5JQQA

Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis - apo form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
276
Chain Sequence
TTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLDYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title Crystal structure of glucosyl-3-phosphoglycerate synthase from Mycobacterium tuberculosis - apo form
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Transferase
total genus 92
structure length 276
sequence length 299
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5jqqA00
4YS8A 2GGOA 5C1GA 3SXEA 1O7OA 4EEMA 1FRWA 3I0JA 5DDVA 3IOIA 3KIAA 2UX8A 3OAMA 5FU8A 4BMAA 2RJ1A 3V0MA 3R2WA 3K8DA 2VS5A 2WAWA 2YC5A 3DUVA 4FCUA 1O23B 1LL2A 5C8RA 2YQHA 3U2UA 1H7FA 1HM9A 1FO9A 1GX4A 2E3DA 2YQCA 1MP4A 2VSIA 4B4BA 3U2VA 1S4NA 3SX5A 2I7BA 3U2TA 1LZIA 1FGXA 2OEFA 1JYKA 4HG6A 5C4CA 1INJA 1VZUA 1OMXA 1TW1A 3D8VA 1VZTA 2P6WA 3SX7A 2JCLA 2Y4JA 2AM4A 2VXLA 1JYLA 1FR8A 5EIYA 5IDTA 1GWVA 1VPAA 5FUHA 3K8EA 4EEAA 4FRBA 4NAIA 3OH3A 3ZF8A 1JVDA 4ASYA 1NQIB 2PA4A 2XWNA 4M28A 4CVHA 1G9RA 5C4BA 4R7PA 1ZIZA 2XMHA 1G23A 4FRPA 2Q4JA 1WVCA 3FWWA 3LW6A 1INIA 4K6RA 1TZFA 3BRKX 3FOQA 5JQQA 1HM0A 2WVMA 5EJ1A 1ON6A 3BCVA 4EE3A 4ARWA 1H5TB 2CU2A 4KC2A 2X65A 4JD0A 3N9WA 4Y63A 5FU0A 5L6SA 2W0VA 3F1CA 1ZI1A 5IFYA 1V82A 4EEOA 1ZDFA 2OEGA 1KWSA 1H4DA 1VGUA 2O1GA 1ZDGA 3E26A 2AE7A 3USQA 3CKQA 1IIMA 3V90A 1QGSA 3SXAA 4G87A 3E25A 2W0WA 2WVLA 2Y4KA 3GUEA 4NANA 1YP3A 1TVYA 3IOHA 1H5SD 1O0RA 3IOJA 2AGDA 1LL3A 5FTVA 4Y7VA 2AESA 1EYRA 1QGQA 1R7XA 1QWJA 3PKQA 4Y64A 4B2XA 2RIYA 1FO8A 2RIXA 2PGYA 1PZYB 5CMGX 1JV1A 3DK5A 2VSHA 4GBPA 1ZI3A 2AECA 1R7TA 4FRMA 3OKRA 2X5SA 4IRPA 5CQNX 2RJ5A 3CU0A 1FGGA 2FYDB 1SS9A 2DPWA 3OC9A 4Y7TA 4L41C 1W57A 4DDZA 1HM8A 1H5SA 2V0JA 