5JQQA

Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis - apo form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
276
Chain Sequence
TTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLDYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis - apo form
rcsb
source organism Mycobacterium tuberculosis h37ra
total genus 92
structure length 276
sequence length 299
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5jqqA00
1NHEB 3U2XA 2A8UA 3I0DA 3POLA 4HO4A 5IDTA 2VFZA 3IOJA 4HO9A 5J49A 1ON6A 2VXLA 1FWYA 4Y6UA 2D7IA 4M2AA 3E26A 1S4NA 3HL3A 1NF5B 1OQMB 4B4BA 4HOCA 1OMZA 2RJ5A 4Y7UA 1G1LA 3QVBA 2RITA 2I5KA 5FU8A 1S4PA 1G93A 5CQMX 5FUHA 2ZU9A 2A8WA 4B5BA 2QH5A 2VSHA 4HO5A 5JQQA 2JCJA 1SS9A 4FCEA 4ZDQA 5IFYA 4EEAA 4HO0A 1W55A 2X65A 3I0CA 2WVKA 3V0PA 1R7TA 1E5KA 4KNXA 1NWGB 1PZYB 1VZXA 3PKQA 3R3IA 4G3QA 1ZCTA 5FTSA 2P72A 2WE9A 4ASYA 1R7UA 1FXOA 2VSIA 4AYJA 2P6WA 1NMMB 2BO7A 4FRAA 5C38A 4KNRA 2P73A 2Y4LA 2QGIA 1HJJA 2OI5A 3Q4SA 4HO3A 2MZBA 5C1GA 4G3SA 1R7XA 4B42A 2WVMA 2RJ4A 2AE7A 3V0OA 1K4VA 1VGWA 3Q80A 5C4FA 5L6SA 5FV9A 3T7NA 5C48A 1H5SA 4KQLA 1ZHJA 4NAKA 1ZCUA 1H7EA 3SX3A 2DPWA 2VS3A 2RJ9A 3I0IX 1ZI4A 2ICYA 4IRPA 1GQCA 4Y62A 1ZI5A 1ZJPA 5CQOA 5FU0A 3T7MA 3I0JA 2AM5A 2Q4JA 1GWVA 3I0FA 4CJCA 1LL0A 4Y64A 1WT3A 5C8RA 1JV3A 1EZIA 5C49A 2X5ZA 5DDTA 2PGYA 1ZJ3A 5AJPA 2V0LA 1G95A 1FZWA 2Z87A 3SX5A 4Y9XA 3V8YA 1VGTA 1WT1A 2V0KA 2YQSA 2FY7A 1ON8A 4EEGA 4YS8A 1JVGA 1WVCA 1LZJA 1H5SC 1NKHB 2RJ1A 3JTJA 4M2BA 2XMHA 2RIYA 3SXCA 4NAIA 5C1HA 4ARWA 4FQWA 1FO9A 2O1HA 5AJOA 4FRDA 4FCUA 4L41C 1O7OA 5C3AA 1H7TA 3TZTA 1H7LA 3V0QA 1VH1A 2GGOA 4NALA 4ECMA 5C1LA 1H7HA 3CKJA 1FO8A 2FYAA 3R2WA 4Y7VA 4BMAA 1ZJ2A 3SX8A 2FFVA 2WAWA 3IOIA 3D8VA 1R7YA 4EVWA 1GX0A 2W0VA 1JYKA 2BO6A 2V0JA 1OMXA 3PKPA 5HS2A 3KIAA 1VPAA 1ZJOA 3D98A 1IINA 1V83A 1O23B 2PX7A 3I0EA 3U2WA 4FREA 1H5RA 3CGXA 2JCKA 3RSBA 4Y63A 5C47A 2GGQA 3DUVA 2BO4A 2VXMA 2Y6PA 1ZDGA 1XHBA 3BCVA 3RMWA 2AECA 2WVLA 4B4MA 1R82A 2RIXA 5C3BA 4EEOA 4CVHA 4Y7FA 2RJ8A 2QKXA 2O1FA 3OKRA 5AJNA 2WEEA 5FTVA 2RJ7A 2XWNA 4Y7TA 3NGWA 2W0WA 3IOHA 2YQJA 4HCQA 1YP4A 4FRPA 3JUKA 4BQHA 3BRKX 4FRQA 3OH1A 3U2VA 2V0IA 1INIA 3O3PA 1G8OA 1FR8A 2XMEA 4ASJA 1MP4A 2D0JA 3E25A 4KPZA 5BXCA 3SPTA 1JYLA 1H5SD 3LW6A 4MNDA 1H5TB 3DK5A 3V0NA 3SXBA 3OC9A 2FFUA 1HM0A 4LW6A 2YC5A 3DJ4A 1G0RA 3SX7A 2OEFA 5CMFX 2E3DA 4Y7GA 4DECA 4EE4A 1R80A 4Y6NA 5DDVA 1FG5N 1FGXA 3F1CA 3ZF8A 1KWSA 1JV1A 1WT2A 1VGZA 3CKQA 1NQIB 5CMHA 4P00A 3V8ZA 4D48A 5C4DA 2I7BA 5IDSA 4AAWA 1O0RA 1YROB 4B4GA 2FYCB 4C2SA 1G9RA 1W57A 2D7RA 4MYBA 1JVDA 2NXVA 1S4OA 4KRVA 2AM3A 3SXEA 3ZGFA 1FGGA 3FOQA 3V91A 2RIZA 1PZTA 1R81A 1LZIA 1YP2A 2YC3A 4HO8A 1LVWA 2Y4JA 2V0HA 2ZU7A 5C36A 3ST8A 1ZI3A 1LL3A 4FRMA 4B3UA 4JISA 3CKNA 3USRA 2XWLA 1H7QA 2Y4MA 1TW1A 2AM4A 5CMJA 3GUEA 5C4BA 2APCA 4FROA 1WSZA 2UX8A 2ICXA 4KPXA 1O7QA 3OH3A 2OI7A 1GQ9A 4D0ZA 5I1FA 3RMVA 2OEGA 2PA4A 2E8BA 4DDZA 1QGSA 3I0KA 5FYEA 3K8EA 1HJLA 1H4DA 4KXOA 1QWJA 3PNNA 2X5SA 5CMIA 2JCLA 4EE5A 4M4KA 2O1GA 1EYRA 1ZJ0A 2WGZA 5CMGX 1ZJ1A 4M28A 2AGDA 4R7PA 1QG8A 3U2TA 1IIMA 1VICA 3CKVA 3V0MA 1H4CA 5EJZA 1WT0A 1V82A 3ZGGA 1H3MA 1ZCYA 2I5EA 1HV9A 2Z86A 3N9WA 4HG6A 3I0GA 2AH9A 4KC4A 5L6VA 1MC3A 1HM9A 1V84A 2JCOA 1GWWA 4FRLA 3FWWA 3ZLKA 2YQCA 4HO2A 1LL2A 4CJ8A 5CQPA 1ZDFA 4AYLA 3OGZA 2VS4A 3U2UA 1XZ6A 1R7VA 5EIYA 1W77A 2XWMA 3F1YA 3T7OA 3USQA 4G87A 1TVYA 2VD4A 4FRHA 1H5SB 5CQNX 1MP3A 4EEMA 1LZ7A 1I52A 1VZTA 1LZ0A 4HO6A 2OI6A 2VS5A 4KT7A 1VGUA 4G3PA 1FOAA 5C4EA 1Z90A 3D5NA 5C4CA 2FYBA 1GA8A 1MP5A 