4KC4A

Structure of the blood group glycosyltransferase aaglyb in complex with a pyridine inhibitor as a neutral pyrophosphate surrogate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
289
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of glycosyltransferase inhibitors: pyridine as a pyrophosphate surrogate.
pubmed doi rcsb
molecule keywords Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 99
structure length 289
sequence length 289
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kc4A00
1ZJOA 1XZ6A 4FQWA 1O7QA 4G3PA 1QWJA 1PZYB 3OH1A 3SXEA 2Y4LA 4KT7A 4LW6A 5C38A 5BXCA 5FUHA 2FFVA 3ST8A 2ICXA 2YESA 1HJLA 3U2VA 4AC3A 1E5KA 4FRAA 1O0RA 4D11A 3ZF8A 2AM5A 2FYCB 1VGZA 2AE7A 5FU8A 3I0HA 4AAWA 4Y7GA 1WT2A 5FV9A 3JUJA 5FYEA 1ON8A 4D0ZA 1ZJ3A 5HS2A 2VS3A 2CU2A 4P02A 4UEGA 4L41C 2RJ1A 2WVMA 3EE5A 3SX5A 4D0TA 3T7OA 1ZDGA 3K8DA 1LL3A 5DDVA 1JV1A 1FO9A 4LW3A 1LL2A 1R7YA 2QGIA 2V0KA 1S4OA 3RMWA 1R80A 3OC9A 1W57A 3Q4SA 2UX8A 2FYBA 3CGXA 4FRLA 5I1FA 5L6VA 4CJCA 3OH2A 5AJPA 2FYAA 4B42A 1FRWA 5CQOA 1G23A 3D5NA 1EYRA 2I5KA 2A8WA 2V0JA 2X5SA 3U0XA 1G9RA 3ZLLA 4Y7FA 2RIXA 5FU0A 1W77A 1H7HA 3RSBA 5J49A 5C4FA 4HO9A 3POLA 4EEAA 2OI6A 2XWLA 4B3UA 2W0WA 4FRPA 4ASYA 3CU0A 4GBPA 1ZCVA 1GQ9A 3SXBA 3U2TA 1ZJ0A 5C3AA 4EE3A 4FCEA 2ZU9A 5CMJA 1H4CA 4MYBA 3SX3A 1TW5A 1HM8A 4HOCA 4B2WA 2VS5A 2VD4A 3CKJA 3OGZA 4HG6A 3N9WA 4KC4A 2Y4JA 5CQMX 4CJBA 3OH3A 3ZGFA 4KXOA 4HCQA 1W55A 3TZTA 2W0VA 1FO8A 1VICA 3SPTA 2YQCA 3ZLKA 1MC3A 4NAKA 5C1LA 4HO4A 5L6SA 1G0RA 1R7UA 1XHBA 5CMFX 4FRMA 2P73A 4EEMA 3SX7A 4KNRA 4KPZA 3SXDA 3I0KA 3PKQA 4HO5A 4NANA 3T7NA 2MZBA 5FTSA 4DE7A 5EJZA 1ZCUA 2WAWA 3R2WA 1MP3A 1G1LA 5AJNA 1O23B 4FRDA 5CMHA 1LZIA 4HO0A 2AM4A 3FWWA 1JVDA 4AYLA 1GWWA 1HJJA 3V0OA 3FOQA 5CQLX 1ZI3A 2Y4KA 3LW6A 1JVGA 1ZI4A 2VSIA 1G93A 4J18A 3DJ4A 4EE4A 3E25A 3OH0A 4C2SA 4FREA 5FTVA 4ECMA 1H5SB 1H5TB 3V0NA 5IDTA 4Y64A 2AGDA 3O3PA 1VM8A 3USRA 5DDTA 1OQMB 1H5RA 1R7TA 4B4BA 3I0EA 2Y6PA 1H7QA 4P00A 3JTJA 1MP5A 4FRHA 1WT1A 3ZGGA 1VGUA 4IRPA 4B5BA 4DDZA 3SXAA 5C4EA 3V0PA 2Z87A 3I0IX 2AH9A 2RJ8A 1HM9A 2I7BA 2BO8A 3D8VA 3DK5A 4M28A 2Z86A 5CMIA 3SXCA 5C48A 4Y9XA 4G3QA 3OAMA 5IFYA 1PZTA 1NF5B 3CKNA 1TVYA 1R82A 1Z90A 5C4DA 1OMZA 3F1CA 2XMEA 1GWVA 2P6WA 2JCKA 3V8YA 1V83A 4NALA 3K8EA 4ASJA 4KNXA 1NHEB 4K6RA 1H5RB 1JV3A 1H7LA 1GA8A 1QGSA 1IINA 3IOHA 2OEGA 1NKHB 2DPWA 3CKQA 4KPXA 3V0MA 4G87A 3PNNA 4M2AA 1TW1A 4R7PA 2D7IA 1WT0A 1ZJ2A 4Y7TA 1H5SC 3E26A 3CKVA 1FXJA 1WT3A 5C47A 3I0GA 5C3DA 1H7GA 2O1FA 1G95A 2V0IA 3I0DA 4M2BA 4Y7VA 3NGWA 3I0JA 4BMAA 1H5SA 1H5TA 1LZ0A 2YQSA 2D7RA 2FY7A 2YC3A 4EEGA 1IIMA 1QG8A 1FWYA 3V8ZA 5C4CA 4FRQA 5C8RA 3U2UA 3U2WA 3TQDA 3T7MA 1VZUA 2XMHA 3F1YA 2RJ4A 2X65A 3V91A 4BQHA 3KIAA 2BO7A 3Q80A 5EJ1A 1G3LA 2AECA 1O7OA 4YS8A 1JYLA 2ICYA 2RIYA 3I0LA 2ZU7A 2X60A 3HL3A 1ZJ1A 1OMXA 3V0LA 4DECA 1FR9A 1ZHJA 3PKPA 2Q4JA 1H7FA 3CKOA 1NQIB 2E3DA 2ZU8A 1R81A 1WVCA 2BO6A 4AYJA 2VSHA 2PX7A 4IRQA 4EE5A 1YP4A 4JD0A 1INIA 3IOJA 1S4NA 1WSZA 4D11C 4EVWA 2X5ZA 3JUKA 1ON6A 2V0LA 1YP2A 5IDSA 2GGQA 4KC2A 3R3IA 1R7XA 1H5SD 4FRBA 5C4BA 2YQJA 2YQHA 1FZWA 1TZFA 4XWIA 2RJ5A 5CQNX 4MNDA 2WEEA 4D48A 5CMGX 3U0YA 2FFUA 3I0FA 4FROA 1ZCTA 2QKXA 3DUVA 5C49A 1GX0A 4CVHA 1VH3A 4KC1A 3SX8A 2QH5A 1H7TA 1NWGB 1VZTA 4FCUA 3OKRA 4G3SA 1G97A 1ZCYA 4ZDQA 1SS9A 5AJOA 1GX4A 2OEFA 1LVWA 2APCA 1YROB 1VGTA 4B4MA 5EIYA 2VS4A 1LZJA 2AESA 3Q7UA 3QVBA 2YC5A 2GGOA 2PA4A 3USQA 1FR8A 1NMMB 2O1HA 2XWNA 2JCJA 4HO8A 2RITA 5C1HA 2PGYA 3BCVA 2A8UA 2E8BA 3I0CA 1I52A 5JQQA 1G8OA 1KWSA 4KQLA 4Y6NA 