2QGIA 1ON8A 1R7VA 3I0IX 2VS4A 1YROB 2O1FA 1LVWA 1G97A 2FYCB 4P00A 3SX3A 4B4MA 3ZLLA 2ICXA 2A8WA 1H7HA 2OI7A 5CMFX 1FR9A 2XWLA 2A8UA 4KPXA 3ZGFA 3SXDA 4BQHA 1VZXA 2RITA 1YP2A 2I5KA 2OI6A 3RMVA 3V8YA 2RJ8A 4ECMA 1IINA 3OGZA 4FRHA 4AAWA 5C4EA 3D98A 4C2SA 1G8OA 2JCJA 3U0XA 4CJBA 4HOCA 1NKHB 4D11A 1OMZA 1H5SB 1JVGA 1NHEB 2NXVA 1WSZA 5C3AA 5C4DA 1MP5A 1V83A 1W77A 1H7EA 3T7OA 1QG8A 3POLA 4AC3A 2WEEA 4NALA 1H5SC 5C49A 3I0DA 3JUJA 3V0LA 4Y9XA 1H5RA 1FOAA 1S4PA 2V0KA 3V0QA 1G3LA 3HL3A 1FXOA 2BO6A 2FFUA 1H7LA 4KNXA 3OH1A 1YP4A 2Y7AA 4Y6UA 3V0OA 2X60A 4HO4A 3RMWA 4KXOA 1VGZA 3SX8A 3Q80A 1H7TA 1R7YA 4KNRA 3SPTA 3OH2A 1GA8A 4DE7A 4E1KA 2D7IA 2WGZA 4FQWA 4B2WA 1G0RA 1LL0A 1GWWA 1MP3A 5C36A 2YC3A 3ST8A 3EE5A 2D0JA 4CJ8A 4ASJA 2O1HA 4Y62A 4IRQA 3O3PA 1R7UA 1VH1A 2WE9A 1ZI4A 3CKVA 3T7NA 3SXGA 2APCA 2MZBA 5C1LA 3D5NA 1G2VA 2YESA 3QVBA 3PKPA 4FREA 2RJ7A 1WT0A 2X5ZA 3TZTA 1G95A 5C4FA 3I0CA 4LW3A 4P02A 2XMEA 4HO8A 1ZJOA 2BO8A 5AJNA 1NWGB 3U0YA 4Y7UA 3PNNA 1ZJ1A 3TQDA 2JCOA 1FXJA 1W55A 4Y7FA 3I0LA 1R81A 3I0FA 2VXMA 3CKNA 4M2BA 4D48A 1LZ0A 4KRVA 1H4EA 5AJPA 2Z87A 3I0KA 4M2AA 1HJJA 1ZCVA 1GX0A 4FRLA 1XHBA 1GQCA 2AH9A 4FROA 4UEGA 1K4VA 2FYBA 1S4OA 2ZU9A 1MC3A 2RJ4A 5CQMX 5CMHA 2GGQA 1VGWA 2RIZA 1HJLA 2VD4A 1FWYA 1R80A 2RJ0A 4G3QA 4KT7A 4ZDQA 2AM5A 5C1HA 2YQSA 5CQLX 4DECA 2XWMA 4EE4A 3V91A 4AYLA 2QKXA 1XZ6A 5CMJA 3Q7UA 4G3PA 4AYJA 3CGXA 1VGTA 1VICA 2D7RA 4D0TA 1LZ7A 1VM8A 4CJCA 4HO0A 3F1YA 5L6VA 2E8BA 3OH4A 1ZJ3A 3V8ZA 2Z86A 3ZGGA 1ZCYA 5IDSA 2QH5A 2FYAA 3SXBA 2AM3A 2RJ9A 1O7QA 2OI5A 1I52A 1ZJ2A 1LZJA 1EZIA 3USRA 5CQOA 2I5EA 2Y6PA 5C3BA 1WT2A 1H4CA 3I0EA 4KC4A 1ZJPA 3T7MA 1FG5N 1G1LA 1H5TA 5CMIA 3CKJA 1H3MA 4KQLA 2BO4A 4JISA 1PZTA 5FYEA 4M4KA 1V84A 5DDTA 3U2XA 3I0GA 2FY7A 2ICYA 4FRDA 5EJZA 1WT1A 1VH3A 