2Y4KA 3K8DA 1H4EA 1G23A 1TZFA 2X60A 3OH2A 4B2WA 3V0LA 1FXJA 4CJBA 2FYDB 2RJ0A 1ZCVA 3OH4A 4XWIA 1INJA 1VZUA 5EJ1A 2Y7AA 4D11A 1VH3A 3EE5A 1H5TA 4D0TA 3I0HA 3ZLLA 3U0XA 4P02A 4J18A 2YCMA 1G3LA 4UEGA 3SXAA 2YESA 5C3DA 1H7FA 4EE3A 5CQLX 4LW3A 1TW5A 2RJ6A 3TQDA 3OH0A 2YQHA 1G2VA 1GX4A 2BO8A 4JD0A 4B2XA 3JUJA 1HM8A 3V90A 2CU2A 4KC1A 1ZIZA 1H7GA 1VM8A 1QGQA 3OAMA 4D11C 4E1KA 4GBPA 1YP3A 3I0LA 4DE7A 4AC3A 4K6RA 4NANA 2ZU8A 3CKOA 3CU0A 3SXGA 4IRQA 4FRBA 1H5RB 2PGVA 4KC2A 3U0YA 1FR9A 2AESA 1ZI1A 1FRWA 3Q7UA 1G97A 3SXDA
chains in the Genus database with same CATH superfamily
1NHEB 3U2XA 2A8UA 3I0DA 3POLA 4HO4A 5IDTA 2VFZA 3IOJA 4HO9A 5J49A 1ON6A 2VXLA 1FWYA 4Y6UA 2D7IA 4M2AA 3E26A 1S4NA 3HL3A 1NF5B 1OQMB 4B4BA 4HOCA 1OMZA 2RJ5A 4Y7UA 1G1LA 3QVBA 2RITA 2I5KA 5FU8A 1S4PA 1G93A 5CQMX 5FUHA 2ZU9A 2A8WA 4B5BA 2QH5A 2VSHA 4HO5A 5JQQA 2JCJA 1SS9A 4FCEA 4ZDQA 5IFYA 4EEAA 4HO0A 1W55A 2X65A 3I0CA 2WVKA 3V0PA 1R7TA 1E5KA 2VK9A 4KNXA 1NWGB 1PZYB 1VZXA 3PKQA 3R3IA 4FIXA 4G3QA 1ZCTA 5FTSA 2P72A 2WE9A 4ASYA 1R7UA 1FXOA 2VSIA 4AYJA 2P6WA 1NMMB 2BO7A 4FRAA 5C38A 4KNRA 4O6NA 2P73A 2Y4LA 2QGIA 1HJJA 2OI5A 3Q4SA 4HO3A 2MZBA 5C1GA 4G3SA 1R7XA 4B42A 2WVMA 2RJ4A 2AE7A 3V0OA 1K4VA 1VGWA 3Q80A 5C4FA 5L6SA 5FV9A 3T7NA 5C48A 1H5SA 4KQLA 1ZHJA 4NAKA 1ZCUA 1H7EA 3SX3A 2DPWA 2VS3A 2RJ9A 3I0IX 1ZI4A 2ICYA 4IRPA 1GQCA 4Y62A 1ZI5A 1ZJPA 5CQOA 5FU0A 3T7MA 3I0JA 2AM5A 2Q4JA 1GWVA 3I0FA 4CJCA 1LL0A 4Y64A 1WT3A 5C8RA 1JV3A 1EZIA 5C49A 4O6MA 2X5ZA 5DDTA 2PGYA 1ZJ3A 5AJPA 2V0LA 1G95A 1FZWA 2Z87A 3SX5A 4Y9XA 3V8YA 1VGTA 1WT1A 2V0KA 2YQSA 2FY7A 1ON8A 4EEGA 4YS8A 1JVGA 1WVCA 1LZJA 1H5SC 1NKHB 2RJ1A 3JTJA 4M2BA 2XMHA 2RIYA 3SXCA 4NAIA 5C1HA 4ARWA 4FQWA 1FO9A 2O1HA 5AJOA 4FRDA 4FCUA 4L41C 1O7OA 5C3AA 1H7TA 3TZTA 1H7LA 3V0QA 1VH1A 2GGOA 2C0NA 4NALA 4Q7CA 4ECMA 5C1LA 1H7HA 3CKJA 1FO8A 2FYAA 3R2WA 4Y7VA 4BMAA 1ZJ2A 3SX8A 2FFVA 2WAWA 3IOIA 3D8VA 1R7YA 2J0BA 4EVWA 1GX0A 2W0VA 1JYKA 2BO6A 2V0JA 1OMXA 3PKPA 5HS2A 3KIAA 1VPAA 1ZJOA 3D98A 1IINA 1V83A 1O23B 2PX7A 3I0EA 3U2WA 4FREA 1H5RA 3CGXA 2JCKA 3RSBA 4Y63A 5C47A 2GGQA 3DUVA 2BO4A 2VXMA 2Y6PA 1ZDGA 1XHBA 3BCVA 3RMWA 2AECA 2WVLA 4B4MA 1R82A 2RIXA 5C3BA 4EEOA 4CVHA 4Y7FA 2RJ8A 2QKXA 2O1FA 3OKRA 5AJNA 2WEEA 5FTVA 2RJ7A 2XWNA 4Y7TA 3NGWA 2W0WA 3IOHA 2YQJA 4HCQA 1YP4A 4FRPA 3JUKA 4BQHA 3BRKX 4FRQA 3OH1A 3U2VA 2V0IA 1INIA 3O3PA 1G8OA 1FR8A 2XMEA 4ASJA 1MP4A 2D0JA 3E25A 4KPZA 5BXCA 3SPTA 1JYLA 1H5SD 3LW6A 4MNDA 1H5TB 3DK5A 3V0NA 3SXBA 3OC9A 5D92A 2FFUA 1HM0A 4LW6A 2YC5A 3DJ4A 1G0RA 3SX7A 2OEFA 5CMFX 2E3DA 4Y7GA 4DECA 4EE4A 1R80A 4Y6NA 5DDVA 1FG5N 1FGXA 3F1CA 3ZF8A 1KWSA 1JV1A 1WT2A 1VGZA 4MIXA 3CKQA 1NQIB 5CMHA 4P00A 3V8ZA 4D48A 5C4DA 2I7BA 5IDSA 4AAWA 1O0RA 1YROB 4B4GA 2FYCB 4FIYA 4C2SA 1G9RA 1W57A 2D7RA 4MYBA 1JVDA 2NXVA 1S4OA 4KRVA 2AM3A 3SXEA 3ZGFA 1FGGA 3FOQA 3V91A 2RIZA 1PZTA 5D91A 1R81A 1LZIA 1YP2A 2YC3A 4HO8A 1LVWA 2Y4JA 2V0HA 2ZU7A 5C36A 3ST8A 1ZI3A 1LL3A 4FRMA 4B3UA 4JISA 3CKNA 3USRA 2XWLA 1H7QA 2Y4MA 1TW1A 2AM4A 5CMJA 3GUEA 5C4BA 2APCA 4FROA 1WSZA 2UX8A 2ICXA 4KPXA 1O7QA 3OH3A 2OI7A 1GQ9A 4D0ZA 5I1FA 3RMVA 2OEGA 2PA4A 2E8BA 4DDZA 1QGSA 3I0KA 5FYEA 3K8EA 1HJLA 1H4DA 4KXOA 1QWJA 3PNNA 2X5SA 5CMIA 2JCLA 4EE5A 4M4KA 2O1GA 1EYRA 1ZJ0A 2WGZA 5CMGX 1ZJ1A 4M28A 2AGDA 4R7PA 1QG8A 3U2TA 1IIMA 1VICA 3CKVA 3V0MA 1H4CA 5EJZA 1WT0A 1V82A 3ZGGA 1H3MA 1ZCYA 2I5EA 2J0AA 1HV9A 2Z86A 3N9WA 4HG6A 3I0GA 2AH9A 4KC4A 5L6VA 1MC3A 1HM9A 1V84A 2JCOA 1GWWA 4FRLA 3FWWA 3ZLKA 2YQCA 4HO2A 1LL2A 4CJ8A 5CQPA 1ZDFA 4AYLA 3OGZA 2VS4A 3U2UA 