5JQQA

Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis - apo form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
276
Chain Sequence
TTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLDYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis - apo form
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Transferase
total genus 92
structure length 276
sequence length 299
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5jqqA00
2OI7A 1ZJPA 5FU0A 2O1FA 4HO3A 3IOJA 4ECMA 4D11A 1MC3A 4C2SA 3K8EA 1H4EA 1ZHJA 4NALA 4D0ZA 2RITA 3K8DA 2X60A 4CJBA 3U0YA 1VGUA 3OGZA 2AE7A 4EEGA 1V84A 2YQSA 1NQIB 1ZIZA 3Q80A 1HM9A 4IRPA 4ARWA 5EIYA 5IDSA 5CQLX 3V8ZA 2RIXA 4YS8A 2RJ8A 2AESA 4AYLA 3I0CA 1ZI5A 3F1CA 2WVMA 4KC1A 5AJPA 5AJNA 2NXVA 2W0WA 1MP4A 1GWWA 1LZIA 1TVYA 2ZU9A 2AM4A 1VGWA 1ZCUA 2VD4A 3ZGFA 1GQ9A 3V0NA 4KNRA 5C4FA 1LVWA 1H5RA 2RJ5A 3U2VA 5FV9A 4LW6A 3U2UA 2Y6PA 4KC4A 1KWSA 1HM0A 2E8BA 4B4MA 1QG8A 4B5BA 1HJJA 2PA4A 2X5SA 3DUVA 4GBPA 1H7LA 2YC5A 4BMAA 2A8UA 5J49A 1G9RA 1NWGB 1V82A 1ZJ1A 4E1KA 5C4CA 4HO9A 1JYKA 1FR8A 1NMMB 3I0GA 3OH1A 1FG5N 3CKJA 4ASJA 1ZJ2A 3USQA 3FWWA 3PNNA 2JCLA 1XHBA 5CQNX 3OH3A 2V0IA 4Y7FA 2X5ZA 5C47A 1G23A 1TZFA 3ZF8A 1H5TB 1VZXA 3T7NA 3POLA 2JCJA 3SXDA 4FCUA 1G93A 2YESA 1FXJA 1YP3A 4KQLA 3ZLLA 2PX7A 4Y7UA 1WSZA 2D7RA 1ZCTA 3U2WA 4Y7TA 4EVWA 1G0RA 3SX8A 4EE5A 5IDTA 1IIMA 1LL3A 2P6WA 3TZTA 2VXMA 1YP2A 5C3DA 2V0LA 2XMEA 4G3SA 1O7QA 1W55A 2YC3A 3ZLKA 2AGDA 3SPTA 4CVHA 1H7QA 5FTVA 4BQHA 2UX8A 3OKRA 4UEGA 1JYLA 1INJA 3QVBA 5CQOA 2WVKA 1ZCYA 3R2WA 3I0IX 1ZDFA 1XZ6A 1GA8A 3T7OA 1HJLA 3SXEA 5C4BA 1VH1A 2RIZA 3JTJA 2AH9A 2AM3A 4Y7GA 2V0KA 3PKQA 1ZI3A 1ON8A 2JCKA 4AAWA 2XWMA 1TW1A 3V0QA 3I0JA 2AECA 3TQDA 3V0PA 4B3UA 2V0HA 2WE9A 4XWIA 1R7UA 4D48A 1H7TA 3I0DA 4KC2A 2V0JA 1MP3A 5C48A 1E5KA 2BO7A 1H4DA 5C1LA 3T7MA 1QWJA 1LL2A 4FRHA 4HO6A 2VSIA 2Y4MA 5C38A 1JVGA 3KIAA 3OH2A 3FOQA 1H5TA 4Y9XA 1FO9A 2BO4A 2O1GA 2VFZA 4B2WA 4FCEA 2VS5A 2ZU7A 2AM5A 2QGIA 3ZGGA 1H5SB 3I0LA 3IOHA 4FRBA 2YQCA 5CMIA 5BXCA 5DDTA 2WEEA 3CKNA 3ST8A 1WT3A 1K4VA 4DE7A 3OH0A 5AJOA 5C4DA 2I5KA 3GUEA 2GGQA 1OMXA 1S4PA 1SS9A 2Y7AA 2JCOA 1NF5B 2XWLA 4IRQA 1FR9A 1R82A 3I0FA 1V83A 4FREA 3RMWA 1R7YA 3CKOA 2E3DA 1H7HA 1R80A 3PKPA 4Y64A 1G95A 2W0VA 1EZIA 1GX4A 4DECA 1R7VA 1NKHB 1ZDGA 2QKXA 4FRMA 1H3MA 2RJ4A 3E26A 1JVDA 1VH3A 1ZJOA 4FROA 1ZCVA 2GGOA 1G97A 2FYCB 4DDZA 4CJCA 3V8YA 1O23B 1GQCA 1WT2A 5CMGX 5C1HA 4AC3A 1GWVA 2BO6A 2Y4KA 4HO5A 4R7PA 3CKVA 4ZDQA 1YROB 2FYBA 4L41C 5L6SA 3I0HA 4EEOA 1HV9A 5FYEA 3N9WA 1VZUA 3HL3A 4NAKA 2WVLA 4JISA 1PZTA 4NANA 5C4EA 1OQMB 3SXGA 1H4CA 2I5EA 4KXOA 4KNXA 1MP5A 1VZTA 1FGXA 3USRA 1FRWA 2PGVA 4FRDA 3SXBA 3CKQA 3V0MA 2RJ9A 4Y63A 1W57A 4K6RA 3SXCA 1H5SA 2PGYA 3U0XA 3D5NA 4HOCA 4ASYA 2RJ6A 2OEGA 3NGWA 4HO8A 5L6VA 1HM8A 4G3QA 4B2XA 3JUKA 2WAWA 2Y4JA 5HS2A 2OI6A 2RIYA 4B4GA 2D7IA 2XMHA 3CGXA 1QGSA 2ZU8A 5I1FA 2P72A 1ZI4A 2P73A 1FXOA 3DJ4A 3F1YA 1FO8A 4NAIA 4D11C 2D0JA 4EEAA 1LZ0A 1VICA 2CU2A 3I0EA 5C49A 3EE5A 1R81A 3SX7A 3OH4A 1WT1A 3BRKX 4CJ8A 1VM8A 1G1LA 2Z86A 3CU0A 1ON6A 4KPZA 5FUHA 1O0RA 4KRVA 3D98A 3OAMA 5EJZA 1JV3A 3I0KA 4HCQA 1I52A 2RJ7A 1H7GA 3U2XA 1IINA 1JV1A 5CMJA 3SX3A 1H7EA 1YP4A 2I7BA 1H7FA 4P02A 5C8RA 5CMHA 2DPWA 4EE3A 5C36A 1INIA 2ICXA 4M28A 2OEFA 4M2AA 3LW6A 5C3AA 1GX0A 1W77A 1TW5A 1VGTA 2O1HA 1PZYB 4KPXA 3E25A 1LZ7A 1FZWA 4M4KA 1EYRA 2APCA 1G3LA 4HO0A 1R7XA 3RMVA 4MNDA 2RJ0A 1R7TA 2X65A 1WVCA 3BCVA 2ICYA 2XWNA 2FYAA 1LL0A 3OC9A 1S4NA 4AYJA 4EE4A 1ZJ3A 5FU8A 3Q7UA 1LZJA 4KT7A 4FRAA 