2V0LA 4MYBA 2VFZA 4KPZA 4D0ZA 4HCQA 1WT3A 1HV9A 2P73A 2VS3A 3CKOA 5FV9A 4EEGA 3SXCA 3R3IA 1NF5B 2V0HA 3JUKA 2P72A 1G93A 4D11C 5FTSA 2ZU8A 4LW6A 3I0HA 4J18A 4NAKA 4HO3A 2WVKA 1H5RB 1E5KA 1Z90A 3NGWA 5HS2A 1JV3A 1ZCUA 1ZCTA 2PX7A 4B4GA 5C47A 4FCEA 4HO9A 2YCMA 4HO2A 4B5BA 2FFVA 2BO7A 1ZHJA 1ZJ0A 3V0PA 4Y7GA 4HO6A 3DJ4A 2Y4MA 2Y4LA 2YQJA 1FZWA 3OH0A 1NMMB 3V0NA 4FRQA 2ZU7A 3RSBA 3U2WA 1OQMB 4G3SA 1TW5A 4FRAA 5C48A 5CQPA 2JCKA 1GQ9A 3Q4SA 4HO5A 2PGVA 1H7QA 5C3DA 4MNDA 4Y6NA 2V0IA 5J49A 3JTJA 4EE5A 5I1FA 4KC1A 5C38A 4B42A 1ZI5A 5AJOA 1R82A 4EVWA 4XWIA 4B3UA 5BXCA 2RJ6A 3ZLKA 1H7GA
chains in the Genus database with same CATH superfamily
4YS8A 2GGOA 5C1GA 3SXEA 1O7OA 4EEMA 5D92A 1FRWA 4Q7CA 3I0JA 5DDVA 3IOIA 3KIAA 2UX8A 3OAMA 5FU8A 4BMAA 2RJ1A 3V0MA 3R2WA 3K8DA 2VS5A 2WAWA 2YC5A 3DUVA 4FCUA 1O23B 1LL2A 5C8RA 2YQHA 3U2UA 1H7FA 1HM9A 1FO9A 1GX4A 2E3DA 2YQCA 1MP4A 2VSIA 4B4BA 3U2VA 1S4NA 3SX5A 2I7BA 3U2TA 1LZIA 1FGXA 2OEFA 1JYKA 4HG6A 5C4CA 1INJA 1VZUA 1OMXA 1TW1A 3D8VA 1VZTA 2P6WA 3SX7A 2JCLA 2Y4JA 2AM4A 2VXLA 1JYLA 1FR8A 5EIYA 5IDTA 1GWVA 1VPAA 5FUHA 3K8EA 4EEAA 4FRBA 4NAIA 3OH3A 3ZF8A 1JVDA 4ASYA 1NQIB 2PA4A 2XWNA 4M28A 4CVHA 1G9RA 5C4BA 4R7PA 1ZIZA 2XMHA 1G23A 4FRPA 2Q4JA 1WVCA 3FWWA 3LW6A 1INIA 4K6RA 1TZFA 3BRKX 3FOQA 5JQQA 1HM0A 2WVMA 5EJ1A 1ON6A 3BCVA 4EE3A 4ARWA 1H5TB 2CU2A 4KC2A 2X65A 4JD0A 3N9WA 4Y63A 5FU0A 5L6SA 2W0VA 3F1CA 1ZI1A 5IFYA 1V82A 4EEOA 1ZDFA 2OEGA 1KWSA 1H4DA 1VGUA 2O1GA 1ZDGA 3E26A 2AE7A 3USQA 3CKQA 1IIMA 3V90A 1QGSA 3SXAA 4G87A 3E25A 2W0WA 2WVLA 2Y4KA 3GUEA 4NANA 1YP3A 1TVYA 3IOHA 1H5SD 1O0RA 3IOJA 2AGDA 1LL3A 5FTVA 4Y7VA 2AESA 1EYRA 1QGQA 1R7XA 1QWJA 3PKQA 4Y64A 4B2XA 2RIYA 1FO8A 2RIXA 2PGYA 5D91A 1PZYB 5CMGX 1JV1A 3DK5A 2C0NA 2VSHA 4GBPA 1ZI3A 2AECA 1R7TA 