1EZIA 2NXVA 4HO3A 1R7VA 1VGWA 1H4EA 2VXLA 3OH4A 1FG5N 1VZXA 4M4KA 2WVKA 1ZI5A 2RJ7A 4Y7UA 1VPAA 4HO6A 2PGVA 4B4GA 2AM3A 1V84A 2WGZA 1VH1A 5CQPA 3GUEA 1H3MA 1G2VA 1MP4A 2RIZA 4HO2A 2O1GA 4CJ8A 1HM0A 1YP3A 2OI7A 3RMVA 4JISA 1ZJPA 4E1KA 3U2XA 1LZ7A 1H7EA 1GQCA 5C36A 2WVLA 1H4DA 1FXOA 2P72A 4Y6UA 1V82A 3BRKX 1ZI1A 1FOAA 2YCMA 2BO4A 2VFZA 4EEOA 4ARWA 1LL0A 2V0HA 2RJ6A 5C1GA 3V90A 1ZIZA 3SXGA 2Y4MA 3D98A 2VXMA 4KRVA 1ZDFA 2WE9A 2I5EA 1JYKA 2JCLA 4B2XA 2JCOA 4NAIA 2XWMA 1K4VA 2Y7AA 1S4PA 1HV9A 1INJA 4Y62A 2FYDB 3V0QA 1FGXA 1QGQA 2RJ0A 2OI5A 2RJ9A 2D0JA 5C3BA 1FGGA 4Y63A 3IOIA
chains in the Genus database with same CATH superfamily
1ZJOA 1XZ6A 4FQWA 1O7QA 4G3PA 1QWJA 1PZYB 3OH1A 3SXEA 2Y4LA 4KT7A 4LW6A 5C38A 5BXCA 5FUHA 2FFVA 3ST8A 2ICXA 2YESA 1HJLA 3U2VA 4AC3A 1E5KA 4FRAA 1O0RA 4D11A 3ZF8A 2AM5A 2FYCB 4MIXA 1VGZA 2AE7A 2VK9A 5FU8A 3I0HA 4AAWA 4Y7GA 1WT2A 5FV9A 3JUJA 5FYEA 1ON8A 4D0ZA 1ZJ3A 5HS2A 2VS3A 2CU2A 4P02A 4UEGA 4L41C 2RJ1A 2WVMA 3EE5A 3SX5A 4D0TA 3T7OA 1ZDGA 3K8DA 1LL3A 5DDVA 1JV1A 1FO9A 4LW3A 1LL2A 1R7YA 2QGIA 2V0KA 1S4OA 3RMWA 1R80A 3OC9A 1W57A 3Q4SA 2UX8A 2FYBA 3CGXA 4FRLA 5I1FA 5L6VA 4CJCA 3OH2A 5AJPA 2FYAA 4B42A 1FRWA 5CQOA 1G23A 3D5NA 1EYRA 2I5KA 2A8WA 2V0JA 4O6NA 2X5SA 3U0XA 1G9RA 3ZLLA 4Y7FA 2RIXA 5FU0A 1W77A 1H7HA 3RSBA 5J49A 5C4FA 4HO9A 3POLA 4EEAA 2OI6A 2XWLA 4B3UA 2W0WA 4FRPA 4ASYA 3CU0A 4GBPA 1ZCVA 1GQ9A 3SXBA 3U2TA 5D92A 1ZJ0A 5C3AA 4EE3A 4FCEA 2ZU9A 5CMJA 1H4CA 4MYBA 3SX3A 1TW5A 1HM8A 4HOCA 4B2WA 2VS5A 2VD4A 3CKJA 3OGZA 4HG6A 3N9WA 4KC4A 2Y4JA 5CQMX 4CJBA 3OH3A 3ZGFA 4KXOA 4HCQA 1W55A 3TZTA 4FIXA 2W0VA 1FO8A 1VICA 3SPTA 2YQCA 3ZLKA 1MC3A 4NAKA 5C1LA 2J0BA 4HO4A 5L6SA 2C0NA 1G0RA 1R7UA 1XHBA 5CMFX 4FRMA 2P73A 4EEMA 3SX7A 4KNRA 4KPZA 3SXDA 3I0KA 3PKQA 4HO5A 4NANA 3T7NA 2MZBA 5FTSA 4DE7A 5EJZA 1ZCUA 2WAWA 3R2WA 1MP3A 1G1LA 5AJNA 1O23B 4FRDA 5CMHA 1LZIA 4HO0A 2AM4A 3FWWA 1JVDA 4AYLA 1GWWA 1HJJA 3V0OA 3FOQA 5CQLX 1ZI3A 2Y4KA 3LW6A 1JVGA 1ZI4A 2VSIA 1G93A 4J18A 3DJ4A 4EE4A 3E25A 3OH0A 4C2SA 4FREA 5FTVA 4ECMA 1H5SB 1H5TB 3V0NA 5IDTA 4Y64A 2AGDA 3O3PA 1VM8A 3USRA 5DDTA 1OQMB 1H5RA 1R7TA 4B4BA 3I0EA 2Y6PA 1H7QA 4P00A 3JTJA 1MP5A 4FRHA 1WT1A 3ZGGA 1VGUA 4IRPA 4B5BA 4DDZA 3SXAA 5C4EA 3V0PA 2Z87A 3I0IX 2AH9A 2RJ8A 1HM9A 2I7BA 2BO8A 3D8VA 3DK5A 4M28A 2Z86A 5CMIA 3SXCA 5C48A 4Y9XA 4G3QA 3OAMA 5IFYA 1PZTA 1NF5B 3CKNA 1TVYA 1R82A 1Z90A 5C4DA 1OMZA 3F1CA 2XMEA 1GWVA 2P6WA 2JCKA 3V8YA 1V83A 4NALA 3K8EA 4ASJA 4KNXA 1NHEB 4K6RA 1H5RB 1JV3A 1H7LA 1GA8A 1QGSA 1IINA 3IOHA 2OEGA 1NKHB 2DPWA 3CKQA 4KPXA 3V0MA 4G87A 3PNNA 4M2AA 1TW1A 4R7PA 2J0AA 2D7IA 1WT0A 1ZJ2A 4Y7TA 1H5SC 3E26A 3CKVA 1FXJA 1WT3A 5C47A 3I0GA 5C3DA 1H7GA 2O1FA 1G95A 2V0IA 3I0DA 4M2BA 4FIYA 4Y7VA 3NGWA 3I0JA 4BMAA 1H5SA 1H5TA 1LZ0A 2YQSA 2D7RA 2FY7A 2YC3A 4Q7CA 4EEGA 1IIMA 1QG8A 1FWYA 3V8ZA 5C4CA 4FRQA 5C8RA 3U2UA 3U2WA 3TQDA 3T7MA 1VZUA 2XMHA 3F1YA 2RJ4A 2X65A 3V91A 4BQHA 3KIAA 2BO7A 3Q80A 5EJ1A 1G3LA 2AECA 1O7OA 4YS8A 1JYLA 2ICYA 2RIYA 3I0LA 2ZU7A 2X60A 3HL3A 1ZJ1A 1OMXA 3V0LA 4DECA 1FR9A 1ZHJA 3PKPA 2Q4JA 1H7FA 3CKOA 1NQIB 2E3DA 2ZU8A 1R81A 1WVCA 2BO6A 4AYJA 2VSHA 2PX7A 4IRQA 4EE5A 1YP4A 4JD0A 1INIA 3IOJA 1S4NA 1WSZA 4D11C 4EVWA 2X5ZA 5D91A 3JUKA 1ON6A 2V0LA 1YP2A 5IDSA 2GGQA 4KC2A 3R3IA 1R7XA 1H5SD 4FRBA 5C4BA 2YQJA 2YQHA 1FZWA 1TZFA 4XWIA 2RJ5A 5CQNX 4MNDA 2WEEA 4D48A 5CMGX 3U0YA 2FFUA 3I0FA 4FROA 1ZCTA 2QKXA 3DUVA 5C49A 1GX0A 4CVHA 1VH3A 4KC1A 3SX8A 2QH5A 1H7TA 1NWGB 1VZTA 4FCUA 3OKRA 4G3SA 1G97A 1ZCYA 4ZDQA 1SS9A 5AJOA 1GX4A 2OEFA 1LVWA 2APCA 