1XZ6A 1R7VA 5EIYA 1W77A 2XWMA 3F1YA 3T7OA 3USQA 4G87A 1TVYA 2VD4A 4FRHA 1H5SB 5CQNX 1MP3A 4EEMA 1LZ7A 1I52A 1VZTA 1LZ0A 4HO6A 2OI6A 2VS5A 4KT7A 1VGUA 4G3PA 1FOAA 5C4EA 1Z90A 3D5NA 5C4CA 2FYBA 1GA8A 1MP5A 2Y4KA 3K8DA 1H4EA 1G23A 1TZFA 2X60A 3OH2A 4B2WA 3V0LA 1FXJA 4CJBA 2FYDB 2RJ0A 1ZCVA 3OH4A 4XWIA 1INJA 1VZUA 5EJ1A 2Y7AA 4D11A 1VH3A 3EE5A 1H5TA 4D0TA 3I0HA 3ZLLA 3U0XA 4P02A 4J18A 2YCMA 1G3LA 4UEGA 3SXAA 2YESA 5C3DA 1H7FA 4EE3A 5CQLX 4LW3A 1TW5A 2RJ6A 3TQDA 3OH0A 2YQHA 1G2VA 1GX4A 2BO8A 4JD0A 4B2XA 3JUJA 1HM8A 3V90A 2CU2A 4KC1A 1ZIZA 1H7GA 1VM8A 1QGQA 3OAMA 4D11C 4E1KA 4GBPA 1YP3A 3I0LA 4DE7A 4AC3A 4K6RA 4NANA 2ZU8A 3CKOA 3CU0A 3SXGA 4IRQA 4FRBA 1H5RB 2PGVA 4KC2A 3U0YA 1FR9A 2AESA 1ZI1A 1FRWA 3Q7UA 1G97A 3SXDA
chains in the Genus database with same CATH topology
1NHEB 3U2XA 2A8UA 3I0DA 3POLA 4HO4A 5IDTA 2VFZA 3IOJA 4HO9A 5J49A 1ON6A 2VXLA 1FWYA 4Y6UA 2D7IA 4M2AA 3E26A 1S4NA 3HL3A 1NF5B 1OQMB 4B4BA 4HOCA 1OMZA 2RJ5A 4Y7UA 1G1LA 3QVBA 2RITA 2I5KA 5FU8A 1S4PA 1G93A 5CQMX 5FUHA 2ZU9A 2A8WA 4B5BA 2QH5A 2VSHA 4HO5A 5JQQA 2JCJA 1SS9A 4FCEA 4ZDQA 5IFYA 4EEAA 4HO0A 1W55A 2X65A 3I0CA 2WVKA 3V0PA 1R7TA 1E5KA 2VK9A 4KNXA 1NWGB 1PZYB 1VZXA 3PKQA 3R3IA 4FIXA 4G3QA 1ZCTA 5FTSA 2P72A 2WE9A 4ASYA 1R7UA 1FXOA 2VSIA 4AYJA 2P6WA 1NMMB 2BO7A 4FRAA 5C38A 4KNRA 4O6NA 2P73A 2Y4LA 2QGIA 1HJJA 2OI5A 3Q4SA 4HO3A 2MZBA 5C1GA 4G3SA 1R7XA 4B42A 2WVMA 2RJ4A 2AE7A 3V0OA 1K4VA 1VGWA 3Q80A 5C4FA 5L6SA 5FV9A 3T7NA 5C48A 1H5SA 4KQLA 1ZHJA 4NAKA 1ZCUA 1H7EA 3SX3A 2DPWA 2VS3A 2RJ9A 3I0IX 1ZI4A 2ICYA 4IRPA 1GQCA 4Y62A 1ZI5A 1ZJPA 5CQOA 5FU0A 3T7MA 3I0JA 2AM5A 2Q4JA 1GWVA 3I0FA 4CJCA 1LL0A 4Y64A 1WT3A 5C8RA 1JV3A 1EZIA 5C49A 4O6MA 2X5ZA 5DDTA 2PGYA 1ZJ3A 5AJPA 2V0LA 1G95A 1FZWA 2Z87A 3SX5A 4Y9XA 3V8YA 1VGTA 1WT1A 2V0KA 2YQSA 2FY7A 1ON8A 4EEGA 4YS8A 1JVGA 1WVCA 1LZJA 1H5SC 1NKHB 2RJ1A 3JTJA 4M2BA 2XMHA 2RIYA 3SXCA 4NAIA 5C1HA 4ARWA 4FQWA 1FO9A 2O1HA 5AJOA 4FRDA 4FCUA 4L41C 1O7OA 5C3AA 1H7TA 3TZTA 1H7LA 3V0QA 1VH1A 2GGOA 2C0NA 4NALA 4Q7CA 4ECMA 5C1LA 1H7HA 3CKJA 1FO8A 2FYAA 3R2WA 4Y7VA 4BMAA 1ZJ2A 3SX8A 2FFVA 2WAWA 3IOIA 3D8VA 1R7YA 2J0BA 4EVWA 1GX0A 2W0VA 1JYKA 2BO6A 2V0JA 1OMXA 3PKPA 5HS2A 3KIAA 1VPAA 1ZJOA 3D98A 1IINA 1V83A 1O23B 2PX7A 3I0EA 3U2WA 4FREA 1H5RA 3CGXA 2JCKA 3RSBA 4Y63A 5C47A 2GGQA 3DUVA 2BO4A 2VXMA 2Y6PA 1ZDGA 1XHBA 3BCVA 3RMWA 2AECA 2WVLA 4B4MA 1R82A 2RIXA 5C3BA 4EEOA 4CVHA 4Y7FA 2RJ8A 2QKXA 2O1FA 3OKRA 5AJNA 2WEEA 5FTVA 2RJ7A 2XWNA 4Y7TA 3NGWA 2W0WA 3IOHA 2YQJA 4HCQA 1YP4A 4FRPA 3JUKA 4BQHA 3BRKX 4FRQA 3OH1A 3U2VA 2V0IA 1INIA 3O3PA 1G8OA 1FR8A 2XMEA 4ASJA 1MP4A 2D0JA 3E25A 4KPZA 5BXCA 3SPTA 1JYLA 1H5SD 3LW6A 4MNDA 1H5TB 3DK5A 3V0NA 3SXBA 3OC9A 5D92A 2FFUA 1HM0A 4LW6A 2YC5A 3DJ4A 1G0RA 3SX7A 2OEFA 5CMFX 2E3DA 4Y7GA 4DECA 4EE4A 1R80A 4Y6NA 5DDVA 1FG5N 1FGXA 3F1CA 3ZF8A 1KWSA 1JV1A 1WT2A 1VGZA 4MIXA 3CKQA 1NQIB 5CMHA 4P00A 3V8ZA 4D48A 5C4DA 2I7BA 5IDSA 4AAWA 1O0RA 1YROB 4B4GA 2FYCB 4FIYA 4C2SA 1G9RA 1W57A 2D7RA 4MYBA 1JVDA 2NXVA 1S4OA 4KRVA 2AM3A 3SXEA 3ZGFA 1FGGA 3FOQA 3V91A 2RIZA 1PZTA 5D91A 1R81A 1LZIA 1YP2A 2YC3A 4HO8A 1LVWA 2Y4JA 2V0HA 2ZU7A 5C36A 3ST8A 1ZI3A 1LL3A 4FRMA 4B3UA 4JISA 3CKNA 3USRA 2XWLA 1H7QA 2Y4MA 1TW1A 2AM4A 5CMJA 3GUEA 5C4BA 2APCA 4FROA 1WSZA 2UX8A 2ICXA 4KPXA 1O7QA 3OH3A 2OI7A 1GQ9A 4D0ZA 5I1FA 3RMVA 2OEGA 2PA4A 2E8BA 4DDZA 1QGSA 3I0KA 5FYEA 3K8EA 1HJLA 1H4DA 4KXOA 1QWJA 3PNNA 2X5SA 5CMIA 2JCLA 4EE5A 4M4KA 2O1GA 1EYRA 1ZJ0A 2WGZA 5CMGX 1ZJ1A 4M28A 2AGDA 4R7PA 1QG8A 3U2TA 1IIMA 1VICA 3CKVA 3V0MA 1H4CA 5EJZA 