4FRMA 3OKRA 2X5SA 4IRPA 5CQNX 2RJ5A 3CU0A 1FGGA 2FYDB 1SS9A 2DPWA 3OC9A 4Y7TA 4L41C 1W57A 4DDZA 1HM8A 1H5SA 2V0JA 2QGIA 1ON8A 1R7VA 3I0IX 2VS4A 1YROB 2O1FA 1LVWA 1G97A 2FYCB 4P00A 3SX3A 4B4MA 3ZLLA 2ICXA 2A8WA 1H7HA 2OI7A 5CMFX 1FR9A 2XWLA 2A8UA 4KPXA 3ZGFA 3SXDA 4BQHA 1VZXA 2RITA 1YP2A 2I5KA 2OI6A 3RMVA 3V8YA 2RJ8A 4MIXA 4ECMA 1IINA 3OGZA 2J0BA 4FRHA 4AAWA 5C4EA 3D98A 4C2SA 1G8OA 2JCJA 3U0XA 4CJBA 4HOCA 1NKHB 4D11A 1OMZA 1H5SB 1JVGA 1NHEB 2NXVA 1WSZA 5C3AA 5C4DA 1MP5A 1V83A 1W77A 1H7EA 3T7OA 1QG8A 3POLA 4AC3A 2WEEA 4NALA 1H5SC 5C49A 3I0DA 3JUJA 3V0LA 4Y9XA 1H5RA 1FOAA 1S4PA 2V0KA 3V0QA 1G3LA 3HL3A 1FXOA 2BO6A 2FFUA 1H7LA 4KNXA 3OH1A 1YP4A 2Y7AA 4Y6UA 3V0OA 2X60A 4HO4A 3RMWA 4KXOA 1VGZA 3SX8A 3Q80A 1H7TA 1R7YA 4KNRA 3SPTA 3OH2A 1GA8A 4DE7A 4E1KA 2D7IA 2WGZA 4FQWA 4B2WA 1G0RA 1LL0A 1GWWA 1MP3A 5C36A 2YC3A 3ST8A 2VK9A 3EE5A 2D0JA 4CJ8A 4ASJA 2O1HA 4Y62A 4IRQA 3O3PA 1R7UA 1VH1A 2WE9A 1ZI4A 3CKVA 3T7NA 3SXGA 2APCA 2MZBA 5C1LA 3D5NA 1G2VA 2YESA 3QVBA 3PKPA 4FREA 2RJ7A 1WT0A 2X5ZA 3TZTA 1G95A 5C4FA 3I0CA 4LW3A 4P02A 2XMEA 4HO8A 1ZJOA 2BO8A 5AJNA 1NWGB 3U0YA 4Y7UA 3PNNA 1ZJ1A 3TQDA 2JCOA 1FXJA 1W55A 4Y7FA 3I0LA 1R81A 3I0FA 4O6MA 2VXMA 3CKNA 4M2BA 4D48A 1LZ0A 4KRVA 1H4EA 5AJPA 2Z87A 3I0KA 4M2AA 1HJJA 1ZCVA 1GX0A 4FRLA 1XHBA 1GQCA 2AH9A 4FROA 4UEGA 1K4VA 2FYBA 1S4OA 2ZU9A 1MC3A 2RJ4A 5CQMX 5CMHA 2GGQA 1VGWA 2RIZA 1HJLA 4FIXA 2VD4A 1FWYA 1R80A 2RJ0A 4G3QA 4KT7A 4ZDQA 2AM5A 5C1HA 2YQSA 5CQLX 4DECA 2XWMA 4EE4A 3V91A 4AYLA 2QKXA 1XZ6A 5CMJA 3Q7UA 4G3PA 4AYJA 3CGXA 1VGTA 1VICA 2D7RA 4D0TA 1LZ7A 1VM8A 4CJCA 4HO0A 3F1YA 5L6VA 2E8BA 3OH4A 1ZJ3A 3V8ZA 2Z86A 3ZGGA 1ZCYA 5IDSA 2QH5A 2FYAA 3SXBA 2AM3A 2RJ9A 1O7QA 2OI5A 1I52A 1ZJ2A 1LZJA 1EZIA 3USRA 5CQOA 2I5EA 2Y6PA 5C3BA 1WT2A 1H4CA 3I0EA 