4Y62A 1FOAA 1H5SD 4FQWA 4Y6NA 5IFYA 3V91A 3IOIA 5CQMX 4B4BA 2VS4A 2FFVA 5FTSA 1QGQA 1G2VA 5EJ1A 4P00A 4FRPA 3RSBA 4J18A 1ZJ0A 2FY7A 5JQQA 2FFUA 2Y4LA 1Z90A 2Q4JA 4EEMA 2YCMA 2Z87A 5DDVA 4HO4A 2A8WA 2BO8A 1ZI1A 1FWYA 2VSHA 4Y7VA 4B42A 1H5RB 3V0LA 5CQPA 1VGZA 5C3BA 3V90A 1WT0A 5C1GA 3SX5A 2VS3A 4G3PA 4JD0A 4HG6A 1O7OA 4M2BA 3SXAA 2FYDB 3D8VA 2MZBA 3DK5A 1NHEB 2OI5A 2VXLA 4G87A 4Y6UA 3Q4SA 1VPAA 1G8OA 4LW3A 3V0OA 4FRLA 2YQJA 2QH5A 1OMZA 2RJ1A 1S4OA 2YQHA 4FRQA 3U2TA 4MYBA 1FGGA 4D0TA 1H5SC 5CMFX 4HO2A 3O3PA 3R3IA 3JUJA 2WGZA
chains in the Genus database with same CATH superfamily
2OI7A 1ZJPA 5FU0A 2O1FA 4HO3A 3IOJA 4ECMA 4D11A 1MC3A 4C2SA 3K8EA 1H4EA 1ZHJA 4NALA 4D0ZA 2RITA 3K8DA 2X60A 4CJBA 3U0YA 1VGUA 3OGZA 2AE7A 4EEGA 1V84A 2YQSA 1NQIB 1ZIZA 3Q80A 1HM9A 4IRPA 4ARWA 5EIYA 5IDSA 5CQLX 3V8ZA 2RIXA 4YS8A 2RJ8A 2AESA 4AYLA 3I0CA 1ZI5A 3F1CA 2WVMA 4KC1A 5AJPA 5AJNA 2NXVA 2W0WA 1MP4A 1GWWA 1LZIA 1TVYA 2ZU9A 2AM4A 1VGWA 1ZCUA 2VD4A 3ZGFA 1GQ9A 3V0NA 4KNRA 5C4FA 1LVWA 1H5RA 2RJ5A 3U2VA 5FV9A 4LW6A 3U2UA 2Y6PA 4KC4A 1KWSA 1HM0A 2E8BA 5D91A 4B4MA 1QG8A 4B5BA 1HJJA 2PA4A 2X5SA 3DUVA 4GBPA 1H7LA 2YC5A 4BMAA 2A8UA 5J49A 1G9RA 1NWGB 1V82A 1ZJ1A 4E1KA 5C4CA 4HO9A 1JYKA 1FR8A 1NMMB 3I0GA 3OH1A 1FG5N 3CKJA 4ASJA 1ZJ2A 3USQA 3FWWA 3PNNA 2JCLA 1XHBA 5CQNX 3OH3A 2V0IA 4Y7FA 2X5ZA 5C47A 1G23A 1TZFA 2VK9A 3ZF8A 1H5TB 1VZXA 3T7NA 3POLA 2JCJA 3SXDA 4FCUA 1G93A 2YESA 1FXJA 1YP3A 2J0AA 4KQLA 3ZLLA 2PX7A 4Y7UA 1WSZA 2D7RA 1ZCTA 3U2WA 4Y7TA 4EVWA 1G0RA 3SX8A 4EE5A 5IDTA 1IIMA 1LL3A 2P6WA 3TZTA 2VXMA 1YP2A 5C3DA 2V0LA 2XMEA 4G3SA 1O7QA 1W55A 2YC3A 3ZLKA 2AGDA 3SPTA 4CVHA 1H7QA 5FTVA 4BQHA 2UX8A 3OKRA 4UEGA 1JYLA 1INJA 5D92A 3QVBA 5CQOA 2WVKA 1ZCYA 3R2WA 3I0IX 1ZDFA 1XZ6A 1GA8A 3T7OA 1HJLA 3SXEA 5C4BA 1VH1A 2RIZA 3JTJA 2AH9A 2AM3A 4Y7GA 2V0KA 3PKQA 1ZI3A 1ON8A 2JCKA 4FIYA 4AAWA 2XWMA 1TW1A 3V0QA 3I0JA 2AECA 3TQDA 3V0PA 4B3UA 2V0HA 2WE9A 4XWIA 1R7UA 4D48A 1H7TA 3I0DA 4KC2A 2V0JA 1MP3A 5C48A 1E5KA 2BO7A 1H4DA 5C1LA 3T7MA 1QWJA 1LL2A 4FRHA 4HO6A 2VSIA 2C0NA 2J0BA 2Y4MA 5C38A 1JVGA 3KIAA 3OH2A 3FOQA 1H5TA 4Y9XA 1FO9A 2BO4A 2O1GA 2VFZA 4B2WA 4FCEA 2VS5A 2ZU7A 2AM5A 2QGIA 3ZGGA 1H5SB 3I0LA 3IOHA 4FRBA 2YQCA 5CMIA 5BXCA 5DDTA 2WEEA 3CKNA 3ST8A 1WT3A 1K4VA 4DE7A 3OH0A 5AJOA 5C4DA 2I5KA 3GUEA 2GGQA 1OMXA 1S4PA 1SS9A 4O6NA 2Y7AA 2JCOA 1NF5B 2XWLA 4IRQA 1FR9A 1R82A 3I0FA 1V83A 4FREA 3RMWA 1R7YA 3CKOA 2E3DA 1H7HA 1R80A 3PKPA 4Y64A 1G95A 2W0VA 1EZIA 1GX4A 4DECA 1R7VA 1NKHB 1ZDGA 2QKXA 4FRMA 1H3MA 2RJ4A 3E26A 1JVDA 1VH3A 1ZJOA 4FROA 1ZCVA 4FIXA 2GGOA 1G97A 2FYCB 4DDZA 4CJCA 3V8YA 1O23B 1GQCA 1WT2A 5CMGX 5C1HA 4AC3A 1GWVA 2BO6A 2Y4KA 4HO5A 4R7PA 3CKVA 4ZDQA 1YROB 2FYBA 4L41C 5L6SA 3I0HA 4EEOA 1HV9A 5FYEA 3N9WA 1VZUA 3HL3A 4NAKA 2WVLA 4JISA 1PZTA 4NANA 5C4EA 1OQMB 3SXGA 1H4CA 2I5EA 4KXOA 4KNXA 1MP5A 1VZTA 1FGXA 3USRA 1FRWA 2PGVA 4FRDA 3SXBA 3CKQA 3V0MA 2RJ9A 4Y63A 1W57A 4K6RA 3SXCA 1H5SA 2PGYA 3U0XA 3D5NA 4HOCA 4ASYA 2RJ6A 2OEGA 3NGWA 4HO8A 5L6VA 1HM8A 4G3QA 4B2XA 3JUKA 2WAWA 2Y4JA 5HS2A 2OI6A 2RIYA 4B4GA 2D7IA 2XMHA 3CGXA 1QGSA 2ZU8A 5I1FA 2P72A 1ZI4A 2P73A 1FXOA 3DJ4A 3F1YA 1FO8A 4NAIA 4D11C 2D0JA 4EEAA 1LZ0A 1VICA 2CU2A 3I0EA 5C49A 3EE5A 1R81A 3SX7A 3OH4A 1WT1A 4Q7CA 3BRKX 4CJ8A 1VM8A 1G1LA 2Z86A 3CU0A 1ON6A 4KPZA 5FUHA 1O0RA 4KRVA 3D98A 3OAMA 5EJZA 1JV3A 3I0KA 4HCQA 1I52A 2RJ7A 1H7GA 3U2XA 1IINA 1JV1A 5CMJA 3SX3A 1H7EA 1YP4A 2I7BA 1H7FA 4P02A 5C8RA 5CMHA 2DPWA 4EE3A 5C36A 1INIA 2ICXA 4M28A 2OEFA 4M2AA 3LW6A 5C3AA 1GX0A 1W77A 1TW5A 1VGTA 2O1HA 1PZYB 