1YROB 1VGTA 4B4MA 5EIYA 2VS4A 1LZJA 2AESA 3Q7UA 3QVBA 2YC5A 2GGOA 2PA4A 3USQA 1FR8A 1NMMB 2O1HA 2XWNA 2JCJA 4HO8A 4O6MA 2RITA 5C1HA 2PGYA 3BCVA 2A8UA 2E8BA 3I0CA 1I52A 5JQQA 1G8OA 1KWSA 4KQLA 4Y6NA 1EZIA 2NXVA 4HO3A 1R7VA 1VGWA 1H4EA 2VXLA 3OH4A 1FG5N 1VZXA 4M4KA 2WVKA 1ZI5A 2RJ7A 4Y7UA 1VPAA 4HO6A 2PGVA 4B4GA 2AM3A 1V84A 2WGZA 1VH1A 5CQPA 3GUEA 1H3MA 1G2VA 1MP4A 2RIZA 4HO2A 2O1GA 4CJ8A 1HM0A 1YP3A 2OI7A 3RMVA 4JISA 1ZJPA 4E1KA 3U2XA 1LZ7A 1H7EA 1GQCA 5C36A 2WVLA 1H4DA 1FXOA 2P72A 4Y6UA 1V82A 3BRKX 1ZI1A 1FOAA 2YCMA 2BO4A 2VFZA 4EEOA 4ARWA 1LL0A 2V0HA 2RJ6A 5C1GA 3V90A 1ZIZA 3SXGA 2Y4MA 3D98A 2VXMA 4KRVA 1ZDFA 2WE9A 2I5EA 1JYKA 2JCLA 4B2XA 2JCOA 4NAIA 2XWMA 1K4VA 2Y7AA 1S4PA 1HV9A 1INJA 4Y62A 2FYDB 3V0QA 1FGXA 1QGQA 2RJ0A 2OI5A 2RJ9A 2D0JA 5C3BA 1FGGA 4Y63A 3IOIA
chains in the Genus database with same CATH topology
1ZJOA 1XZ6A 4FQWA 1O7QA 4G3PA 1QWJA 1PZYB 3OH1A 3SXEA 2Y4LA 4KT7A 4LW6A 5C38A 5BXCA 5FUHA 2FFVA 3ST8A 2ICXA 2YESA 1HJLA 3U2VA 4AC3A 1E5KA 4FRAA 1O0RA 4D11A 3ZF8A 2AM5A 2FYCB 4MIXA 1VGZA 2AE7A 2VK9A 5FU8A 3I0HA 4AAWA 4Y7GA 1WT2A 5FV9A 3JUJA 5FYEA 1ON8A 4D0ZA 1ZJ3A 5HS2A 2VS3A 2CU2A 4P02A 4UEGA 4L41C 2RJ1A 2WVMA 3EE5A 3SX5A 4D0TA 3T7OA 1ZDGA 3K8DA 1LL3A 5DDVA 1JV1A 1FO9A 4LW3A 1LL2A 1R7YA 2QGIA 2V0KA 1S4OA 3RMWA 1R80A 3OC9A 1W57A 3Q4SA 2UX8A 2FYBA 3CGXA 4FRLA 5I1FA 5L6VA 4CJCA 3OH2A 5AJPA 2FYAA 4B42A 1FRWA 5CQOA 1G23A 3D5NA 1EYRA 2I5KA 2A8WA 2V0JA 4O6NA 2X5SA 3U0XA 1G9RA 3ZLLA 4Y7FA 2RIXA 5FU0A 1W77A 1H7HA 3RSBA 5J49A 5C4FA 4HO9A 3POLA 4EEAA 2OI6A 2XWLA 4B3UA 2W0WA 4FRPA 4ASYA 3CU0A 4GBPA 1ZCVA 1GQ9A 3SXBA 3U2TA 5D92A 1ZJ0A 5C3AA 4EE3A 4FCEA 2ZU9A 5CMJA 1H4CA 4MYBA 3SX3A 1TW5A 1HM8A 4HOCA 4B2WA 2VS5A 2VD4A 3CKJA 3OGZA 4HG6A 3N9WA 4KC4A 2Y4JA 5CQMX 4CJBA 3OH3A 3ZGFA 4KXOA 4HCQA 1W55A 3TZTA 4FIXA 2W0VA 1FO8A 1VICA 3SPTA 2YQCA 3ZLKA 1MC3A 4NAKA 5C1LA 2J0BA 4HO4A 5L6SA 2C0NA 1G0RA 1R7UA 1XHBA 5CMFX 4FRMA 2P73A 4EEMA 3SX7A 4KNRA 4KPZA 3SXDA 3I0KA 3PKQA 4HO5A 4NANA 3T7NA 2MZBA 5FTSA 4DE7A 5EJZA 1ZCUA 2WAWA 3R2WA 1MP3A 1G1LA 5AJNA 1O23B 4FRDA 5CMHA 1LZIA 4HO0A 2AM4A 3FWWA 1JVDA 4AYLA 1GWWA 1HJJA 3V0OA 3FOQA 5CQLX 1ZI3A 2Y4KA 3LW6A 1JVGA 1ZI4A 2VSIA 1G93A 4J18A 3DJ4A 4EE4A 3E25A 3OH0A 4C2SA 4FREA 5FTVA 4ECMA 1H5SB 1H5TB 3V0NA 5IDTA 4Y64A 2AGDA 3O3PA 1VM8A 3USRA 5DDTA 1OQMB 1H5RA 1R7TA 4B4BA 3I0EA 2Y6PA 1H7QA 4P00A 3JTJA 1MP5A 4FRHA 1WT1A 3ZGGA 1VGUA 4IRPA 4B5BA 4DDZA 3SXAA 5C4EA 3V0PA 2Z87A 3I0IX 2AH9A 2RJ8A 1HM9A 2I7BA 2BO8A 3D8VA 3DK5A 4M28A 2Z86A 5CMIA 3SXCA 5C48A 4Y9XA 4G3QA 3OAMA 5IFYA 1PZTA 1NF5B 3CKNA 1TVYA 1R82A 1Z90A 5C4DA 1OMZA 3F1CA 2XMEA 1GWVA 2P6WA 2JCKA 3V8YA 1V83A 4NALA 3K8EA 4ASJA 4KNXA 1NHEB 4K6RA 1H5RB 1JV3A 1H7LA 1GA8A 1QGSA 1IINA 3IOHA 2OEGA 1NKHB 2DPWA 3CKQA 4KPXA 3V0MA 4G87A 3PNNA 4M2AA 1TW1A 4R7PA 2J0AA 2D7IA 1WT0A 1ZJ2A 4Y7TA 1H5SC 3E26A 3CKVA 1FXJA 1WT3A 5C47A 3I0GA 5C3DA 1H7GA 2O1FA 1G95A 2V0IA 3I0DA 4M2BA 4FIYA 4Y7VA 3NGWA 3I0JA 4BMAA 1H5SA 1H5TA 1LZ0A 2YQSA 2D7RA 2FY7A 2YC3A 4Q7CA 4EEGA 1IIMA 1QG8A 1FWYA 3V8ZA 5C4CA 4FRQA 5C8RA 3U2UA 3U2WA 3TQDA 3T7MA 1VZUA 2XMHA 3F1YA 2RJ4A 2X65A 3V91A 4BQHA 3KIAA 2BO7A 3Q80A 5EJ1A 1G3LA 2AECA 1O7OA 4YS8A 1JYLA 2ICYA 2RIYA 3I0LA 2ZU7A 2X60A 3HL3A 1ZJ1A 1OMXA 3V0LA 4DECA 1FR9A 1ZHJA 3PKPA 2Q4JA 1H7FA 3CKOA 1NQIB 2E3DA 2ZU8A 1R81A 1WVCA 2BO6A 4AYJA 2VSHA 2PX7A 4IRQA 4EE5A 1YP4A 4JD0A 1INIA 3IOJA 1S4NA 1WSZA 4D11C 4EVWA 2X5ZA 5D91A 3JUKA 1ON6A 2V0LA 1YP2A 5IDSA 2GGQA 4KC2A 3R3IA 1R7XA 1H5SD 4FRBA 5C4BA 2YQJA 2YQHA 1FZWA 1TZFA 4XWIA 2RJ5A 5CQNX 4MNDA 