4KC4A 1ZJPA 3T7MA 1FG5N 1G1LA 1H5TA 5CMIA 3CKJA 1H3MA 4KQLA 2BO4A 4JISA 1PZTA 5FYEA 4M4KA 1V84A 5DDTA 3U2XA 3I0GA 2FY7A 2ICYA 4FRDA 5EJZA 1WT1A 1VH3A 2V0LA 4MYBA 2VFZA 4KPZA 4D0ZA 4HCQA 1WT3A 1HV9A 2P73A 2VS3A 3CKOA 5FV9A 4EEGA 3SXCA 3R3IA 1NF5B 2V0HA 3JUKA 2P72A 1G93A 4D11C 5FTSA 2ZU8A 4O6NA 4LW6A 3I0HA 4J18A 2J0AA 4NAKA 4HO3A 2WVKA 1H5RB 1E5KA 4FIYA 1Z90A 3NGWA 5HS2A 1JV3A 1ZCUA 1ZCTA 2PX7A 4B4GA 5C47A 4FCEA 4HO9A 2YCMA 4HO2A 4B5BA 2FFVA 2BO7A 1ZHJA 1ZJ0A 3V0PA 4Y7GA 4HO6A 3DJ4A 2Y4MA 2Y4LA 2YQJA 1FZWA 3OH0A 1NMMB 3V0NA 4FRQA 2ZU7A 3RSBA 3U2WA 1OQMB 4G3SA 1TW5A 4FRAA 5C48A 5CQPA 2JCKA 1GQ9A 3Q4SA 4HO5A 2PGVA 1H7QA 5C3DA 4MNDA 4Y6NA 2V0IA 5J49A 3JTJA 4EE5A 5I1FA 4KC1A 5C38A 4B42A 1ZI5A 5AJOA 1R82A 4EVWA 4XWIA 4B3UA 5BXCA 2RJ6A 3ZLKA 1H7GA
chains in the Genus database with same CATH topology
4YS8A 2GGOA 5C1GA 3SXEA 1O7OA 4EEMA 5D92A 1FRWA 4Q7CA 3I0JA 5DDVA 3IOIA 3KIAA 2UX8A 3OAMA 5FU8A 4BMAA 2RJ1A 3V0MA 3R2WA 3K8DA 2VS5A 2WAWA 2YC5A 3DUVA 4FCUA 1O23B 1LL2A 5C8RA 2YQHA 3U2UA 1H7FA 1HM9A 1FO9A 1GX4A 2E3DA 2YQCA 1MP4A 2VSIA 4B4BA 3U2VA 1S4NA 3SX5A 2I7BA 3U2TA 1LZIA 1FGXA 2OEFA 1JYKA 4HG6A 5C4CA 1INJA 1VZUA 1OMXA 1TW1A 3D8VA 1VZTA 2P6WA 3SX7A 2JCLA 2Y4JA 2AM4A 2VXLA 1JYLA 1FR8A 5EIYA 5IDTA 1GWVA 1VPAA 5FUHA 3K8EA 4EEAA 4FRBA 4NAIA 3OH3A 3ZF8A 1JVDA 4ASYA 1NQIB 2PA4A 2XWNA 4M28A 4CVHA 1G9RA 5C4BA 4R7PA 1ZIZA 2XMHA 1G23A 4FRPA 2Q4JA 1WVCA 3FWWA 3LW6A 1INIA 4K6RA 1TZFA 3BRKX 3FOQA 5JQQA 1HM0A 2WVMA 5EJ1A 1ON6A 3BCVA 4EE3A 4ARWA 1H5TB 2CU2A 4KC2A 2X65A 4JD0A 3N9WA 4Y63A 5FU0A 5L6SA 2W0VA 3F1CA 1ZI1A 5IFYA 1V82A 4EEOA 1ZDFA 2OEGA 1KWSA 1H4DA 1VGUA 2O1GA 1ZDGA 3E26A 2AE7A 3USQA 3CKQA 1IIMA 3V90A 1QGSA 3SXAA 4G87A 3E25A 2W0WA 2WVLA 2Y4KA 3GUEA 4NANA 1YP3A 1TVYA 3IOHA 1H5SD 1O0RA 3IOJA 