4KPXA 3E25A 1LZ7A 1FZWA 4M4KA 1EYRA 2APCA 1G3LA 4HO0A 1R7XA 3RMVA 4O6MA 4MNDA 2RJ0A 1R7TA 2X65A 1WVCA 3BCVA 2ICYA 2XWNA 2FYAA 1LL0A 3OC9A 1S4NA 4AYJA 4EE4A 1ZJ3A 5FU8A 3Q7UA 1LZJA 4KT7A 4FRAA 4Y62A 1FOAA 1H5SD 4FQWA 4MIXA 4Y6NA 5IFYA 3V91A 3IOIA 5CQMX 4B4BA 2VS4A 2FFVA 5FTSA 1QGQA 1G2VA 5EJ1A 4P00A 4FRPA 3RSBA 4J18A 1ZJ0A 2FY7A 5JQQA 2FFUA 2Y4LA 1Z90A 2Q4JA 4EEMA 2YCMA 2Z87A 5DDVA 4HO4A 2A8WA 2BO8A 1ZI1A 1FWYA 2VSHA 4Y7VA 4B42A 1H5RB 3V0LA 5CQPA 1VGZA 5C3BA 3V90A 1WT0A 5C1GA 3SX5A 2VS3A 4G3PA 4JD0A 4HG6A 1O7OA 4M2BA 3SXAA 2FYDB 3D8VA 2MZBA 3DK5A 1NHEB 2OI5A 2VXLA 4G87A 4Y6UA 3Q4SA 1VPAA 1G8OA 4LW3A 3V0OA 4FRLA 2YQJA 2QH5A 1OMZA 2RJ1A 1S4OA 2YQHA 4FRQA 3U2TA 4MYBA 1FGGA 4D0TA 1H5SC 5CMFX 4HO2A 3O3PA 3R3IA 3JUJA 2WGZA
chains in the Genus database with same CATH topology
2OI7A 1ZJPA 5FU0A 2O1FA 4HO3A 3IOJA 4ECMA 4D11A 1MC3A 4C2SA 3K8EA 1H4EA 1ZHJA 4NALA 4D0ZA 2RITA 3K8DA 2X60A 4CJBA 3U0YA 1VGUA 3OGZA 2AE7A 4EEGA 1V84A 2YQSA 1NQIB 1ZIZA 3Q80A 1HM9A 4IRPA 4ARWA 5EIYA 5IDSA 5CQLX 3V8ZA 2RIXA 4YS8A 2RJ8A 2AESA 4AYLA 3I0CA 1ZI5A 3F1CA 2WVMA 4KC1A 5AJPA 5AJNA 2NXVA 2W0WA 1MP4A 1GWWA 1LZIA 1TVYA 2ZU9A 2AM4A 1VGWA 1ZCUA 2VD4A 3ZGFA 1GQ9A 3V0NA 4KNRA 5C4FA 1LVWA 1H5RA 2RJ5A 3U2VA 5FV9A 4LW6A 3U2UA 2Y6PA 4KC4A 1KWSA 1HM0A 2E8BA 5D91A 4B4MA 1QG8A 4B5BA 1HJJA 2PA4A 2X5SA 3DUVA 4GBPA 1H7LA 2YC5A 4BMAA 2A8UA 5J49A 1G9RA 1NWGB 1V82A 1ZJ1A 4E1KA 5C4CA 4HO9A 1JYKA 1FR8A 1NMMB 3I0GA 3OH1A 1FG5N 3CKJA 4ASJA 1ZJ2A 3USQA 3FWWA 3PNNA 2JCLA 1XHBA 5CQNX 3OH3A 2V0IA 4Y7FA 2X5ZA 5C47A 1G23A 1TZFA 2VK9A 3ZF8A 1H5TB 1VZXA 3T7NA 3POLA 2JCJA 3SXDA 4FCUA 1G93A 2YESA 1FXJA 1YP3A 2J0AA 4KQLA 3ZLLA 2PX7A 4Y7UA 1WSZA 2D7RA 1ZCTA 3U2WA 4Y7TA 4EVWA 1G0RA 3SX8A 4EE5A 5IDTA 1IIMA 1LL3A 2P6WA 3TZTA 2VXMA 1YP2A 5C3DA 2V0LA 2XMEA 4G3SA 1O7QA 1W55A 2YC3A 3ZLKA 2AGDA 3SPTA 4CVHA 1H7QA 5FTVA 4BQHA 2UX8A 3OKRA 4UEGA 1JYLA 1INJA 5D92A 3QVBA 5CQOA 2WVKA 1ZCYA 3R2WA 3I0IX 1ZDFA 1XZ6A 1GA8A 3T7OA 1HJLA 3SXEA 5C4BA 1VH1A 2RIZA 3JTJA 2AH9A 2AM3A 4Y7GA 2V0KA 3PKQA 1ZI3A 1ON8A 2JCKA 4FIYA 4AAWA 2XWMA 1TW1A 3V0QA 3I0JA 2AECA 3TQDA 3V0PA 4B3UA 2V0HA 2WE9A 4XWIA 1R7UA 4D48A 1H7TA 3I0DA 4KC2A 2V0JA 1MP3A 5C48A 1E5KA 2BO7A 1H4DA 5C1LA 3T7MA 1QWJA 1LL2A 4FRHA 4HO6A 2VSIA 2C0NA 2J0BA 2Y4MA 5C38A 1JVGA 3KIAA 3OH2A 3FOQA 1H5TA 4Y9XA 1FO9A 2BO4A 2O1GA 2VFZA 4B2WA 4FCEA 2VS5A 2ZU7A 2AM5A 2QGIA 3ZGGA 1H5SB 3I0LA 3IOHA 4FRBA 2YQCA 5CMIA 5BXCA 5DDTA 2WEEA 3CKNA 3ST8A 1WT3A 1K4VA 4DE7A 3OH0A 5AJOA 5C4DA 2I5KA 3GUEA 2GGQA 1OMXA 1S4PA 1SS9A 4O6NA 2Y7AA 2JCOA 1NF5B 2XWLA 4IRQA 1FR9A 1R82A 3I0FA 1V83A 4FREA 3RMWA 1R7YA 3CKOA 2E3DA 1H7HA 1R80A 3PKPA 4Y64A 1G95A 2W0VA 1EZIA 1GX4A 4DECA 1R7VA 1NKHB 1ZDGA 2QKXA 4FRMA 1H3MA 2RJ4A 3E26A 1JVDA 1VH3A 1ZJOA 4FROA 1ZCVA 4FIXA 2GGOA 1G97A 2FYCB 4DDZA 4CJCA 3V8YA 1O23B 1GQCA 1WT2A 5CMGX 5C1HA 4AC3A 1GWVA 2BO6A 2Y4KA 4HO5A 4R7PA 3CKVA 4ZDQA 1YROB 2FYBA 4L41C 5L6SA 3I0HA 4EEOA 1HV9A 5FYEA 3N9WA 1VZUA 3HL3A 4NAKA 2WVLA 4JISA 1PZTA 4NANA 5C4EA 1OQMB 3SXGA 1H4CA 2I5EA 4KXOA 4KNXA 1MP5A 1VZTA 1FGXA 3USRA 1FRWA 2PGVA 4FRDA 3SXBA 3CKQA 3V0MA 2RJ9A 4Y63A 1W57A 4K6RA 3SXCA 1H5SA 2PGYA 3U0XA 3D5NA 4HOCA 4ASYA 2RJ6A 2OEGA 3NGWA 4HO8A 5L6VA 1HM8A 4G3QA 4B2XA 3JUKA 2WAWA 2Y4JA 5HS2A 2OI6A 2RIYA 4B4GA 2D7IA 2XMHA 3CGXA 1QGSA 2ZU8A 5I1FA 2P72A 1ZI4A 2P73A 1FXOA 3DJ4A 3F1YA 1FO8A 4NAIA 4D11C 2D0JA 4EEAA 1LZ0A 1VICA 2CU2A 3I0EA 5C49A 3EE5A 1R81A 3SX7A 3OH4A 1WT1A 4Q7CA 3BRKX 4CJ8A 1VM8A 1G1LA 2Z86A 3CU0A 1ON6A 4KPZA 5FUHA 1O0RA 4KRVA 3D98A 3OAMA 5EJZA 1JV3A 