2WEEA 4D48A 5CMGX 3U0YA 2FFUA 3I0FA 4FROA 1ZCTA 2QKXA 3DUVA 5C49A 1GX0A 4CVHA 1VH3A 4KC1A 3SX8A 2QH5A 1H7TA 1NWGB 1VZTA 4FCUA 3OKRA 4G3SA 1G97A 1ZCYA 4ZDQA 1SS9A 5AJOA 1GX4A 2OEFA 1LVWA 2APCA 1YROB 1VGTA 4B4MA 5EIYA 2VS4A 1LZJA 2AESA 3Q7UA 3QVBA 2YC5A 2GGOA 2PA4A 3USQA 1FR8A 1NMMB 2O1HA 2XWNA 2JCJA 4HO8A 4O6MA 2RITA 5C1HA 2PGYA 3BCVA 2A8UA 2E8BA 3I0CA 1I52A 5JQQA 1G8OA 1KWSA 4KQLA 4Y6NA 1EZIA 2NXVA 4HO3A 1R7VA 1VGWA 1H4EA 2VXLA 3OH4A 1FG5N 1VZXA 4M4KA 2WVKA 1ZI5A 2RJ7A 4Y7UA 1VPAA 4HO6A 2PGVA 4B4GA 2AM3A 1V84A 2WGZA 1VH1A 5CQPA 3GUEA 1H3MA 1G2VA 1MP4A 2RIZA 4HO2A 2O1GA 4CJ8A 1HM0A 1YP3A 2OI7A 3RMVA 4JISA 1ZJPA 4E1KA 3U2XA 1LZ7A 1H7EA 1GQCA 5C36A 2WVLA 1H4DA 1FXOA 2P72A 4Y6UA 1V82A 3BRKX 1ZI1A 1FOAA 2YCMA 2BO4A 2VFZA 4EEOA 4ARWA 1LL0A 2V0HA 2RJ6A 5C1GA 3V90A 1ZIZA 3SXGA 2Y4MA 3D98A 2VXMA 4KRVA 1ZDFA 2WE9A 2I5EA 1JYKA 2JCLA 4B2XA 2JCOA 4NAIA 2XWMA 1K4VA 2Y7AA 1S4PA 1HV9A 1INJA 4Y62A 2FYDB 3V0QA 1FGXA 1QGQA 2RJ0A 2OI5A 2RJ9A 2D0JA 5C3BA 1FGGA 4Y63A 3IOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJO A;  1XZ6 A;  4FQW A;  1O7Q A;  4G3P A;  1QWJ A;  1PZY B;  3OH1 A;  3SXE A;  2Y4L A;  4KT7 A;  4LW6 A;  5C38 A;  5BXC A;  5FUH A;  2FFV A;  3ST8 A;  2ICX A;  2YES A;  1HJL A;  3U2V A;  4AC3 A;  1E5K A;  4FRA A;  1O0R A;  4D11 A;  3ZF8 A;  2AM5 A;  2FYC B;  1VGZ A;  2AE7 A;  5FU8 A;  3I0H A;  4AAW A;  4Y7G A;  1WT2 A;  5FV9 A;  3JUJ A;  5FYE A;  1ON8 A;  4D0Z A;  1ZJ3 A;  5HS2 A;  2VS3 A;  2CU2 A;  4P02 A;  4UEG A;  4L41 C;  2RJ1 A;  2WVM A;  3EE5 A;  3SX5 A;  4D0T A;  3T7O A;  1ZDG A;  3K8D A;  1LL3 A;  5DDV A;  1JV1 A;  1FO9 A;  4LW3 A;  1LL2 A;  1R7Y A;  2QGI A;  2V0K A;  1S4O A;  3RMW A;  1R80 A;  3OC9 A;  1W57 A;  3Q4S A;  2UX8 A;  2FYB A;  3CGX A;  4FRL A;  5I1F A;  5L6V A;  4CJC A;  3OH2 A;  5AJP A;  2FYA A;  4B42 A;  1FRW A;  5CQO A;  1G23 A;  3D5N A;  1EYR A;  2I5K A;  2A8W A;  2V0J A;  2X5S A;  3U0X A;  1G9R A;  3ZLL A;  4Y7F A;  2RIX A;  5FU0 A;  1W77 A;  1H7H A;  3RSB A;  5J49 A;  5C4F A;  4HO9 A;  3POL A;  4EEA A;  2OI6 A;  2XWL A;  4B3U A;  2W0W A;  4FRP A;  4ASY A;  3CU0 A;  4GBP A;  1ZCV A;  1GQ9 A;  3SXB A;  3U2T A;  1ZJ0 A;  5C3A A;  4EE3 A;  4FCE A;  2ZU9 A;  5CMJ A;  1H4C A;  4MYB A;  3SX3 A;  1TW5 A;  1HM8 A;  4HOC A;  4B2W A;  2VS5 A;  2VD4 A;  3CKJ A;  3OGZ A;  4HG6 A;  3N9W A;  4KC4 A;  2Y4J A;  5CQM X;  4CJB A;  3OH3 A;  3ZGF A;  4KXO A;  4HCQ A;  1W55 A;  3TZT A;  2W0V A;  1FO8 A;  1VIC A;  3SPT A;  2YQC A;  3ZLK A;  1MC3 A;  4NAK A;  5C1L A;  4HO4 A;  5L6S A;  1G0R A;  1R7U A;  1XHB A;  5CMF X;  4FRM A;  2P73 A;  4EEM A;  3SX7 A;  4KNR A;  4KPZ A;  3SXD A;  3I0K A;  3PKQ A;  4HO5 A;  4NAN A;  3T7N A;  2MZB A;  5FTS A;  4DE7 A;  5EJZ A;  1ZCU A;  2WAW A;  3R2W A;  1MP3 A;  1G1L A;  5AJN A;  1O23 B;  4FRD A;  5CMH A;  1LZI A;  4HO0 A;  2AM4 A;  3FWW A;  1JVD A;  4AYL A;  1GWW A;  1HJJ A;  3V0O A;  3FOQ A;  5CQL X;  1ZI3 A;  2Y4K A;  3LW6 A;  1JVG A;  1ZI4 A;  2VSI A;  1G93 A;  4J18 A;  3DJ4 A;  4EE4 A;  3E25 A;  3OH0 A;  4C2S A;  4FRE A;  5FTV A;  4ECM A;  1H5S B;  1H5T B;  3V0N A;  5IDT A;  4Y64 A;  2AGD A;  3O3P A;  1VM8 A;  3USR A;  5DDT A;  1OQM B;  1H5R A;  1R7T A;  4B4B A;  3I0E A;  2Y6P A;  1H7Q A;  4P00 A;  3JTJ A;  1MP5 A;  4FRH A;  1WT1 A;  3ZGG A;  1VGU A;  4IRP A;  4B5B A;  4DDZ A;  3SXA A;  5C4E A;  3V0P A;  2Z87 A;  3I0I X;  2AH9 A;  2RJ8 A;  1HM9 A;  2I7B A;  2BO8 A;  3D8V A;  3DK5 A;  4M28 A;  2Z86 A;  5CMI A;  3SXC A;  5C48 A;  4Y9X A;  4G3Q A;  3OAM A;  5IFY A;  1PZT A;  