1WT0A 1V82A 3ZGGA 1H3MA 1ZCYA 2I5EA 2J0AA 1HV9A 2Z86A 3N9WA 4HG6A 3I0GA 2AH9A 4KC4A 5L6VA 1MC3A 1HM9A 1V84A 2JCOA 1GWWA 4FRLA 3FWWA 3ZLKA 2YQCA 4HO2A 1LL2A 4CJ8A 5CQPA 1ZDFA 4AYLA 3OGZA 2VS4A 3U2UA 1XZ6A 1R7VA 5EIYA 1W77A 2XWMA 3F1YA 3T7OA 3USQA 4G87A 1TVYA 2VD4A 4FRHA 1H5SB 5CQNX 1MP3A 4EEMA 1LZ7A 1I52A 1VZTA 1LZ0A 4HO6A 2OI6A 2VS5A 4KT7A 1VGUA 4G3PA 1FOAA 5C4EA 1Z90A 3D5NA 5C4CA 2FYBA 1GA8A 1MP5A 2Y4KA 3K8DA 1H4EA 1G23A 1TZFA 2X60A 3OH2A 4B2WA 3V0LA 1FXJA 4CJBA 2FYDB 2RJ0A 1ZCVA 3OH4A 4XWIA 1INJA 1VZUA 5EJ1A 2Y7AA 4D11A 1VH3A 3EE5A 1H5TA 4D0TA 3I0HA 3ZLLA 3U0XA 4P02A 4J18A 2YCMA 1G3LA 4UEGA 3SXAA 2YESA 5C3DA 1H7FA 4EE3A 5CQLX 4LW3A 1TW5A 2RJ6A 3TQDA 3OH0A 2YQHA 1G2VA 1GX4A 2BO8A 4JD0A 4B2XA 3JUJA 1HM8A 3V90A 2CU2A 4KC1A 1ZIZA 1H7GA 1VM8A 1QGQA 3OAMA 4D11C 4E1KA 4GBPA 1YP3A 3I0LA 4DE7A 4AC3A 4K6RA 4NANA 2ZU8A 3CKOA 3CU0A 3SXGA 4IRQA 4FRBA 1H5RB 2PGVA 4KC2A 3U0YA 1FR9A 2AESA 1ZI1A 1FRWA 3Q7UA 1G97A 3SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHE B;  3U2X A;  2A8U A;  3I0D A;  3POL A;  4HO4 A;  5IDT A;  2VFZ A;  3IOJ A;  4HO9 A;  5J49 A;  1ON6 A;  2VXL A;  1FWY A;  4Y6U A;  2D7I A;  4M2A A;  3E26 A;  1S4N A;  3HL3 A;  1NF5 B;  1OQM B;  4B4B A;  4HOC A;  1OMZ A;  2RJ5 A;  4Y7U A;  1G1L A;  3QVB A;  2RIT A;  2I5K A;  5FU8 A;  1S4P A;  1G93 A;  5CQM X;  5FUH A;  2ZU9 A;  2A8W A;  4B5B A;  2QH5 A;  2VSH A;  4HO5 A;  5JQQ A;  2JCJ A;  1SS9 A;  4FCE A;  4ZDQ A;  5IFY A;  4EEA A;  4HO0 A;  1W55 A;  2X65 A;  3I0C A;  2WVK A;  3V0P A;  1R7T A;  1E5K A;  4KNX A;  1NWG B;  1PZY B;  1VZX A;  3PKQ A;  3R3I A;  4G3Q A;  1ZCT A;  5FTS A;  2P72 A;  2WE9 A;  4ASY A;  1R7U A;  1FXO A;  2VSI A;  4AYJ A;  2P6W A;  1NMM B;  2BO7 A;  4FRA A;  5C38 A;  4KNR A;  2P73 A;  2Y4L A;  2QGI A;  1HJJ A;  2OI5 A;  3Q4S A;  4HO3 A;  2MZB A;  5C1G A;  4G3S A;  1R7X A;  4B42 A;  2WVM A;  2RJ4 A;  2AE7 A;  3V0O A;  1K4V A;  1VGW A;  3Q80 A;  5C4F A;  5L6S A;  5FV9 A;  3T7N A;  5C48 A;  1H5S A;  4KQL A;  1ZHJ A;  4NAK A;  1ZCU A;  1H7E A;  3SX3 A;  2DPW A;  2VS3 A;  2RJ9 A;  3I0I X;  1ZI4 A;  2ICY A;  4IRP A;  1GQC A;  4Y62 A;  1ZI5 A;  1ZJP A;  5CQO A;  5FU0 A;  3T7M A;  3I0J A;  2AM5 A;  2Q4J A;  1GWV A;  3I0F A;  4CJC A;  1LL0 A;  4Y64 A;  1WT3 A;  5C8R A;  1JV3 A;  1EZI A;  5C49 A;  2X5Z A;  5DDT A;  2PGY A;  1ZJ3 A;  5AJP A;  2V0L A;  1G95 A;  1FZW A;  2Z87 A;  3SX5 A;  4Y9X A;  3V8Y A;  1VGT A;  1WT1 A;  2V0K A;  2YQS A;  2FY7 A;  1ON8 A;  4EEG A;  4YS8 A;  1JVG A;  1WVC A;  1LZJ A;  1H5S C;  1NKH B;  2RJ1 A;  3JTJ A;  4M2B A;  2XMH A;  2RIY A;  3SXC A;  4NAI A;  5C1H A;  4ARW A;  4FQW A;  1FO9 A;  2O1H A;  5AJO A;  4FRD A;  4FCU A;  4L41 C;  1O7O A;  5C3A A;  1H7T A;  3TZT A;  1H7L A;  3V0Q A;  1VH1 A;  2GGO A;  4NAL A;  4ECM A;  5C1L A;  1H7H A;  3CKJ A;  1FO8 A;  2FYA A;  3R2W A;  4Y7V A;  4BMA A;  1ZJ2 A;  3SX8 A;  2FFV A;  2WAW A;  3IOI A;  3D8V A;  1R7Y A;  4EVW A;  1GX0 A;  2W0V A;  1JYK A;  2BO6 A;  2V0J A;  1OMX A;  3PKP A;  5HS2 A;  3KIA A;  1VPA A;  1ZJO A;  3D98 A;  1IIN A;  1V83 A;  1O23 B;  2PX7 A;  3I0E A;  3U2W A;  4FRE A;  1H5R A;  3CGX A;  2JCK A;  3RSB A;  4Y63 A;  5C47 A;  2GGQ A;  3DUV A;  2BO4 A;  2VXM A;  2Y6P A;  1ZDG A;  1XHB A;  3BCV A;  3RMW A;  2AEC A;  2WVL A;  4B4M A;  1R82 A;  2RIX A;  5C3B A;  4EEO A;  4CVH A;  4Y7F A;  2RJ8 A;  2QKX A;  2O1F A;  3OKR A;  5AJN A;  2WEE A;  5FTV A;  2RJ7 A;  2XWN A;  4Y7T A;  3NGW A;  2W0W A;  3IOH A;  2YQJ A;  4HCQ A;  1YP4 A;  4FRP A;  3JUK A;  4BQH A;  