3I0KA 4HCQA 1I52A 2RJ7A 1H7GA 3U2XA 1IINA 1JV1A 5CMJA 3SX3A 1H7EA 1YP4A 2I7BA 1H7FA 4P02A 5C8RA 5CMHA 2DPWA 4EE3A 5C36A 1INIA 2ICXA 4M28A 2OEFA 4M2AA 3LW6A 5C3AA 1GX0A 1W77A 1TW5A 1VGTA 2O1HA 1PZYB 4KPXA 3E25A 1LZ7A 1FZWA 4M4KA 1EYRA 2APCA 1G3LA 4HO0A 1R7XA 3RMVA 4O6MA 4MNDA 2RJ0A 1R7TA 2X65A 1WVCA 3BCVA 2ICYA 2XWNA 2FYAA 1LL0A 3OC9A 1S4NA 4AYJA 4EE4A 1ZJ3A 5FU8A 3Q7UA 1LZJA 4KT7A 4FRAA 4Y62A 1FOAA 1H5SD 4FQWA 4MIXA 4Y6NA 5IFYA 3V91A 3IOIA 5CQMX 4B4BA 2VS4A 2FFVA 5FTSA 1QGQA 1G2VA 5EJ1A 4P00A 4FRPA 3RSBA 4J18A 1ZJ0A 2FY7A 5JQQA 2FFUA 2Y4LA 1Z90A 2Q4JA 4EEMA 2YCMA 2Z87A 5DDVA 4HO4A 2A8WA 2BO8A 1ZI1A 1FWYA 2VSHA 4Y7VA 4B42A 1H5RB 3V0LA 5CQPA 1VGZA 5C3BA 3V90A 1WT0A 5C1GA 3SX5A 2VS3A 4G3PA 4JD0A 4HG6A 1O7OA 4M2BA 3SXAA 2FYDB 3D8VA 2MZBA 3DK5A 1NHEB 2OI5A 2VXLA 4G87A 4Y6UA 3Q4SA 1VPAA 1G8OA 4LW3A 3V0OA 4FRLA 2YQJA 2QH5A 1OMZA 2RJ1A 1S4OA 2YQHA 4FRQA 3U2TA 4MYBA 1FGGA 4D0TA 1H5SC 5CMFX 4HO2A 3O3PA 3R3IA 3JUJA 2WGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI7 A;  1ZJP A;  5FU0 A;  2O1F A;  4HO3 A;  3IOJ A;  4ECM A;  4D11 A;  1MC3 A;  4C2S A;  3K8E A;  1H4E A;  1ZHJ A;  4NAL A;  4D0Z A;  2RIT A;  3K8D A;  2X60 A;  4CJB A;  3U0Y A;  1VGU A;  3OGZ A;  2AE7 A;  4EEG A;  1V84 A;  2YQS A;  1NQI B;  1ZIZ A;  3Q80 A;  1HM9 A;  4IRP A;  4ARW A;  5EIY A;  5IDS A;  5CQL X;  3V8Z A;  2RIX A;  4YS8 A;  2RJ8 A;  2AES A;  4AYL A;  3I0C A;  1ZI5 A;  3F1C A;  2WVM A;  4KC1 A;  5AJP A;  5AJN A;  2NXV A;  2W0W A;  1MP4 A;  1GWW A;  1LZI A;  1TVY A;  2ZU9 A;  2AM4 A;  1VGW A;  1ZCU A;  2VD4 A;  3ZGF A;  1GQ9 A;  3V0N A;  4KNR A;  5C4F A;  1LVW A;  1H5R A;  2RJ5 A;  3U2V A;  5FV9 A;  4LW6 A;  3U2U A;  2Y6P A;  4KC4 A;  1KWS A;  1HM0 A;  2E8B A;  4B4M A;  1QG8 A;  4B5B A;  1HJJ A;  2PA4 A;  2X5S A;  3DUV A;  4GBP A;  1H7L A;  2YC5 A;  4BMA A;  2A8U A;  5J49 A;  1G9R A;  1NWG B;  1V82 A;  1ZJ1 A;  4E1K A;  5C4C A;  4HO9 A;  1JYK A;  1FR8 A;  1NMM B;  3I0G A;  3OH1 A;  1FG5 N;  3CKJ A;  4ASJ A;  1ZJ2 A;  3USQ A;  3FWW A;  3PNN A;  2JCL A;  1XHB A;  5CQN X;  3OH3 A;  2V0I A;  4Y7F A;  2X5Z A;  5C47 A;  1G23 A;  1TZF A;  3ZF8 A;  1H5T B;  1VZX A;  3T7N A;  3POL A;  2JCJ A;  3SXD A;  4FCU A;  1G93 A;  2YES A;  1FXJ A;  1YP3 A;  4KQL A;  3ZLL A;  2PX7 A;  4Y7U A;  1WSZ A;  2D7R A;  1ZCT A;  3U2W A;  4Y7T A;  4EVW A;  1G0R A;  3SX8 A;  4EE5 A;  5IDT A;  1IIM A;  1LL3 A;  2P6W A;  3TZT A;  2VXM A;  1YP2 A;  5C3D A;  2V0L A;  2XME A;  4G3S A;  1O7Q A;  1W55 A;  2YC3 A;  3ZLK A;  2AGD A;  3SPT A;  4CVH A;  1H7Q A;  5FTV A;  4BQH A;  2UX8 A;  3OKR A;  4UEG A;  1JYL A;  1INJ A;  3QVB A;  5CQO A;  2WVK A;  1ZCY A;  3R2W A;  3I0I X;  1ZDF A;  1XZ6 A;  1GA8 A;  3T7O A;  1HJL A;  3SXE A;  5C4B A;  1VH1 A;  2RIZ A;  3JTJ A;  2AH9 A;  2AM3 A;  4Y7G A;  2V0K A;  3PKQ A;  1ZI3 A;  1ON8 A;  2JCK A;  4AAW A;  2XWM A;  1TW1 A;  3V0Q A;  3I0J A;  2AEC A;  3TQD A;  3V0P A;  4B3U A;  2V0H A;  2WE9 A;  4XWI A;  1R7U A;  4D48 A;  1H7T A;  3I0D A;  4KC2 A;  2V0J A;  1MP3 A;  5C48 A;  1E5K A;  2BO7 A;  1H4D A;  5C1L A;  3T7M A;  1QWJ A;  1LL2 A;  4FRH A;  4HO6 A;  2VSI A;  2Y4M A;  5C38 A;  1JVG A;  3KIA A;  3OH2 A;  3FOQ A;  1H5T A;  4Y9X A;  1FO9 A;  2BO4 A;  2O1G A;  2VFZ A;  4B2W A;  4FCE A;  2VS5 A;  2ZU7 A;  2AM5 A;  2QGI A;  3ZGG A;  1H5S B;  3I0L A;  3IOH A;  4FRB A;  2YQC A;  5CMI A;  5BXC A;  5DDT A;  2WEE A;  3CKN A;  3ST8 A;  1WT3 A;  1K4V A;  4DE7 A;  3OH0 A;  5AJO A;  5C4D A;  2I5K A;  3GUE A;  2GGQ A;  1OMX A;  1S4P A;  1SS9 A;  2Y7A