1NF5 B;  3CKN A;  1TVY A;  1R82 A;  1Z90 A;  5C4D A;  1OMZ A;  3F1C A;  2XME A;  1GWV A;  2P6W A;  2JCK A;  3V8Y A;  1V83 A;  4NAL A;  3K8E A;  4ASJ A;  4KNX A;  1NHE B;  4K6R A;  1H5R B;  1JV3 A;  1H7L A;  1GA8 A;  1QGS A;  1IIN A;  3IOH A;  2OEG A;  1NKH B;  2DPW A;  3CKQ A;  4KPX A;  3V0M A;  4G87 A;  3PNN A;  4M2A A;  1TW1 A;  4R7P A;  2D7I A;  1WT0 A;  1ZJ2 A;  4Y7T A;  1H5S C;  3E26 A;  3CKV A;  1FXJ A;  1WT3 A;  5C47 A;  3I0G A;  5C3D A;  1H7G A;  2O1F A;  1G95 A;  2V0I A;  3I0D A;  4M2B A;  4Y7V A;  3NGW A;  3I0J A;  4BMA A;  1H5S A;  1H5T A;  1LZ0 A;  2YQS A;  2D7R A;  2FY7 A;  2YC3 A;  4EEG A;  1IIM A;  1QG8 A;  1FWY A;  3V8Z A;  5C4C A;  4FRQ A;  5C8R A;  3U2U A;  3U2W A;  3TQD A;  3T7M A;  1VZU A;  2XMH A;  3F1Y A;  2RJ4 A;  2X65 A;  3V91 A;  4BQH A;  3KIA A;  2BO7 A;  3Q80 A;  5EJ1 A;  1G3L A;  2AEC A;  1O7O A;  4YS8 A;  1JYL A;  2ICY A;  2RIY A;  3I0L A;  2ZU7 A;  2X60 A;  3HL3 A;  1ZJ1 A;  1OMX A;  3V0L A;  4DEC A;  1FR9 A;  1ZHJ A;  3PKP A;  2Q4J A;  1H7F A;  3CKO A;  1NQI B;  2E3D A;  2ZU8 A;  1R81 A;  1WVC A;  2BO6 A;  4AYJ A;  2VSH A;  2PX7 A;  4IRQ A;  4EE5 A;  1YP4 A;  4JD0 A;  1INI A;  3IOJ A;  1S4N A;  1WSZ A;  4D11 C;  4EVW A;  2X5Z A;  3JUK A;  1ON6 A;  2V0L A;  1YP2 A;  5IDS A;  2GGQ A;  4KC2 A;  3R3I A;  1R7X A;  1H5S D;  4FRB A;  5C4B A;  2YQJ A;  2YQH A;  1FZW A;  1TZF A;  4XWI A;  2RJ5 A;  5CQN X;  4MND A;  2WEE A;  4D48 A;  5CMG X;  3U0Y A;  2FFU A;  3I0F A;  4FRO A;  1ZCT A;  2QKX A;  3DUV A;  5C49 A;  1GX0 A;  4CVH A;  1VH3 A;  4KC1 A;  3SX8 A;  2QH5 A;  1H7T A;  1NWG B;  1VZT A;  4FCU A;  3OKR A;  4G3S A;  1G97 A;  1ZCY A;  4ZDQ A;  1SS9 A;  5AJO A;  1GX4 A;  2OEF A;  1LVW A;  2APC A;  1YRO B;  1VGT A;  4B4M A;  5EIY A;  2VS4 A;  1LZJ A;  2AES A;  3Q7U A;  3QVB A;  2YC5 A;  2GGO A;  2PA4 A;  3USQ A;  1FR8 A;  1NMM B;  2O1H A;  2XWN A;  2JCJ A;  4HO8 A;  2RIT A;  5C1H A;  2PGY A;  3BCV A;  2A8U A;  2E8B A;  3I0C A;  1I52 A;  5JQQ A;  1G8O A;  1KWS A;  4KQL A;  4Y6N A;  1EZI A;  2NXV A;  4HO3 A;  1R7V A;  1VGW A;  1H4E A;  2VXL A;  3OH4 A;  1FG5 N;  1VZX A;  4M4K A;  2WVK A;  1ZI5 A;  2RJ7 A;  4Y7U A;  1VPA A;  4HO6 A;  2PGV A;  4B4G A;  2AM3 A;  1V84 A;  2WGZ A;  1VH1 A;  5CQP A;  3GUE A;  1H3M A;  1G2V A;  1MP4 A;  2RIZ A;  4HO2 A;  2O1G A;  4CJ8 A;  1HM0 A;  1YP3 A;  2OI7 A;  3RMV A;  4JIS A;  1ZJP A;  4E1K A;  3U2X A;  1LZ7 A;  1H7E A;  1GQC A;  5C36 A;  2WVL A;  1H4D A;  1FXO A;  2P72 A;  4Y6U A;  1V82 A;  3BRK X;  1ZI1 A;  1FOA A;  2YCM A;  2BO4 A;  2VFZ A;  4EEO A;  4ARW A;  1LL0 A;  2V0H A;  2RJ6 A;  5C1G A;  3V90 A;  1ZIZ A;  3SXG A;  2Y4M A;  3D98 A;  2VXM A;  4KRV A;  1ZDF A;  2WE9 A;  2I5E A;  1JYK A;  2JCL A;  4B2X A;  2JCO A;  4NAI A;  2XWM A;  1K4V A;  2Y7A A;  1S4P A;  1HV9 A;  1INJ A;  4Y62 A;  2FYD B;  3V0Q A;  1FGX A;  1QGQ A;  2RJ0 A;  2OI5 A;  2RJ9 A;  2D0J A;  5C3B A;  1FGG A;  4Y63 A;  3IOI A; 
#chains in the Genus database with same CATH topology
 1ZJO A;  1XZ6 A;  4FQW A;  1O7Q A;  4G3P A;  1QWJ A;  1PZY B;  3OH1 A;  3SXE A;  2Y4L A;  4KT7 A;  4LW6 A;  5C38 A;  5BXC A;  5FUH A;  2FFV A;  3ST8 A;  2ICX A;  2YES A;  1HJL A;  3U2V A;  4AC3 A;  1E5K A;  4FRA A;  1O0R A;  4D11 A;  3ZF8 A;  2AM5 A;  2FYC B;  4MIX A;  1VGZ A;  2AE7 A;  2VK9 A;  5FU8 A;  3I0H A;  4AAW A;  4Y7G A;  1WT2 A;  5FV9 A;  3JUJ A;  5FYE A;  1ON8 A;  4D0Z A;  1ZJ3 A;  5HS2 A;  2VS3 A;  2CU2 A;  4P02 A;  4UEG A;  4L41 C;  2RJ1 A;  2WVM A;  3EE5 A;  3SX5 A;  4D0T A;  3T7O A;  1ZDG A;  3K8D