3BRK X;  4FRQ A;  3OH1 A;  3U2V A;  2V0I A;  1INI A;  3O3P A;  1G8O A;  1FR8 A;  2XME A;  4ASJ A;  1MP4 A;  2D0J A;  3E25 A;  4KPZ A;  5BXC A;  3SPT A;  1JYL A;  1H5S D;  3LW6 A;  4MND A;  1H5T B;  3DK5 A;  3V0N A;  3SXB A;  3OC9 A;  2FFU A;  1HM0 A;  4LW6 A;  2YC5 A;  3DJ4 A;  1G0R A;  3SX7 A;  2OEF A;  5CMF X;  2E3D A;  4Y7G A;  4DEC A;  4EE4 A;  1R80 A;  4Y6N A;  5DDV A;  1FG5 N;  1FGX A;  3F1C A;  3ZF8 A;  1KWS A;  1JV1 A;  1WT2 A;  1VGZ A;  3CKQ A;  1NQI B;  5CMH A;  4P00 A;  3V8Z A;  4D48 A;  5C4D A;  2I7B A;  5IDS A;  4AAW A;  1O0R A;  1YRO B;  4B4G A;  2FYC B;  4C2S A;  1G9R A;  1W57 A;  2D7R A;  4MYB A;  1JVD A;  2NXV A;  1S4O A;  4KRV A;  2AM3 A;  3SXE A;  3ZGF A;  1FGG A;  3FOQ A;  3V91 A;  2RIZ A;  1PZT A;  1R81 A;  1LZI A;  1YP2 A;  2YC3 A;  4HO8 A;  1LVW A;  2Y4J A;  2V0H A;  2ZU7 A;  5C36 A;  3ST8 A;  1ZI3 A;  1LL3 A;  4FRM A;  4B3U A;  4JIS A;  3CKN A;  3USR A;  2XWL A;  1H7Q A;  2Y4M A;  1TW1 A;  2AM4 A;  5CMJ A;  3GUE A;  5C4B A;  2APC A;  4FRO A;  1WSZ A;  2UX8 A;  2ICX A;  4KPX A;  1O7Q A;  3OH3 A;  2OI7 A;  1GQ9 A;  4D0Z A;  5I1F A;  3RMV A;  2OEG A;  2PA4 A;  2E8B A;  4DDZ A;  1QGS A;  3I0K A;  5FYE A;  3K8E A;  1HJL A;  1H4D A;  4KXO A;  1QWJ A;  3PNN A;  2X5S A;  5CMI A;  2JCL A;  4EE5 A;  4M4K A;  2O1G A;  1EYR A;  1ZJ0 A;  2WGZ A;  5CMG X;  1ZJ1 A;  4M28 A;  2AGD A;  4R7P A;  1QG8 A;  3U2T A;  1IIM A;  1VIC A;  3CKV A;  3V0M A;  1H4C A;  5EJZ A;  1WT0 A;  1V82 A;  3ZGG A;  1H3M A;  1ZCY A;  2I5E A;  1HV9 A;  2Z86 A;  3N9W A;  4HG6 A;  3I0G A;  2AH9 A;  4KC4 A;  5L6V A;  1MC3 A;  1HM9 A;  1V84 A;  2JCO A;  1GWW A;  4FRL A;  3FWW A;  3ZLK A;  2YQC A;  4HO2 A;  1LL2 A;  4CJ8 A;  5CQP A;  1ZDF A;  4AYL A;  3OGZ A;  2VS4 A;  3U2U A;  1XZ6 A;  1R7V A;  5EIY A;  1W77 A;  2XWM A;  3F1Y A;  3T7O A;  3USQ A;  4G87 A;  1TVY A;  2VD4 A;  4FRH A;  1H5S B;  5CQN X;  1MP3 A;  4EEM A;  1LZ7 A;  1I52 A;  1VZT A;  1LZ0 A;  4HO6 A;  2OI6 A;  2VS5 A;  4KT7 A;  1VGU A;  4G3P A;  1FOA A;  5C4E A;  1Z90 A;  3D5N A;  5C4C A;  2FYB A;  1GA8 A;  1MP5 A;  2Y4K A;  3K8D A;  1H4E A;  1G23 A;  1TZF A;  2X60 A;  3OH2 A;  4B2W A;  3V0L A;  1FXJ A;  4CJB A;  2FYD B;  2RJ0 A;  1ZCV A;  3OH4 A;  4XWI A;  1INJ A;  1VZU A;  5EJ1 A;  2Y7A A;  4D11 A;  1VH3 A;  3EE5 A;  1H5T A;  4D0T A;  3I0H A;  3ZLL A;  3U0X A;  4P02 A;  4J18 A;  2YCM A;  1G3L A;  4UEG A;  3SXA A;  2YES A;  5C3D A;  1H7F A;  4EE3 A;  5CQL X;  4LW3 A;  1TW5 A;  2RJ6 A;  3TQD A;  3OH0 A;  2YQH A;  1G2V A;  1GX4 A;  2BO8 A;  4JD0 A;  4B2X A;  3JUJ A;  1HM8 A;  3V90 A;  2CU2 A;  4KC1 A;  1ZIZ A;  1H7G A;  1VM8 A;  1QGQ A;  3OAM A;  4D11 C;  4E1K A;  4GBP A;  1YP3 A;  3I0L A;  4DE7 A;  4AC3 A;  4K6R A;  4NAN A;  2ZU8 A;  3CKO A;  3CU0 A;  3SXG A;  4IRQ A;  4FRB A;  1H5R B;  2PGV A;  4KC2 A;  3U0Y A;  1FR9 A;  2AES A;  1ZI1 A;  1FRW A;  3Q7U A;  1G97 A;  3SXD A; 
#chains in the Genus database with same CATH topology
 1NHE B;  3U2X A;  2A8U A;  3I0D A;  3POL A;  4HO4 A;  5IDT A;  2VFZ A;  3IOJ A;  4HO9 A;  5J49 A;  1ON6 A;  2VXL A;  1FWY A;  4Y6U A;  2D7I A;  4M2A A;  3E26 A;  1S4N A;  3HL3 A;  1NF5 B;  1OQM B;  4B4B A;  4HOC A;  1OMZ A;  2RJ5 A;  4Y7U A;  1G1L A;  3QVB A;  2RIT A;  2I5K A;  5FU8 A;  1S4P A;  1G93 A;  5CQM X;  5FUH A;  2ZU9 A;  2A8W A;  4B5B A;  2QH5 A;  2VSH A;  4HO5 A;  5JQQ A;  2JCJ A;  1SS9 A;  4FCE A;  4ZDQ A;  5IFY A;  4EEA A;  4HO0 A;  1W55 A;  2X65 A;  3I0C A;  2WVK A;  3V0P A;  1R7T A;  1E5K A;  2VK9 A;  4KNX A;  1NWG B;  1PZY