2AGDA 1LL3A 5FTVA 4Y7VA 2AESA 1EYRA 1QGQA 1R7XA 1QWJA 3PKQA 4Y64A 4B2XA 2RIYA 1FO8A 2RIXA 2PGYA 5D91A 1PZYB 5CMGX 1JV1A 3DK5A 2C0NA 2VSHA 4GBPA 1ZI3A 2AECA 1R7TA 4FRMA 3OKRA 2X5SA 4IRPA 5CQNX 2RJ5A 3CU0A 1FGGA 2FYDB 1SS9A 2DPWA 3OC9A 4Y7TA 4L41C 1W57A 4DDZA 1HM8A 1H5SA 2V0JA 2QGIA 1ON8A 1R7VA 3I0IX 2VS4A 1YROB 2O1FA 1LVWA 1G97A 2FYCB 4P00A 3SX3A 4B4MA 3ZLLA 2ICXA 2A8WA 1H7HA 2OI7A 5CMFX 1FR9A 2XWLA 2A8UA 4KPXA 3ZGFA 3SXDA 4BQHA 1VZXA 2RITA 1YP2A 2I5KA 2OI6A 3RMVA 3V8YA 2RJ8A 4MIXA 4ECMA 1IINA 3OGZA 2J0BA 4FRHA 4AAWA 5C4EA 3D98A 4C2SA 1G8OA 2JCJA 3U0XA 4CJBA 4HOCA 1NKHB 4D11A 1OMZA 1H5SB 1JVGA 1NHEB 2NXVA 1WSZA 5C3AA 5C4DA 1MP5A 1V83A 1W77A 1H7EA 3T7OA 1QG8A 3POLA 4AC3A 2WEEA 4NALA 1H5SC 5C49A 3I0DA 3JUJA 3V0LA 4Y9XA 1H5RA 1FOAA 1S4PA 2V0KA 3V0QA 1G3LA 3HL3A 1FXOA 2BO6A 2FFUA 1H7LA 4KNXA 3OH1A 1YP4A 2Y7AA 4Y6UA 3V0OA 2X60A 4HO4A 3RMWA 4KXOA 1VGZA 3SX8A 3Q80A 1H7TA 1R7YA 4KNRA 3SPTA 3OH2A 1GA8A 4DE7A 4E1KA 2D7IA 2WGZA 4FQWA 4B2WA 1G0RA 1LL0A 1GWWA 1MP3A 5C36A 2YC3A 3ST8A 2VK9A 3EE5A 2D0JA 4CJ8A 4ASJA 2O1HA 4Y62A 4IRQA 3O3PA 1R7UA 1VH1A 2WE9A 1ZI4A 3CKVA 3T7NA 3SXGA 2APCA 2MZBA 5C1LA 3D5NA 1G2VA 2YESA 3QVBA 3PKPA 4FREA 2RJ7A 1WT0A 2X5ZA 3TZTA 1G95A 5C4FA 3I0CA 4LW3A 4P02A 2XMEA 4HO8A 1ZJOA 2BO8A 5AJNA 1NWGB 3U0YA 4Y7UA 3PNNA 1ZJ1A 3TQDA 2JCOA 1FXJA 1W55A 4Y7FA 3I0LA 1R81A 3I0FA 4O6MA 2VXMA 3CKNA 4M2BA 4D48A 1LZ0A 4KRVA 1H4EA 5AJPA 2Z87A 3I0KA 4M2AA 1HJJA 1ZCVA 1GX0A 4FRLA 1XHBA 1GQCA 2AH9A 4FROA 4UEGA 1K4VA 2FYBA 1S4OA 2ZU9A 1MC3A 2RJ4A 5CQMX 5CMHA 2GGQA 1VGWA 2RIZA 1HJLA 4FIXA 2VD4A 1FWYA 1R80A 2RJ0A 4G3QA 4KT7A 4ZDQA 2AM5A 5C1HA 2YQSA 5CQLX 4DECA 2XWMA 4EE4A 3V91A 4AYLA 2QKXA 1XZ6A 5CMJA 3Q7UA 4G3PA 4AYJA 3CGXA 1VGTA 1VICA 2D7RA 4D0TA 1LZ7A 1VM8A 4CJCA 4HO0A 3F1YA 5L6VA 