A;  1LL3 A;  5DDV A;  1JV1 A;  1FO9 A;  4LW3 A;  1LL2 A;  1R7Y A;  2QGI A;  2V0K A;  1S4O A;  3RMW A;  1R80 A;  3OC9 A;  1W57 A;  3Q4S A;  2UX8 A;  2FYB A;  3CGX A;  4FRL A;  5I1F A;  5L6V A;  4CJC A;  3OH2 A;  5AJP A;  2FYA A;  4B42 A;  1FRW A;  5CQO A;  1G23 A;  3D5N A;  1EYR A;  2I5K A;  2A8W A;  2V0J A;  4O6N A;  2X5S A;  3U0X A;  1G9R A;  3ZLL A;  4Y7F A;  2RIX A;  5FU0 A;  1W77 A;  1H7H A;  3RSB A;  5J49 A;  5C4F A;  4HO9 A;  3POL A;  4EEA A;  2OI6 A;  2XWL A;  4B3U A;  2W0W A;  4FRP A;  4ASY A;  3CU0 A;  4GBP A;  1ZCV A;  1GQ9 A;  3SXB A;  3U2T A;  5D92 A;  1ZJ0 A;  5C3A A;  4EE3 A;  4FCE A;  2ZU9 A;  5CMJ A;  1H4C A;  4MYB A;  3SX3 A;  1TW5 A;  1HM8 A;  4HOC A;  4B2W A;  2VS5 A;  2VD4 A;  3CKJ A;  3OGZ A;  4HG6 A;  3N9W A;  4KC4 A;  2Y4J A;  5CQM X;  4CJB A;  3OH3 A;  3ZGF A;  4KXO A;  4HCQ A;  1W55 A;  3TZT A;  4FIX A;  2W0V A;  1FO8 A;  1VIC A;  3SPT A;  2YQC A;  3ZLK A;  1MC3 A;  4NAK A;  5C1L A;  2J0B A;  4HO4 A;  5L6S A;  2C0N A;  1G0R A;  1R7U A;  1XHB A;  5CMF X;  4FRM A;  2P73 A;  4EEM A;  3SX7 A;  4KNR A;  4KPZ A;  3SXD A;  3I0K A;  3PKQ A;  4HO5 A;  4NAN A;  3T7N A;  2MZB A;  5FTS A;  4DE7 A;  5EJZ A;  1ZCU A;  2WAW A;  3R2W A;  1MP3 A;  1G1L A;  5AJN A;  1O23 B;  4FRD A;  5CMH A;  1LZI A;  4HO0 A;  2AM4 A;  3FWW A;  1JVD A;  4AYL A;  1GWW A;  1HJJ A;  3V0O A;  3FOQ A;  5CQL X;  1ZI3 A;  2Y4K A;  3LW6 A;  1JVG A;  1ZI4 A;  2VSI A;  1G93 A;  4J18 A;  3DJ4 A;  4EE4 A;  3E25 A;  3OH0 A;  4C2S A;  4FRE A;  5FTV A;  4ECM A;  1H5S B;  1H5T B;  3V0N A;  5IDT A;  4Y64 A;  2AGD A;  3O3P A;  1VM8 A;  3USR A;  5DDT A;  1OQM B;  1H5R A;  1R7T A;  4B4B A;  3I0E A;  2Y6P A;  1H7Q A;  4P00 A;  3JTJ A;  1MP5 A;  4FRH A;  1WT1 A;  3ZGG A;  1VGU A;  4IRP A;  4B5B A;  4DDZ A;  3SXA A;  5C4E A;  3V0P A;  2Z87 A;  3I0I X;  2AH9 A;  2RJ8 A;  1HM9 A;  2I7B A;  2BO8 A;  3D8V A;  3DK5 A;  4M28 A;  2Z86 A;  5CMI A;  3SXC A;  5C48 A;  4Y9X A;  4G3Q A;  3OAM A;  5IFY A;  1PZT A;  1NF5 B;  3CKN A;  1TVY A;  1R82 A;  1Z90 A;  5C4D A;  1OMZ A;  3F1C A;  2XME A;  1GWV A;  2P6W A;  2JCK A;  3V8Y A;  1V83 A;  4NAL A;  3K8E A;  4ASJ A;  4KNX A;  1NHE B;  4K6R A;  1H5R B;  1JV3 A;  1H7L A;  1GA8 A;  1QGS A;  1IIN A;  3IOH A;  2OEG A;  1NKH B;  2DPW A;  3CKQ A;  4KPX A;  3V0M A;  4G87 A;  3PNN A;  4M2A A;  1TW1 A;  4R7P A;  2J0A A;  2D7I A;  1WT0 A;  1ZJ2 A;  4Y7T A;  1H5S C;  3E26 A;  3CKV A;  1FXJ A;  1WT3 A;  5C47 A;  3I0G A;  5C3D A;  1H7G A;  2O1F A;  1G95 A;  2V0I A;  3I0D A;  4M2B A;  4FIY A;  4Y7V A;  3NGW A;  3I0J A;  4BMA A;  1H5S A;  1H5T A;  1LZ0 A;  2YQS A;  2D7R A;  2FY7 A;  2YC3 A;  4Q7C A;  4EEG A;  1IIM A;  1QG8 A;  1FWY A;  3V8Z A;  5C4C A;  4FRQ A;  5C8R A;  3U2U A;  3U2W A;  3TQD A;  3T7M A;  1VZU A;  2XMH A;  3F1Y A;  2RJ4 A;  2X65 A;  3V91 A;  4BQH A;  3KIA A;  2BO7 A;  3Q80 A;  5EJ1 A;  1G3L A;  2AEC A;  1O7O A;  4YS8 A;  1JYL A;  2ICY A;  2RIY A;  3I0L A;  2ZU7 A;  2X60 A;  3HL3 A;  1ZJ1 A;  1OMX A;  3V0L A;  4DEC A;  1FR9 A;  1ZHJ A;  3PKP A;  2Q4J A;  1H7F A;  3CKO A;  1NQI B;  2E3D A;  2ZU8 A;  1R81 A;  1WVC A;  2BO6 A;  4AYJ A;  2VSH A;  2PX7 A;  4IRQ A;  4EE5 A;  1YP4 A;  4JD0 A;  1INI A;  3IOJ A;  1S4N A;  1WSZ A;  4D11 C;  4EVW A;  2X5Z A;  5D91 A;  3JUK A;  1ON6 A;  2V0L A;  1YP2 A;  5IDS A;  2GGQ A;  4KC2 A;  3R3I A;  1R7X A;  1H5S D;  4FRB A;  5C4B A;  2YQJ A;  2YQH A;  1FZW A;  1TZF A;  4XWI A;  2RJ5 A;  5CQN X;  4MND A;  2WEE A;  4D48 A;  5CMG X;  3U0Y A;  2FFU A;  3I0F A;  4FRO A;  1ZCT A;  2QKX