A;  2JCO A;  1NF5 B;  2XWL A;  4IRQ A;  1FR9 A;  1R82 A;  3I0F A;  1V83 A;  4FRE A;  3RMW A;  1R7Y A;  3CKO A;  2E3D A;  1H7H A;  1R80 A;  3PKP A;  4Y64 A;  1G95 A;  2W0V A;  1EZI A;  1GX4 A;  4DEC A;  1R7V A;  1NKH B;  1ZDG A;  2QKX A;  4FRM A;  1H3M A;  2RJ4 A;  3E26 A;  1JVD A;  1VH3 A;  1ZJO A;  4FRO A;  1ZCV A;  2GGO A;  1G97 A;  2FYC B;  4DDZ A;  4CJC A;  3V8Y A;  1O23 B;  1GQC A;  1WT2 A;  5CMG X;  5C1H A;  4AC3 A;  1GWV A;  2BO6 A;  2Y4K A;  4HO5 A;  4R7P A;  3CKV A;  4ZDQ A;  1YRO B;  2FYB A;  4L41 C;  5L6S A;  3I0H A;  4EEO A;  1HV9 A;  5FYE A;  3N9W A;  1VZU A;  3HL3 A;  4NAK A;  2WVL A;  4JIS A;  1PZT A;  4NAN A;  5C4E A;  1OQM B;  3SXG A;  1H4C A;  2I5E A;  4KXO A;  4KNX A;  1MP5 A;  1VZT A;  1FGX A;  3USR A;  1FRW A;  2PGV A;  4FRD A;  3SXB A;  3CKQ A;  3V0M A;  2RJ9 A;  4Y63 A;  1W57 A;  4K6R A;  3SXC A;  1H5S A;  2PGY A;  3U0X A;  3D5N A;  4HOC A;  4ASY A;  2RJ6 A;  2OEG A;  3NGW A;  4HO8 A;  5L6V A;  1HM8 A;  4G3Q A;  4B2X A;  3JUK A;  2WAW A;  2Y4J A;  5HS2 A;  2OI6 A;  2RIY A;  4B4G A;  2D7I A;  2XMH A;  3CGX A;  1QGS A;  2ZU8 A;  5I1F A;  2P72 A;  1ZI4 A;  2P73 A;  1FXO A;  3DJ4 A;  3F1Y A;  1FO8 A;  4NAI A;  4D11 C;  2D0J A;  4EEA A;  1LZ0 A;  1VIC A;  2CU2 A;  3I0E A;  5C49 A;  3EE5 A;  1R81 A;  3SX7 A;  3OH4 A;  1WT1 A;  3BRK X;  4CJ8 A;  1VM8 A;  1G1L A;  2Z86 A;  3CU0 A;  1ON6 A;  4KPZ A;  5FUH A;  1O0R A;  4KRV A;  3D98 A;  3OAM A;  5EJZ A;  1JV3 A;  3I0K A;  4HCQ A;  1I52 A;  2RJ7 A;  1H7G A;  3U2X A;  1IIN A;  1JV1 A;  5CMJ A;  3SX3 A;  1H7E A;  1YP4 A;  2I7B A;  1H7F A;  4P02 A;  5C8R A;  5CMH A;  2DPW A;  4EE3 A;  5C36 A;  1INI A;  2ICX A;  4M28 A;  2OEF A;  4M2A A;  3LW6 A;  5C3A A;  1GX0 A;  1W77 A;  1TW5 A;  1VGT A;  2O1H A;  1PZY B;  4KPX A;  3E25 A;  1LZ7 A;  1FZW A;  4M4K A;  1EYR A;  2APC A;  1G3L A;  4HO0 A;  1R7X A;  3RMV A;  4MND A;  2RJ0 A;  1R7T A;  2X65 A;  1WVC A;  3BCV A;  2ICY A;  2XWN A;  2FYA A;  1LL0 A;  3OC9 A;  1S4N A;  4AYJ A;  4EE4 A;  1ZJ3 A;  5FU8 A;  3Q7U A;  1LZJ A;  4KT7 A;  4FRA A;  4Y62 A;  1FOA A;  1H5S D;  4FQW A;  4Y6N A;  5IFY A;  3V91 A;  3IOI A;  5CQM X;  4B4B A;  2VS4 A;  2FFV A;  5FTS A;  1QGQ A;  1G2V A;  5EJ1 A;  4P00 A;  4FRP A;  3RSB A;  4J18 A;  1ZJ0 A;  2FY7 A;  5JQQ A;  2FFU A;  2Y4L A;  1Z90 A;  2Q4J A;  4EEM A;  2YCM A;  2Z87 A;  5DDV A;  4HO4 A;  2A8W A;  2BO8 A;  1ZI1 A;  1FWY A;  2VSH A;  4Y7V A;  4B42 A;  1H5R B;  3V0L A;  5CQP A;  1VGZ A;  5C3B A;  3V90 A;  1WT0 A;  5C1G A;  3SX5 A;  2VS3 A;  4G3P A;  4JD0 A;  4HG6 A;  1O7O A;  4M2B A;  3SXA A;  2FYD B;  3D8V A;  2MZB A;  3DK5 A;  1NHE B;  2OI5 A;  2VXL A;  4G87 A;  4Y6U A;  3Q4S A;  1VPA A;  1G8O A;  4LW3 A;  3V0O A;  4FRL A;  2YQJ A;  2QH5 A;  1OMZ A;  2RJ1 A;  1S4O A;  2YQH A;  4FRQ A;  3U2T A;  4MYB A;  1FGG A;  4D0T A;  1H5S C;  5CMF X;  4HO2 A;  3O3P A;  3R3I A;  3JUJ A;  2WGZ A; 
#chains in the Genus database with same CATH topology
 2OI7 A;  1ZJP A;  5FU0 A;  2O1F A;  4HO3 A;  3IOJ A;  4ECM A;  4D11 A;  1MC3 A;  4C2S A;  3K8E A;  1H4E A;  1ZHJ A;  4NAL A;  4D0Z A;  2RIT A;  3K8D A;  2X60 A;  4CJB A;  3U0Y A;  1VGU A;  3OGZ A;  2AE7 A;  4EEG A;  1V84 A;  2YQS A;  1NQI B;  1ZIZ A;  3Q80 A;  1HM9 A;  4IRP A;  4ARW A;  5EIY A;  5IDS A;  5CQL X;  3V8Z A;  2RIX A;  4YS8 A;  2RJ8 A;  2AES A;  4AYL A;  3I0C A;  1ZI5 A;  3F1C A;  2WVM A;  4KC1 A;  5AJP A;  5AJN A;  2NXV A;  2W0W A;  1MP4 A;  1GWW A;  1LZI A;  1TVY A;  2ZU9 A;  2AM4 A;  1VGW A;  1ZCU A;  2VD4 A;  3ZGF A;  