B;  1VZX A;  3PKQ A;  3R3I A;  4FIX A;  4G3Q A;  1ZCT A;  5FTS A;  2P72 A;  2WE9 A;  4ASY A;  1R7U A;  1FXO A;  2VSI A;  4AYJ A;  2P6W A;  1NMM B;  2BO7 A;  4FRA A;  5C38 A;  4KNR A;  4O6N A;  2P73 A;  2Y4L A;  2QGI A;  1HJJ A;  2OI5 A;  3Q4S A;  4HO3 A;  2MZB A;  5C1G A;  4G3S A;  1R7X A;  4B42 A;  2WVM A;  2RJ4 A;  2AE7 A;  3V0O A;  1K4V A;  1VGW A;  3Q80 A;  5C4F A;  5L6S A;  5FV9 A;  3T7N A;  5C48 A;  1H5S A;  4KQL A;  1ZHJ A;  4NAK A;  1ZCU A;  1H7E A;  3SX3 A;  2DPW A;  2VS3 A;  2RJ9 A;  3I0I X;  1ZI4 A;  2ICY A;  4IRP A;  1GQC A;  4Y62 A;  1ZI5 A;  1ZJP A;  5CQO A;  5FU0 A;  3T7M A;  3I0J A;  2AM5 A;  2Q4J A;  1GWV A;  3I0F A;  4CJC A;  1LL0 A;  4Y64 A;  1WT3 A;  5C8R A;  1JV3 A;  1EZI A;  5C49 A;  4O6M A;  2X5Z A;  5DDT A;  2PGY A;  1ZJ3 A;  5AJP A;  2V0L A;  1G95 A;  1FZW A;  2Z87 A;  3SX5 A;  4Y9X A;  3V8Y A;  1VGT A;  1WT1 A;  2V0K A;  2YQS A;  2FY7 A;  1ON8 A;  4EEG A;  4YS8 A;  1JVG A;  1WVC A;  1LZJ A;  1H5S C;  1NKH B;  2RJ1 A;  3JTJ A;  4M2B A;  2XMH A;  2RIY A;  3SXC A;  4NAI A;  5C1H A;  4ARW A;  4FQW A;  1FO9 A;  2O1H A;  5AJO A;  4FRD A;  4FCU A;  4L41 C;  1O7O A;  5C3A A;  1H7T A;  3TZT A;  1H7L A;  3V0Q A;  1VH1 A;  2GGO A;  2C0N A;  4NAL A;  4Q7C A;  4ECM A;  5C1L A;  1H7H A;  3CKJ A;  1FO8 A;  2FYA A;  3R2W A;  4Y7V A;  4BMA A;  1ZJ2 A;  3SX8 A;  2FFV A;  2WAW A;  3IOI A;  3D8V A;  1R7Y A;  2J0B A;  4EVW A;  1GX0 A;  2W0V A;  1JYK A;  2BO6 A;  2V0J A;  1OMX A;  3PKP A;  5HS2 A;  3KIA A;  1VPA A;  1ZJO A;  3D98 A;  1IIN A;  1V83 A;  1O23 B;  2PX7 A;  3I0E A;  3U2W A;  4FRE A;  1H5R A;  3CGX A;  2JCK A;  3RSB A;  4Y63 A;  5C47 A;  2GGQ A;  3DUV A;  2BO4 A;  2VXM A;  2Y6P A;  1ZDG A;  1XHB A;  3BCV A;  3RMW A;  2AEC A;  2WVL A;  4B4M A;  1R82 A;  2RIX A;  5C3B A;  4EEO A;  4CVH A;  4Y7F A;  2RJ8 A;  2QKX A;  2O1F A;  3OKR A;  5AJN A;  2WEE A;  5FTV A;  2RJ7 A;  2XWN A;  4Y7T A;  3NGW A;  2W0W A;  3IOH A;  2YQJ A;  4HCQ A;  1YP4 A;  4FRP A;  3JUK A;  4BQH A;  3BRK X;  4FRQ A;  3OH1 A;  3U2V A;  2V0I A;  1INI A;  3O3P A;  1G8O A;  1FR8 A;  2XME A;  4ASJ A;  1MP4 A;  2D0J A;  3E25 A;  4KPZ A;  5BXC A;  3SPT A;  1JYL A;  1H5S D;  3LW6 A;  4MND A;  1H5T B;  3DK5 A;  3V0N A;  3SXB A;  3OC9 A;  5D92 A;  2FFU A;  1HM0 A;  4LW6 A;  2YC5 A;  3DJ4 A;  1G0R A;  3SX7 A;  2OEF A;  5CMF X;  2E3D A;  4Y7G A;  4DEC A;  4EE4 A;  1R80 A;  4Y6N A;  5DDV A;  1FG5 N;  1FGX A;  3F1C A;  3ZF8 A;  1KWS A;  1JV1 A;  1WT2 A;  1VGZ A;  4MIX A;  3CKQ A;  1NQI B;  5CMH A;  4P00 A;  3V8Z A;  4D48 A;  5C4D A;  2I7B A;  5IDS A;  4AAW A;  1O0R A;  1YRO B;  4B4G A;  2FYC B;  4FIY A;  4C2S A;  1G9R A;  1W57 A;  2D7R A;  4MYB A;  1JVD A;  2NXV A;  1S4O A;  4KRV A;  2AM3 A;  3SXE A;  3ZGF A;  1FGG A;  3FOQ A;  3V91 A;  2RIZ A;  1PZT A;  5D91 A;  1R81 A;  1LZI A;  1YP2 A;  2YC3 A;  4HO8 A;  1LVW A;  2Y4J A;  2V0H A;  2ZU7 A;  5C36 A;  3ST8 A;  1ZI3 A;  1LL3 A;  4FRM A;  4B3U A;  4JIS A;  3CKN A;  3USR A;  2XWL A;  1H7Q A;  2Y4M A;  1TW1 A;  2AM4 A;  5CMJ A;  3GUE A;  5C4B A;  2APC A;  4FRO A;  1WSZ A;  2UX8 A;  2ICX A;  4KPX A;  1O7Q A;  3OH3 A;  2OI7 A;  1GQ9 A;  4D0Z A;  5I1F A;  3RMV A;  2OEG A;  2PA4 A;  2E8B A;  4DDZ A;  1QGS A;  3I0K A;  5FYE A;  3K8E A;  1HJL A;  1H4D A;  4KXO A;  1QWJ A;  3PNN A;  2X5S A;  5CMI A;  2JCL A;  4EE5 A;  4M4K A;  2O1G A;  1EYR A;  1ZJ0 A;  2WGZ A;  5CMG X;  1ZJ1 A;  4M28 A;  2AGD A;  4R7P A;  1QG8 A;  3U2T A;  1IIM A;  1VIC A;  3CKV A;  3V0M A;  1H4C A;  5EJZ A;  1WT0 A;  1V82 A;  