A;  3DUV A;  5C49 A;  1GX0 A;  4CVH A;  1VH3 A;  4KC1 A;  3SX8 A;  2QH5 A;  1H7T A;  1NWG B;  1VZT A;  4FCU A;  3OKR A;  4G3S A;  1G97 A;  1ZCY A;  4ZDQ A;  1SS9 A;  5AJO A;  1GX4 A;  2OEF A;  1LVW A;  2APC A;  1YRO B;  1VGT A;  4B4M A;  5EIY A;  2VS4 A;  1LZJ A;  2AES A;  3Q7U A;  3QVB A;  2YC5 A;  2GGO A;  2PA4 A;  3USQ A;  1FR8 A;  1NMM B;  2O1H A;  2XWN A;  2JCJ A;  4HO8 A;  4O6M A;  2RIT A;  5C1H A;  2PGY A;  3BCV A;  2A8U A;  2E8B A;  3I0C A;  1I52 A;  5JQQ A;  1G8O A;  1KWS A;  4KQL A;  4Y6N A;  1EZI A;  2NXV A;  4HO3 A;  1R7V A;  1VGW A;  1H4E A;  2VXL A;  3OH4 A;  1FG5 N;  1VZX A;  4M4K A;  2WVK A;  1ZI5 A;  2RJ7 A;  4Y7U A;  1VPA A;  4HO6 A;  2PGV A;  4B4G A;  2AM3 A;  1V84 A;  2WGZ A;  1VH1 A;  5CQP A;  3GUE A;  1H3M A;  1G2V A;  1MP4 A;  2RIZ A;  4HO2 A;  2O1G A;  4CJ8 A;  1HM0 A;  1YP3 A;  2OI7 A;  3RMV A;  4JIS A;  1ZJP A;  4E1K A;  3U2X A;  1LZ7 A;  1H7E A;  1GQC A;  5C36 A;  2WVL A;  1H4D A;  1FXO A;  2P72 A;  4Y6U A;  1V82 A;  3BRK X;  1ZI1 A;  1FOA A;  2YCM A;  2BO4 A;  2VFZ A;  4EEO A;  4ARW A;  1LL0 A;  2V0H A;  2RJ6 A;  5C1G A;  3V90 A;  1ZIZ A;  3SXG A;  2Y4M A;  3D98 A;  2VXM A;  4KRV A;  1ZDF A;  2WE9 A;  2I5E A;  1JYK A;  2JCL A;  4B2X A;  2JCO A;  4NAI A;  2XWM A;  1K4V A;  2Y7A A;  1S4P A;  1HV9 A;  1INJ A;  4Y62 A;  2FYD B;  3V0Q A;  1FGX A;  1QGQ A;  2RJ0 A;  2OI5 A;  2RJ9 A;  2D0J A;  5C3B A;  1FGG A;  4Y63 A;  3IOI A; 
#chains in the Genus database with same CATH homology
 1ZJO A;  1XZ6 A;  4FQW A;  1O7Q A;  4G3P A;  1QWJ A;  1PZY B;  3OH1 A;  3SXE A;  2Y4L A;  4KT7 A;  4LW6 A;  5C38 A;  5BXC A;  5FUH A;  2FFV A;  3ST8 A;  2ICX A;  2YES A;  1HJL A;  3U2V A;  4AC3 A;  1E5K A;  4FRA A;  1O0R A;  4D11 A;  3ZF8 A;  2AM5 A;  2FYC B;  4MIX A;  1VGZ A;  2AE7 A;  2VK9 A;  5FU8 A;  3I0H A;  4AAW A;  4Y7G A;  1WT2 A;  5FV9 A;  3JUJ A;  5FYE A;  1ON8 A;  4D0Z A;  1ZJ3 A;  5HS2 A;  2VS3 A;  2CU2 A;  4P02 A;  4UEG A;  4L41 C;  2RJ1 A;  2WVM A;  3EE5 A;  3SX5 A;  4D0T A;  3T7O A;  1ZDG A;  3K8D A;  1LL3 A;  5DDV A;  1JV1 A;  1FO9 A;  4LW3 A;  1LL2 A;  1R7Y A;  2QGI A;  2V0K A;  1S4O A;  3RMW A;  1R80 A;  3OC9 A;  1W57 A;  3Q4S A;  2UX8 A;  2FYB A;  3CGX A;  4FRL A;  5I1F A;  5L6V A;  4CJC A;  3OH2 A;  5AJP A;  2FYA A;  4B42 A;  1FRW A;  5CQO A;  1G23 A;  3D5N A;  1EYR A;  2I5K A;  2A8W A;  2V0J A;  4O6N A;  2X5S A;  3U0X A;  1G9R A;  3ZLL A;  4Y7F A;  2RIX A;  5FU0 A;  1W77 A;  1H7H A;  3RSB A;  5J49 A;  5C4F A;  4HO9 A;  3POL A;  4EEA A;  2OI6 A;  2XWL A;  4B3U A;  2W0W A;  4FRP A;  4ASY A;  3CU0 A;  4GBP A;  1ZCV A;  1GQ9 A;  3SXB A;  3U2T A;  5D92 A;  1ZJ0 A;  5C3A A;  4EE3 A;  4FCE A;  2ZU9 A;  5CMJ A;  1H4C A;  4MYB A;  3SX3 A;  1TW5 A;  1HM8 A;  4HOC A;  4B2W A;  2VS5 A;  2VD4 A;  3CKJ A;  3OGZ A;  4HG6 A;  3N9W A;  4KC4 A;  2Y4J A;  5CQM X;  4CJB A;  3OH3 A;  3ZGF A;  4KXO A;  4HCQ A;  1W55 A;  3TZT A;  4FIX A;  2W0V A;  1FO8 A;  1VIC A;  3SPT A;  2YQC A;  3ZLK A;  1MC3 A;  4NAK A;  5C1L A;  2J0B A;  4HO4 A;  5L6S A;  2C0N A;  1G0R A;  1R7U A;  1XHB A;  5CMF X;  4FRM A;  2P73 A;  4EEM A;  3SX7 A;  4KNR A;  4KPZ A;  3SXD A;  3I0K A;  3PKQ A;  4HO5 A;  4NAN A;  3T7N A;  2MZB A;  5FTS A;  4DE7 A;  5EJZ A;  1ZCU A;  2WAW A;  3R2W A;  1MP3 A;  1G1L A;  5AJN A;  1O23 B;  4FRD A;  5CMH A;  1LZI A;  4HO0 A;  2AM4 A;  3FWW A;  1JVD A;  4AYL A;  1GWW A;  1HJJ A;  3V0O A;  3FOQ A;  5CQL X;  1ZI3 A;  2Y4K A;  3LW6 A;  1JVG A;  1ZI4 A;  2VSI A;  1G93 A;  4J18 A;  3DJ4 A;  4EE4 A;  3E25 A;  3OH0 A;  