1GQ9 A;  3V0N A;  4KNR A;  5C4F A;  1LVW A;  1H5R A;  2RJ5 A;  3U2V A;  5FV9 A;  4LW6 A;  3U2U A;  2Y6P A;  4KC4 A;  1KWS A;  1HM0 A;  2E8B A;  5D91 A;  4B4M A;  1QG8 A;  4B5B A;  1HJJ A;  2PA4 A;  2X5S A;  3DUV A;  4GBP A;  1H7L A;  2YC5 A;  4BMA A;  2A8U A;  5J49 A;  1G9R A;  1NWG B;  1V82 A;  1ZJ1 A;  4E1K A;  5C4C A;  4HO9 A;  1JYK A;  1FR8 A;  1NMM B;  3I0G A;  3OH1 A;  1FG5 N;  3CKJ A;  4ASJ A;  1ZJ2 A;  3USQ A;  3FWW A;  3PNN A;  2JCL A;  1XHB A;  5CQN X;  3OH3 A;  2V0I A;  4Y7F A;  2X5Z A;  5C47 A;  1G23 A;  1TZF A;  2VK9 A;  3ZF8 A;  1H5T B;  1VZX A;  3T7N A;  3POL A;  2JCJ A;  3SXD A;  4FCU A;  1G93 A;  2YES A;  1FXJ A;  1YP3 A;  2J0A A;  4KQL A;  3ZLL A;  2PX7 A;  4Y7U A;  1WSZ A;  2D7R A;  1ZCT A;  3U2W A;  4Y7T A;  4EVW A;  1G0R A;  3SX8 A;  4EE5 A;  5IDT A;  1IIM A;  1LL3 A;  2P6W A;  3TZT A;  2VXM A;  1YP2 A;  5C3D A;  2V0L A;  2XME A;  4G3S A;  1O7Q A;  1W55 A;  2YC3 A;  3ZLK A;  2AGD A;  3SPT A;  4CVH A;  1H7Q A;  5FTV A;  4BQH A;  2UX8 A;  3OKR A;  4UEG A;  1JYL A;  1INJ A;  5D92 A;  3QVB A;  5CQO A;  2WVK A;  1ZCY A;  3R2W A;  3I0I X;  1ZDF A;  1XZ6 A;  1GA8 A;  3T7O A;  1HJL A;  3SXE A;  5C4B A;  1VH1 A;  2RIZ A;  3JTJ A;  2AH9 A;  2AM3 A;  4Y7G A;  2V0K A;  3PKQ A;  1ZI3 A;  1ON8 A;  2JCK A;  4FIY A;  4AAW A;  2XWM A;  1TW1 A;  3V0Q A;  3I0J A;  2AEC A;  3TQD A;  3V0P A;  4B3U A;  2V0H A;  2WE9 A;  4XWI A;  1R7U A;  4D48 A;  1H7T A;  3I0D A;  4KC2 A;  2V0J A;  1MP3 A;  5C48 A;  1E5K A;  2BO7 A;  1H4D A;  5C1L A;  3T7M A;  1QWJ A;  1LL2 A;  4FRH A;  4HO6 A;  2VSI A;  2C0N A;  2J0B A;  2Y4M A;  5C38 A;  1JVG A;  3KIA A;  3OH2 A;  3FOQ A;  1H5T A;  4Y9X A;  1FO9 A;  2BO4 A;  2O1G A;  2VFZ A;  4B2W A;  4FCE A;  2VS5 A;  2ZU7 A;  2AM5 A;  2QGI A;  3ZGG A;  1H5S B;  3I0L A;  3IOH A;  4FRB A;  2YQC A;  5CMI A;  5BXC A;  5DDT A;  2WEE A;  3CKN A;  3ST8 A;  1WT3 A;  1K4V A;  4DE7 A;  3OH0 A;  5AJO A;  5C4D A;  2I5K A;  3GUE A;  2GGQ A;  1OMX A;  1S4P A;  1SS9 A;  4O6N A;  2Y7A A;  2JCO A;  1NF5 B;  2XWL A;  4IRQ A;  1FR9 A;  1R82 A;  3I0F A;  1V83 A;  4FRE A;  3RMW A;  1R7Y A;  3CKO A;  2E3D A;  1H7H A;  1R80 A;  3PKP A;  4Y64 A;  1G95 A;  2W0V A;  1EZI A;  1GX4 A;  4DEC A;  1R7V A;  1NKH B;  1ZDG A;  2QKX A;  4FRM A;  1H3M A;  2RJ4 A;  3E26 A;  1JVD A;  1VH3 A;  1ZJO A;  4FRO A;  1ZCV A;  4FIX A;  2GGO A;  1G97 A;  2FYC B;  4DDZ A;  4CJC A;  3V8Y A;  1O23 B;  1GQC A;  1WT2 A;  5CMG X;  5C1H A;  4AC3 A;  1GWV A;  2BO6 A;  2Y4K A;  4HO5 A;  4R7P A;  3CKV A;  4ZDQ A;  1YRO B;  2FYB A;  4L41 C;  5L6S A;  3I0H A;  4EEO A;  1HV9 A;  5FYE A;  3N9W A;  1VZU A;  3HL3 A;  4NAK A;  2WVL A;  4JIS A;  1PZT A;  4NAN A;  5C4E A;  1OQM B;  3SXG A;  1H4C A;  2I5E A;  4KXO A;  4KNX A;  1MP5 A;  1VZT A;  1FGX A;  3USR A;  1FRW A;  2PGV A;  4FRD A;  3SXB A;  3CKQ A;  3V0M A;  2RJ9 A;  4Y63 A;  1W57 A;  4K6R A;  3SXC A;  1H5S A;  2PGY A;  3U0X A;  3D5N A;  4HOC A;  4ASY A;  2RJ6 A;  2OEG A;  3NGW A;  4HO8 A;  5L6V A;  1HM8 A;  4G3Q A;  4B2X A;  3JUK A;  2WAW A;  2Y4J A;  5HS2 A;  2OI6 A;  2RIY A;  4B4G A;  2D7I A;  2XMH A;  3CGX A;  1QGS A;  2ZU8 A;  5I1F A;  2P72 A;  1ZI4 A;  2P73 A;  1FXO A;  3DJ4 A;  3F1Y A;  1FO8 A;  4NAI A;  4D11 C;  2D0J A;  4EEA A;  1LZ0 A;  1VIC A;  2CU2 A;  3I0E A;  5C49 A;  3EE5 A;  1R81 A;  3SX7 A;  3OH4 A;  1WT1 A;  4Q7C A;  3BRK X;  4CJ8 A;  1VM8 A;  1G1L A;  2Z86 A;  3CU0 A;  1ON6 A;  4KPZ A;  5FUH A;  1O0R A;  4KRV A;  3D98 A;  3OAM A;  5EJZ A;  1JV3 A;  3I0K A;  4HCQ A;  1I52 A;  