3ZGG A;  1H3M A;  1ZCY A;  2I5E A;  2J0A A;  1HV9 A;  2Z86 A;  3N9W A;  4HG6 A;  3I0G A;  2AH9 A;  4KC4 A;  5L6V A;  1MC3 A;  1HM9 A;  1V84 A;  2JCO A;  1GWW A;  4FRL A;  3FWW A;  3ZLK A;  2YQC A;  4HO2 A;  1LL2 A;  4CJ8 A;  5CQP A;  1ZDF A;  4AYL A;  3OGZ A;  2VS4 A;  3U2U A;  1XZ6 A;  1R7V A;  5EIY A;  1W77 A;  2XWM A;  3F1Y A;  3T7O A;  3USQ A;  4G87 A;  1TVY A;  2VD4 A;  4FRH A;  1H5S B;  5CQN X;  1MP3 A;  4EEM A;  1LZ7 A;  1I52 A;  1VZT A;  1LZ0 A;  4HO6 A;  2OI6 A;  2VS5 A;  4KT7 A;  1VGU A;  4G3P A;  1FOA A;  5C4E A;  1Z90 A;  3D5N A;  5C4C A;  2FYB A;  1GA8 A;  1MP5 A;  2Y4K A;  3K8D A;  1H4E A;  1G23 A;  1TZF A;  2X60 A;  3OH2 A;  4B2W A;  3V0L A;  1FXJ A;  4CJB A;  2FYD B;  2RJ0 A;  1ZCV A;  3OH4 A;  4XWI A;  1INJ A;  1VZU A;  5EJ1 A;  2Y7A A;  4D11 A;  1VH3 A;  3EE5 A;  1H5T A;  4D0T A;  3I0H A;  3ZLL A;  3U0X A;  4P02 A;  4J18 A;  2YCM A;  1G3L A;  4UEG A;  3SXA A;  2YES A;  5C3D A;  1H7F A;  4EE3 A;  5CQL X;  4LW3 A;  1TW5 A;  2RJ6 A;  3TQD A;  3OH0 A;  2YQH A;  1G2V A;  1GX4 A;  2BO8 A;  4JD0 A;  4B2X A;  3JUJ A;  1HM8 A;  3V90 A;  2CU2 A;  4KC1 A;  1ZIZ A;  1H7G A;  1VM8 A;  1QGQ A;  3OAM A;  4D11 C;  4E1K A;  4GBP A;  1YP3 A;  3I0L A;  4DE7 A;  4AC3 A;  4K6R A;  4NAN A;  2ZU8 A;  3CKO A;  3CU0 A;  3SXG A;  4IRQ A;  4FRB A;  1H5R B;  2PGV A;  4KC2 A;  3U0Y A;  1FR9 A;  2AES A;  1ZI1 A;  1FRW A;  3Q7U A;  1G97 A;  3SXD A; 
#chains in the Genus database with same CATH homology
 1NHE B;  3U2X A;  2A8U A;  3I0D A;  3POL A;  4HO4 A;  5IDT A;  2VFZ A;  3IOJ A;  4HO9 A;  5J49 A;  1ON6 A;  2VXL A;  1FWY A;  4Y6U A;  2D7I A;  4M2A A;  3E26 A;  1S4N A;  3HL3 A;  1NF5 B;  1OQM B;  4B4B A;  4HOC A;  1OMZ A;  2RJ5 A;  4Y7U A;  1G1L A;  3QVB A;  2RIT A;  2I5K A;  5FU8 A;  1S4P A;  1G93 A;  5CQM X;  5FUH A;  2ZU9 A;  2A8W A;  4B5B A;  2QH5 A;  2VSH A;  4HO5 A;  5JQQ A;  2JCJ A;  1SS9 A;  4FCE A;  4ZDQ A;  5IFY A;  4EEA A;  4HO0 A;  1W55 A;  2X65 A;  3I0C A;  2WVK A;  3V0P A;  1R7T A;  1E5K A;  2VK9 A;  4KNX A;  1NWG B;  1PZY B;  1VZX A;  3PKQ A;  3R3I A;  4FIX A;  4G3Q A;  1ZCT A;  5FTS A;  2P72 A;  2WE9 A;  4ASY A;  1R7U A;  1FXO A;  2VSI A;  4AYJ A;  2P6W A;  1NMM B;  2BO7 A;  4FRA A;  5C38 A;  4KNR A;  4O6N A;  2P73 A;  2Y4L A;  2QGI A;  1HJJ A;  2OI5 A;  3Q4S A;  4HO3 A;  2MZB A;  5C1G A;  4G3S A;  1R7X A;  4B42 A;  2WVM A;  2RJ4 A;  2AE7 A;  3V0O A;  1K4V A;  1VGW A;  3Q80 A;  5C4F A;  5L6S A;  5FV9 A;  3T7N A;  5C48 A;  1H5S A;  4KQL A;  1ZHJ A;  4NAK A;  1ZCU A;  1H7E A;  3SX3 A;  2DPW A;  2VS3 A;  2RJ9 A;  3I0I X;  1ZI4 A;  2ICY A;  4IRP A;  1GQC A;  4Y62 A;  1ZI5 A;  1ZJP A;  5CQO A;  5FU0 A;  3T7M A;  3I0J A;  2AM5 A;  2Q4J A;  1GWV A;  3I0F A;  4CJC A;  1LL0 A;  4Y64 A;  1WT3 A;  5C8R A;  1JV3 A;  1EZI A;  5C49 A;  4O6M A;  2X5Z A;  5DDT A;  2PGY A;  1ZJ3 A;  5AJP A;  2V0L A;  1G95 A;  1FZW A;  2Z87 A;  3SX5 A;  4Y9X A;  3V8Y A;  1VGT A;  1WT1 A;  2V0K A;  2YQS A;  2FY7 A;  1ON8 A;  4EEG A;  4YS8 A;  1JVG A;  1WVC A;  1LZJ A;  1H5S C;  1NKH B;  2RJ1 A;  3JTJ A;  4M2B A;  2XMH A;  2RIY A;  3SXC A;  4NAI A;  5C1H A;  4ARW A;  4FQW A;  1FO9 A;  2O1H A;  5AJO A;  4FRD A;  4FCU A;  4L41 C;  1O7O A;  5C3A A;  1H7T A;  3TZT A;  1H7L A;  3V0Q A;  1VH1 A;  2GGO A;  2C0N A;  4NAL A;  4Q7C A;  4ECM A;  5C1L A;  1H7H A;  3CKJ A;  1FO8 A;  2FYA A;  3R2W A;  4Y7V A;  4BMA A;  1ZJ2 A;  3SX8 A;  2FFV A;  2WAW A;  3IOI A;  3D8V A;  1R7Y A;  2J0B A;  4EVW A;  1GX0 A;  2W0V A;  1JYK A;  2BO6 A;  2V0J A;  1OMX A;  