4C2S A;  4FRE A;  5FTV A;  4ECM A;  1H5S B;  1H5T B;  3V0N A;  5IDT A;  4Y64 A;  2AGD A;  3O3P A;  1VM8 A;  3USR A;  5DDT A;  1OQM B;  1H5R A;  1R7T A;  4B4B A;  3I0E A;  2Y6P A;  1H7Q A;  4P00 A;  3JTJ A;  1MP5 A;  4FRH A;  1WT1 A;  3ZGG A;  1VGU A;  4IRP A;  4B5B A;  4DDZ A;  3SXA A;  5C4E A;  3V0P A;  2Z87 A;  3I0I X;  2AH9 A;  2RJ8 A;  1HM9 A;  2I7B A;  2BO8 A;  3D8V A;  3DK5 A;  4M28 A;  2Z86 A;  5CMI A;  3SXC A;  5C48 A;  4Y9X A;  4G3Q A;  3OAM A;  5IFY A;  1PZT A;  1NF5 B;  3CKN A;  1TVY A;  1R82 A;  1Z90 A;  5C4D A;  1OMZ A;  3F1C A;  2XME A;  1GWV A;  2P6W A;  2JCK A;  3V8Y A;  1V83 A;  4NAL A;  3K8E A;  4ASJ A;  4KNX A;  1NHE B;  4K6R A;  1H5R B;  1JV3 A;  1H7L A;  1GA8 A;  1QGS A;  1IIN A;  3IOH A;  2OEG A;  1NKH B;  2DPW A;  3CKQ A;  4KPX A;  3V0M A;  4G87 A;  3PNN A;  4M2A A;  1TW1 A;  4R7P A;  2J0A A;  2D7I A;  1WT0 A;  1ZJ2 A;  4Y7T A;  1H5S C;  3E26 A;  3CKV A;  1FXJ A;  1WT3 A;  5C47 A;  3I0G A;  5C3D A;  1H7G A;  2O1F A;  1G95 A;  2V0I A;  3I0D A;  4M2B A;  4FIY A;  4Y7V A;  3NGW A;  3I0J A;  4BMA A;  1H5S A;  1H5T A;  1LZ0 A;  2YQS A;  2D7R A;  2FY7 A;  2YC3 A;  4Q7C A;  4EEG A;  1IIM A;  1QG8 A;  1FWY A;  3V8Z A;  5C4C A;  4FRQ A;  5C8R A;  3U2U A;  3U2W A;  3TQD A;  3T7M A;  1VZU A;  2XMH A;  3F1Y A;  2RJ4 A;  2X65 A;  3V91 A;  4BQH A;  3KIA A;  2BO7 A;  3Q80 A;  5EJ1 A;  1G3L A;  2AEC A;  1O7O A;  4YS8 A;  1JYL A;  2ICY A;  2RIY A;  3I0L A;  2ZU7 A;  2X60 A;  3HL3 A;  1ZJ1 A;  1OMX A;  3V0L A;  4DEC A;  1FR9 A;  1ZHJ A;  3PKP A;  2Q4J A;  1H7F A;  3CKO A;  1NQI B;  2E3D A;  2ZU8 A;  1R81 A;  1WVC A;  2BO6 A;  4AYJ A;  2VSH A;  2PX7 A;  4IRQ A;  4EE5 A;  1YP4 A;  4JD0 A;  1INI A;  3IOJ A;  1S4N A;  1WSZ A;  4D11 C;  4EVW A;  2X5Z A;  5D91 A;  3JUK A;  1ON6 A;  2V0L A;  1YP2 A;  5IDS A;  2GGQ A;  4KC2 A;  3R3I A;  1R7X A;  1H5S D;  4FRB A;  5C4B A;  2YQJ A;  2YQH A;  1FZW A;  1TZF A;  4XWI A;  2RJ5 A;  5CQN X;  4MND A;  2WEE A;  4D48 A;  5CMG X;  3U0Y A;  2FFU A;  3I0F A;  4FRO A;  1ZCT A;  2QKX A;  3DUV A;  5C49 A;  1GX0 A;  4CVH A;  1VH3 A;  4KC1 A;  3SX8 A;  2QH5 A;  1H7T A;  1NWG B;  1VZT A;  4FCU A;  3OKR A;  4G3S A;  1G97 A;  1ZCY A;  4ZDQ A;  1SS9 A;  5AJO A;  1GX4 A;  2OEF A;  1LVW A;  2APC A;  1YRO B;  1VGT A;  4B4M A;  5EIY A;  2VS4 A;  1LZJ A;  2AES A;  3Q7U A;  3QVB A;  2YC5 A;  2GGO A;  2PA4 A;  3USQ A;  1FR8 A;  1NMM B;  2O1H A;  2XWN A;  2JCJ A;  4HO8 A;  4O6M A;  2RIT A;  5C1H A;  2PGY A;  3BCV A;  2A8U A;  2E8B A;  3I0C A;  1I52 A;  5JQQ A;  1G8O A;  1KWS A;  4KQL A;  4Y6N A;  1EZI A;  2NXV A;  4HO3 A;  1R7V A;  1VGW A;  1H4E A;  2VXL A;  3OH4 A;  1FG5 N;  1VZX A;  4M4K A;  2WVK A;  1ZI5 A;  2RJ7 A;  4Y7U A;  1VPA A;  4HO6 A;  2PGV A;  4B4G A;  2AM3 A;  1V84 A;  2WGZ A;  1VH1 A;  5CQP A;  3GUE A;  1H3M A;  1G2V A;  1MP4 A;  2RIZ A;  4HO2 A;  2O1G A;  4CJ8 A;  1HM0 A;  1YP3 A;  2OI7 A;  3RMV A;  4JIS A;  1ZJP A;  4E1K A;  3U2X A;  1LZ7 A;  1H7E A;  1GQC A;  5C36 A;  2WVL A;  1H4D A;  1FXO A;  2P72 A;  4Y6U A;  1V82 A;  3BRK X;  1ZI1 A;  1FOA A;  2YCM A;  2BO4 A;  2VFZ A;  4EEO A;  4ARW A;  1LL0 A;  2V0H A;  2RJ6 A;  5C1G A;  3V90 A;  1ZIZ A;  3SXG A;  2Y4M A;  3D98 A;  2VXM A;  4KRV A;  1ZDF A;  2WE9 A;  2I5E A;  1JYK A;  2JCL A;  4B2X A;  2JCO A;  4NAI A;  2XWM A;  1K4V A;  2Y7A A;  1S4P A;  1HV9 A;  1INJ A;  4Y62 A;  2FYD B;  3V0Q A;  1FGX A;  1QGQ A;  2RJ0 A;  2OI5 A;  2RJ9 A;  2D0J A;  5C3B A;  1FGG A;  4Y63 A;  3IOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...