2RJ7 A;  1H7G A;  3U2X A;  1IIN A;  1JV1 A;  5CMJ A;  3SX3 A;  1H7E A;  1YP4 A;  2I7B A;  1H7F A;  4P02 A;  5C8R A;  5CMH A;  2DPW A;  4EE3 A;  5C36 A;  1INI A;  2ICX A;  4M28 A;  2OEF A;  4M2A A;  3LW6 A;  5C3A A;  1GX0 A;  1W77 A;  1TW5 A;  1VGT A;  2O1H A;  1PZY B;  4KPX A;  3E25 A;  1LZ7 A;  1FZW A;  4M4K A;  1EYR A;  2APC A;  1G3L A;  4HO0 A;  1R7X A;  3RMV A;  4O6M A;  4MND A;  2RJ0 A;  1R7T A;  2X65 A;  1WVC A;  3BCV A;  2ICY A;  2XWN A;  2FYA A;  1LL0 A;  3OC9 A;  1S4N A;  4AYJ A;  4EE4 A;  1ZJ3 A;  5FU8 A;  3Q7U A;  1LZJ A;  4KT7 A;  4FRA A;  4Y62 A;  1FOA A;  1H5S D;  4FQW A;  4MIX A;  4Y6N A;  5IFY A;  3V91 A;  3IOI A;  5CQM X;  4B4B A;  2VS4 A;  2FFV A;  5FTS A;  1QGQ A;  1G2V A;  5EJ1 A;  4P00 A;  4FRP A;  3RSB A;  4J18 A;  1ZJ0 A;  2FY7 A;  5JQQ A;  2FFU A;  2Y4L A;  1Z90 A;  2Q4J A;  4EEM A;  2YCM A;  2Z87 A;  5DDV A;  4HO4 A;  2A8W A;  2BO8 A;  1ZI1 A;  1FWY A;  2VSH A;  4Y7V A;  4B42 A;  1H5R B;  3V0L A;  5CQP A;  1VGZ A;  5C3B A;  3V90 A;  1WT0 A;  5C1G A;  3SX5 A;  2VS3 A;  4G3P A;  4JD0 A;  4HG6 A;  1O7O A;  4M2B A;  3SXA A;  2FYD B;  3D8V A;  2MZB A;  3DK5 A;  1NHE B;  2OI5 A;  2VXL A;  4G87 A;  4Y6U A;  3Q4S A;  1VPA A;  1G8O A;  4LW3 A;  3V0O A;  4FRL A;  2YQJ A;  2QH5 A;  1OMZ A;  2RJ1 A;  1S4O A;  2YQH A;  4FRQ A;  3U2T A;  4MYB A;  1FGG A;  4D0T A;  1H5S C;  5CMF X;  4HO2 A;  3O3P A;  3R3I A;  3JUJ A;  2WGZ A; 
#chains in the Genus database with same CATH homology
 2OI7 A;  1ZJP A;  5FU0 A;  2O1F A;  4HO3 A;  3IOJ A;  4ECM A;  4D11 A;  1MC3 A;  4C2S A;  3K8E A;  1H4E A;  1ZHJ A;  4NAL A;  4D0Z A;  2RIT A;  3K8D A;  2X60 A;  4CJB A;  3U0Y A;  1VGU A;  3OGZ A;  2AE7 A;  4EEG A;  1V84 A;  2YQS A;  1NQI B;  1ZIZ A;  3Q80 A;  1HM9 A;  4IRP A;  4ARW A;  5EIY A;  5IDS A;  5CQL X;  3V8Z A;  2RIX A;  4YS8 A;  2RJ8 A;  2AES A;  4AYL A;  3I0C A;  1ZI5 A;  3F1C A;  2WVM A;  4KC1 A;  5AJP A;  5AJN A;  2NXV A;  2W0W A;  1MP4 A;  1GWW A;  1LZI A;  1TVY A;  2ZU9 A;  2AM4 A;  1VGW A;  1ZCU A;  2VD4 A;  3ZGF A;  1GQ9 A;  3V0N A;  4KNR A;  5C4F A;  1LVW A;  1H5R A;  2RJ5 A;  3U2V A;  5FV9 A;  4LW6 A;  3U2U A;  2Y6P A;  4KC4 A;  1KWS A;  1HM0 A;  2E8B A;  5D91 A;  4B4M A;  1QG8 A;  4B5B A;  1HJJ A;  2PA4 A;  2X5S A;  3DUV A;  4GBP A;  1H7L A;  2YC5 A;  4BMA A;  2A8U A;  5J49 A;  1G9R A;  1NWG B;  1V82 A;  1ZJ1 A;  4E1K A;  5C4C A;  4HO9 A;  1JYK A;  1FR8 A;  1NMM B;  3I0G A;  3OH1 A;  1FG5 N;  3CKJ A;  4ASJ A;  1ZJ2 A;  3USQ A;  3FWW A;  3PNN A;  2JCL A;  1XHB A;  5CQN X;  3OH3 A;  2V0I A;  4Y7F A;  2X5Z A;  5C47 A;  1G23 A;  1TZF A;  2VK9 A;  3ZF8 A;  1H5T B;  1VZX A;  3T7N A;  3POL A;  2JCJ A;  3SXD A;  4FCU A;  1G93 A;  2YES A;  1FXJ A;  1YP3 A;  2J0A A;  4KQL A;  3ZLL A;  2PX7 A;  4Y7U A;  1WSZ A;  2D7R A;  1ZCT A;  3U2W A;  4Y7T A;  4EVW A;  1G0R A;  3SX8 A;  4EE5 A;  5IDT A;  1IIM A;  1LL3 A;  2P6W A;  3TZT A;  2VXM A;  1YP2 A;  5C3D A;  2V0L A;  2XME A;  4G3S A;  1O7Q A;  1W55 A;  2YC3 A;  3ZLK A;  2AGD A;  3SPT A;  4CVH A;  1H7Q A;  5FTV A;  4BQH A;  2UX8 A;  3OKR A;  4UEG A;  1JYL A;  1INJ A;  5D92 A;  3QVB A;  5CQO A;  2WVK A;  1ZCY A;  3R2W A;  3I0I X;  1ZDF A;  1XZ6 A;  1GA8 A;  3T7O A;  1HJL A;  3SXE A;  5C4B A;  1VH1 A;  2RIZ A;  3JTJ A;  2AH9 A;  2AM3 A;  4Y7G A;  2V0K A;  3PKQ A;  1ZI3 A;  1ON8 A;  2JCK A;  4FIY A;  4AAW A;  2XWM A;  1TW1 A;  3V0Q A;  3I0J A;  2AEC A;  3TQD A;  3V0P A;  4B3U A;  2V0H A;  2WE9 A;  4XWI A;  1R7U A;  4D48 A;  1H7T A;  3I0D A;  4KC2 A;  2V0J A;  1MP3 