2E8BA 3OH4A 1ZJ3A 3V8ZA 2Z86A 3ZGGA 1ZCYA 5IDSA 2QH5A 2FYAA 3SXBA 2AM3A 2RJ9A 1O7QA 2OI5A 1I52A 1ZJ2A 1LZJA 1EZIA 3USRA 5CQOA 2I5EA 2Y6PA 5C3BA 1WT2A 1H4CA 3I0EA 4KC4A 1ZJPA 3T7MA 1FG5N 1G1LA 1H5TA 5CMIA 3CKJA 1H3MA 4KQLA 2BO4A 4JISA 1PZTA 5FYEA 4M4KA 1V84A 5DDTA 3U2XA 3I0GA 2FY7A 2ICYA 4FRDA 5EJZA 1WT1A 1VH3A 2V0LA 4MYBA 2VFZA 4KPZA 4D0ZA 4HCQA 1WT3A 1HV9A 2P73A 2VS3A 3CKOA 5FV9A 4EEGA 3SXCA 3R3IA 1NF5B 2V0HA 3JUKA 2P72A 1G93A 4D11C 5FTSA 2ZU8A 4O6NA 4LW6A 3I0HA 4J18A 2J0AA 4NAKA 4HO3A 2WVKA 1H5RB 1E5KA 4FIYA 1Z90A 3NGWA 5HS2A 1JV3A 1ZCUA 1ZCTA 2PX7A 4B4GA 5C47A 4FCEA 4HO9A 2YCMA 4HO2A 4B5BA 2FFVA 2BO7A 1ZHJA 1ZJ0A 3V0PA 4Y7GA 4HO6A 3DJ4A 2Y4MA 2Y4LA 2YQJA 1FZWA 3OH0A 1NMMB 3V0NA 4FRQA 2ZU7A 3RSBA 3U2WA 1OQMB 4G3SA 1TW5A 4FRAA 5C48A 5CQPA 2JCKA 1GQ9A 3Q4SA 4HO5A 2PGVA 1H7QA 5C3DA 4MNDA 4Y6NA 2V0IA 5J49A 3JTJA 4EE5A 5I1FA 4KC1A 5C38A 4B42A 1ZI5A 5AJOA 1R82A 4EVWA 4XWIA 4B3UA 5BXCA 2RJ6A 3ZLKA 1H7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS8 A;  2GGO A;  5C1G A;  3SXE A;  1O7O A;  4EEM A;  1FRW A;  3I0J A;  5DDV A;  3IOI A;  3KIA A;  2UX8 A;  3OAM A;  5FU8 A;  4BMA A;  2RJ1 A;  3V0M A;  3R2W A;  3K8D A;  2VS5 A;  2WAW A;  2YC5 A;  3DUV A;  4FCU A;  1O23 B;  1LL2 A;  5C8R A;  2YQH A;  3U2U A;  1H7F A;  1HM9 A;  1FO9 A;  1GX4 A;  2E3D A;  2YQC A;  1MP4 A;  2VSI A;  4B4B A;  3U2V A;  1S4N A;  3SX5 A;  2I7B A;  3U2T A;  1LZI A;  1FGX A;  2OEF A;  1JYK A;  4HG6 A;  5C4C A;  1INJ A;  1VZU A;  1OMX A;  1TW1 A;  3D8V A;  1VZT A;  2P6W A;  3SX7 A;  2JCL A;  2Y4J A;  2AM4 A;  2VXL A;  1JYL A;  1FR8 A;  5EIY A;  5IDT A;  1GWV A;  1VPA A;  5FUH A;  3K8E A;  4EEA A;  4FRB A;  4NAI A;  3OH3 A;  3ZF8 A;  1JVD A;  4ASY A;  1NQI B;  2PA4 A;  2XWN A;  4M28 A;  4CVH A;  1G9R A;  5C4B