 A;  2PGV A;  4K6R A;  2E3D A;  3OH2 A;  1NQI B;  1ZJ0 A;  5FU8 A;  3SX7 A;  1XZ6 A;  1G95 A;  1FOA A;  3USQ A;  2WEE A;  4IRP A;  1QG8 A;  5CMJ A;  1H5S B;  1JYL A;  2X60 A;  2I7B A;  4GBP A;  4M2A A;  5FUH A;  4EVW A;  2AM4 A;  4HO2 A;  4MIX A;  4DDZ A;  4G3S A;  2XWN A;  2PX7 A;  2W0V A;  2P6W A;  4EEG A;  1H7L A;  4XWI A;  3I0D A;  4FRL A;  5D91 A;  1ZJP A;  3TQD A;  3O3P A;  3RMW A;  2WGZ A;  2J0A A;  1HJJ A;  1HM8 A;  1QGS A;  4M28 A;  3SXE A;  4ECM A;  3SPT A;  4ARW A;  3T7N A;  4UEG A;  1TZF A;  4BMA A;  1H5T B;  5J49 A;  2Y7A A;  4HO5 A;  2RIX A;  2OEG A;  2OI5 A;  2V0K A;  5EJZ A;  2P72 A;  2W0W A;  1ZCT A;  1H5S C;  5L6V A;  2C0N A;  1ZIZ A;  2AEC A;  3FWW A;  1H7F A;  4C2S A;  2VXM A;  2Z87 A;  2E8B A;  1V82 A;  2V0H A;  2X65 A;  3RSB A;  5AJN A;  5C4B A;  5C1L A;  4HO8 A;  1FR9 A;  1NF5 B;  5C48 A;  4NAK A;  1Z90 A;  4NAI A;  1EZI A;  1TVY A;  1V83 A;  1OQM B;  1QWJ A;  4FRP A;  1YRO B;  4DEC A;  2VSI A;  2RIT A;  5C4D A;  3FOQ A;  4KQL A;  1H5R B;  1G97 A;  3N9W A;  4R7P A;  2RJ0 A;  2RJ8 A;  1ZJO A;  1HJL A;  3OH3 A;  2I5E A;  4KC4 A;  3IOH A;  1OMZ A;  2QH5 A;  4FRH A;  2BO8 A;  1R7T A;  3CKO A;  1ZI3 A;  3OH1 A;  2ICX A;  3F1C A;  4FQW A;  2YES A;  4Y7T A;  4O6M A;  1FR8 A;  5FYE A;  1GQC A;  1VPA A;  4D48 A;  3OC9 A;  4KPZ A;  1W77 A;  3SXA A;  5CMF X;  1G8O A;  5IDS A;  2AM3 A;  3D5N A;  4MND A;  2VFZ A;  4KC2 A;  4CJC A;  1ZCY A;  1WVC A;  2BO4 A;  4Y9X A;  1GA8 A;  2A8W A;  2XWL A;  1ZI1 A;  4HO9 A;  4B2W A;  2CU2 A;  4AC3 A;  3KIA A;  3NGW A;  4HG6 A;  4G87 A;  5AJP A;  1H7Q A;  1VGU A;  3I0K A;  3Q80 A;  5C4E A;  3CKJ A;  5I1F A;  2APC A;  1EYR A;  3HL3 A;  2Y4L A;  1H7G A;  4AYL A;  2VS5 A;  4FCE A;  4JD0 A;  2RJ4 A;  1W57 A;  3BRK X;  3V91 A;  4FRO A;  2GGO A;  4G3P A;  5C4F A;  4KXO A;  2D0J A;  1NKH B;  3D8V A;  3I0H A;  1YP4 A;  1TW1 A;  4NAL A;  4EEM A;  2RJ9 A;  1MP5 A;  3DK5 A;  4KC1 A;  1H7H A;  5C1H A;  4HOC A;  1G23 A;  4Y7F A;  3V0Q A;  4B5B A;  2WVL A;  2O1H A;  4M4K A;  4Q7C A;  1MP4 A;  2O1G A;  2RJ5 A;  2Q4J A;  2QGI A;  2FFU A;  5FTV A;  1LL3 A;  5C3B A;  5CMG X;  4AAW A;  3OKR A;  2D7I A;  2JCO A;  2JCK A;  4Y62 A;  3U2T A;  3ZGF A;  1E5K A;  3JTJ A;  3K8D A;  3USR A;  2O1F A;  1LL0 A;  3BCV A;  3SX8 A;  4Y7G A;  2RIZ A;  1ZHJ A;  4DE7 A;  5IDT A;  1ZJ1 A;  1TW5 A;  2AM5 A;  2FYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...