A;  5C48 A;  1E5K A;  2BO7 A;  1H4D A;  5C1L A;  3T7M A;  1QWJ A;  1LL2 A;  4FRH A;  4HO6 A;  2VSI A;  2C0N A;  2J0B A;  2Y4M A;  5C38 A;  1JVG A;  3KIA A;  3OH2 A;  3FOQ A;  1H5T A;  4Y9X A;  1FO9 A;  2BO4 A;  2O1G A;  2VFZ A;  4B2W A;  4FCE A;  2VS5 A;  2ZU7 A;  2AM5 A;  2QGI A;  3ZGG A;  1H5S B;  3I0L A;  3IOH A;  4FRB A;  2YQC A;  5CMI A;  5BXC A;  5DDT A;  2WEE A;  3CKN A;  3ST8 A;  1WT3 A;  1K4V A;  4DE7 A;  3OH0 A;  5AJO A;  5C4D A;  2I5K A;  3GUE A;  2GGQ A;  1OMX A;  1S4P A;  1SS9 A;  4O6N A;  2Y7A A;  2JCO A;  1NF5 B;  2XWL A;  4IRQ A;  1FR9 A;  1R82 A;  3I0F A;  1V83 A;  4FRE A;  3RMW A;  1R7Y A;  3CKO A;  2E3D A;  1H7H A;  1R80 A;  3PKP A;  4Y64 A;  1G95 A;  2W0V A;  1EZI A;  1GX4 A;  4DEC A;  1R7V A;  1NKH B;  1ZDG A;  2QKX A;  4FRM A;  1H3M A;  2RJ4 A;  3E26 A;  1JVD A;  1VH3 A;  1ZJO A;  4FRO A;  1ZCV A;  4FIX A;  2GGO A;  1G97 A;  2FYC B;  4DDZ A;  4CJC A;  3V8Y A;  1O23 B;  1GQC A;  1WT2 A;  5CMG X;  5C1H A;  4AC3 A;  1GWV A;  2BO6 A;  2Y4K A;  4HO5 A;  4R7P A;  3CKV A;  4ZDQ A;  1YRO B;  2FYB A;  4L41 C;  5L6S A;  3I0H A;  4EEO A;  1HV9 A;  5FYE A;  3N9W A;  1VZU A;  3HL3 A;  4NAK A;  2WVL A;  4JIS A;  1PZT A;  4NAN A;  5C4E A;  1OQM B;  3SXG A;  1H4C A;  2I5E A;  4KXO A;  4KNX A;  1MP5 A;  1VZT A;  1FGX A;  3USR A;  1FRW A;  2PGV A;  4FRD A;  3SXB A;  3CKQ A;  3V0M A;  2RJ9 A;  4Y63 A;  1W57 A;  4K6R A;  3SXC A;  1H5S A;  2PGY A;  3U0X A;  3D5N A;  4HOC A;  4ASY A;  2RJ6 A;  2OEG A;  3NGW A;  4HO8 A;  5L6V A;  1HM8 A;  4G3Q A;  4B2X A;  3JUK A;  2WAW A;  2Y4J A;  5HS2 A;  2OI6 A;  2RIY A;  4B4G A;  2D7I A;  2XMH A;  3CGX A;  1QGS A;  2ZU8 A;  5I1F A;  2P72 A;  1ZI4 A;  2P73 A;  1FXO A;  3DJ4 A;  3F1Y A;  1FO8 A;  4NAI A;  4D11 C;  2D0J A;  4EEA A;  1LZ0 A;  1VIC A;  2CU2 A;  3I0E A;  5C49 A;  3EE5 A;  1R81 A;  3SX7 A;  3OH4 A;  1WT1 A;  4Q7C A;  3BRK X;  4CJ8 A;  1VM8 A;  1G1L A;  2Z86 A;  3CU0 A;  1ON6 A;  4KPZ A;  5FUH A;  1O0R A;  4KRV A;  3D98 A;  3OAM A;  5EJZ A;  1JV3 A;  3I0K A;  4HCQ A;  1I52 A;  2RJ7 A;  1H7G A;  3U2X A;  1IIN A;  1JV1 A;  5CMJ A;  3SX3 A;  1H7E A;  1YP4 A;  2I7B A;  1H7F A;  4P02 A;  5C8R A;  5CMH A;  2DPW A;  4EE3 A;  5C36 A;  1INI A;  2ICX A;  4M28 A;  2OEF A;  4M2A A;  3LW6 A;  5C3A A;  1GX0 A;  1W77 A;  1TW5 A;  1VGT A;  2O1H A;  1PZY B;  4KPX A;  3E25 A;  1LZ7 A;  1FZW A;  4M4K A;  1EYR A;  2APC A;  1G3L A;  4HO0 A;  1R7X A;  3RMV A;  4O6M A;  4MND A;  2RJ0 A;  1R7T A;  2X65 A;  1WVC A;  3BCV A;  2ICY A;  2XWN A;  2FYA A;  1LL0 A;  3OC9 A;  1S4N A;  4AYJ A;  4EE4 A;  1ZJ3 A;  5FU8 A;  3Q7U A;  1LZJ A;  4KT7 A;  4FRA A;  4Y62 A;  1FOA A;  1H5S D;  4FQW A;  4MIX A;  4Y6N A;  5IFY A;  3V91 A;  3IOI A;  5CQM X;  4B4B A;  2VS4 A;  2FFV A;  5FTS A;  1QGQ A;  1G2V A;  5EJ1 A;  4P00 A;  4FRP A;  3RSB A;  4J18 A;  1ZJ0 A;  2FY7 A;  5JQQ A;  2FFU A;  2Y4L A;  1Z90 A;  2Q4J A;  4EEM A;  2YCM A;  2Z87 A;  5DDV A;  4HO4 A;  2A8W A;  2BO8 A;  1ZI1 A;  1FWY A;  2VSH A;  4Y7V A;  4B42 A;  1H5R B;  3V0L A;  5CQP A;  1VGZ A;  5C3B A;  3V90 A;  1WT0 A;  5C1G A;  3SX5 A;  2VS3 A;  4G3P A;  4JD0 A;  4HG6 A;  1O7O A;  4M2B A;  3SXA A;  2FYD B;  3D8V A;  2MZB A;  3DK5 A;  1NHE B;  2OI5 A;  2VXL A;  4G87 A;  4Y6U A;  3Q4S A;  1VPA A;  1G8O A;  4LW3 A;  3V0O A;  4FRL A;  2YQJ A;  2QH5 A;  1OMZ A;  2RJ1 A;  1S4O A;  2YQH A;  4FRQ A;  3U2T A;  4MYB A;  1FGG A;  4D0T A;  1H5S C;  5CMF X;  4HO2 A;  3O3P A;  3R3I A;  3JUJ A;  2WGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...