3PKP A;  5HS2 A;  3KIA A;  1VPA A;  1ZJO A;  3D98 A;  1IIN A;  1V83 A;  1O23 B;  2PX7 A;  3I0E A;  3U2W A;  4FRE A;  1H5R A;  3CGX A;  2JCK A;  3RSB A;  4Y63 A;  5C47 A;  2GGQ A;  3DUV A;  2BO4 A;  2VXM A;  2Y6P A;  1ZDG A;  1XHB A;  3BCV A;  3RMW A;  2AEC A;  2WVL A;  4B4M A;  1R82 A;  2RIX A;  5C3B A;  4EEO A;  4CVH A;  4Y7F A;  2RJ8 A;  2QKX A;  2O1F A;  3OKR A;  5AJN A;  2WEE A;  5FTV A;  2RJ7 A;  2XWN A;  4Y7T A;  3NGW A;  2W0W A;  3IOH A;  2YQJ A;  4HCQ A;  1YP4 A;  4FRP A;  3JUK A;  4BQH A;  3BRK X;  4FRQ A;  3OH1 A;  3U2V A;  2V0I A;  1INI A;  3O3P A;  1G8O A;  1FR8 A;  2XME A;  4ASJ A;  1MP4 A;  2D0J A;  3E25 A;  4KPZ A;  5BXC A;  3SPT A;  1JYL A;  1H5S D;  3LW6 A;  4MND A;  1H5T B;  3DK5 A;  3V0N A;  3SXB A;  3OC9 A;  5D92 A;  2FFU A;  1HM0 A;  4LW6 A;  2YC5 A;  3DJ4 A;  1G0R A;  3SX7 A;  2OEF A;  5CMF X;  2E3D A;  4Y7G A;  4DEC A;  4EE4 A;  1R80 A;  4Y6N A;  5DDV A;  1FG5 N;  1FGX A;  3F1C A;  3ZF8 A;  1KWS A;  1JV1 A;  1WT2 A;  1VGZ A;  4MIX A;  3CKQ A;  1NQI B;  5CMH A;  4P00 A;  3V8Z A;  4D48 A;  5C4D A;  2I7B A;  5IDS A;  4AAW A;  1O0R A;  1YRO B;  4B4G A;  2FYC B;  4FIY A;  4C2S A;  1G9R A;  1W57 A;  2D7R A;  4MYB A;  1JVD A;  2NXV A;  1S4O A;  4KRV A;  2AM3 A;  3SXE A;  3ZGF A;  1FGG A;  3FOQ A;  3V91 A;  2RIZ A;  1PZT A;  5D91 A;  1R81 A;  1LZI A;  1YP2 A;  2YC3 A;  4HO8 A;  1LVW A;  2Y4J A;  2V0H A;  2ZU7 A;  5C36 A;  3ST8 A;  1ZI3 A;  1LL3 A;  4FRM A;  4B3U A;  4JIS A;  3CKN A;  3USR A;  2XWL A;  1H7Q A;  2Y4M A;  1TW1 A;  2AM4 A;  5CMJ A;  3GUE A;  5C4B A;  2APC A;  4FRO A;  1WSZ A;  2UX8 A;  2ICX A;  4KPX A;  1O7Q A;  3OH3 A;  2OI7 A;  1GQ9 A;  4D0Z A;  5I1F A;  3RMV A;  2OEG A;  2PA4 A;  2E8B A;  4DDZ A;  1QGS A;  3I0K A;  5FYE A;  3K8E A;  1HJL A;  1H4D A;  4KXO A;  1QWJ A;  3PNN A;  2X5S A;  5CMI A;  2JCL A;  4EE5 A;  4M4K A;  2O1G A;  1EYR A;  1ZJ0 A;  2WGZ A;  5CMG X;  1ZJ1 A;  4M28 A;  2AGD A;  4R7P A;  1QG8 A;  3U2T A;  1IIM A;  1VIC A;  3CKV A;  3V0M A;  1H4C A;  5EJZ A;  1WT0 A;  1V82 A;  3ZGG A;  1H3M A;  1ZCY A;  2I5E A;  2J0A A;  1HV9 A;  2Z86 A;  3N9W A;  4HG6 A;  3I0G A;  2AH9 A;  4KC4 A;  5L6V A;  1MC3 A;  1HM9 A;  1V84 A;  2JCO A;  1GWW A;  4FRL A;  3FWW A;  3ZLK A;  2YQC A;  4HO2 A;  1LL2 A;  4CJ8 A;  5CQP A;  1ZDF A;  4AYL A;  3OGZ A;  2VS4 A;  3U2U A;  1XZ6 A;  1R7V A;  5EIY A;  1W77 A;  2XWM A;  3F1Y A;  3T7O A;  3USQ A;  4G87 A;  1TVY A;  2VD4 A;  4FRH A;  1H5S B;  5CQN X;  1MP3 A;  4EEM A;  1LZ7 A;  1I52 A;  1VZT A;  1LZ0 A;  4HO6 A;  2OI6 A;  2VS5 A;  4KT7 A;  1VGU A;  4G3P A;  1FOA A;  5C4E A;  1Z90 A;  3D5N A;  5C4C A;  2FYB A;  1GA8 A;  1MP5 A;  2Y4K A;  3K8D A;  1H4E A;  1G23 A;  1TZF A;  2X60 A;  3OH2 A;  4B2W A;  3V0L A;  1FXJ A;  4CJB A;  2FYD B;  2RJ0 A;  1ZCV A;  3OH4 A;  4XWI A;  1INJ A;  1VZU A;  5EJ1 A;  2Y7A A;  4D11 A;  1VH3 A;  3EE5 A;  1H5T A;  4D0T A;  3I0H A;  3ZLL A;  3U0X A;  4P02 A;  4J18 A;  2YCM A;  1G3L A;  4UEG A;  3SXA A;  2YES A;  5C3D A;  1H7F A;  4EE3 A;  5CQL X;  4LW3 A;  1TW5 A;  2RJ6 A;  3TQD A;  3OH0 A;  2YQH A;  1G2V A;  1GX4 A;  2BO8 A;  4JD0 A;  4B2X A;  3JUJ A;  1HM8 A;  3V90 A;  2CU2 A;  4KC1 A;  1ZIZ A;  1H7G A;  1VM8 A;  1QGQ A;  3OAM A;  4D11 C;  4E1K A;  4GBP A;  1YP3 A;  3I0L A;  4DE7 A;  4AC3 A;  4K6R A;  4NAN A;  2ZU8 A;  3CKO A;  3CU0 A;  3SXG A;  4IRQ A;  4FRB A;  1H5R B;  2PGV A;  4KC2 A;  3U0Y A;  1FR9 A;  2AES A;  1ZI1 A;  1FRW A;  3Q7U A;  1G97 A;  3SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...