A;  4R7P A;  1ZIZ A;  2XMH A;  1G23 A;  4FRP A;  2Q4J A;  1WVC A;  3FWW A;  3LW6 A;  1INI A;  4K6R A;  1TZF A;  3BRK X;  3FOQ A;  5JQQ A;  1HM0 A;  2WVM A;  5EJ1 A;  1ON6 A;  3BCV A;  4EE3 A;  4ARW A;  1H5T B;  2CU2 A;  4KC2 A;  2X65 A;  4JD0 A;  3N9W A;  4Y63 A;  5FU0 A;  5L6S A;  2W0V A;  3F1C A;  1ZI1 A;  5IFY A;  1V82 A;  4EEO A;  1ZDF A;  2OEG A;  1KWS A;  1H4D A;  1VGU A;  2O1G A;  1ZDG A;  3E26 A;  2AE7 A;  3USQ A;  3CKQ A;  1IIM A;  3V90 A;  1QGS A;  3SXA A;  4G87 A;  3E25 A;  2W0W A;  2WVL A;  2Y4K A;  3GUE A;  4NAN A;  1YP3 A;  1TVY A;  3IOH A;  1H5S D;  1O0R A;  3IOJ A;  2AGD A;  1LL3 A;  5FTV A;  4Y7V A;  2AES A;  1EYR A;  1QGQ A;  1R7X A;  1QWJ A;  3PKQ A;  4Y64 A;  4B2X A;  2RIY A;  1FO8 A;  2RIX A;  2PGY A;  1PZY B;  5CMG X;  1JV1 A;  3DK5 A;  2VSH A;  4GBP A;  1ZI3 A;  2AEC A;  1R7T A;  4FRM A;  3OKR A;  2X5S A;  4IRP A;  5CQN X;  2RJ5 A;  3CU0 A;  1FGG A;  2FYD B;  1SS9 A;  2DPW A;  3OC9 A;  4Y7T A;  4L41 C;  1W57 A;  4DDZ A;  1HM8 A;  1H5S A;  2V0J A;  2QGI A;  1ON8 A;  1R7V A;  3I0I X;  2VS4 A;  1YRO B;  2O1F A;  1LVW A;  1G97 A;  2FYC B;  4P00 A;  3SX3 A;  4B4M A;  3ZLL A;  2ICX A;  2A8W A;  1H7H A;  2OI7 A;  5CMF X;  1FR9 A;  2XWL A;  2A8U A;  4KPX A;  3ZGF A;  3SXD A;  4BQH A;  1VZX A;  2RIT A;  1YP2 A;  2I5K A;  2OI6 A;  3RMV A;  3V8Y A;  2RJ8 A;  4ECM A;  1IIN A;  3OGZ A;  4FRH A;  4AAW A;  5C4E A;  3D98 A;  4C2S A;  1G8O A;  2JCJ A;  3U0X A;  4CJB A;  4HOC A;  1NKH B;  4D11 A;  1OMZ A;  1H5S B;  1JVG A;  1NHE B;  2NXV A;  1WSZ A;  5C3A A;  5C4D A;  1MP5 A;  1V83 A;  1W77 A;  1H7E A;  3T7O A;  1QG8 A;  3POL A;  4AC3 A;  2WEE A;  4NAL A;  1H5S C;  5C49 A;  3I0D A;  3JUJ A;  3V0L A;  4Y9X A;  1H5R A;  1FOA A;  1S4P A;  2V0K A;  3V0Q A;  1G3L A;  3HL3 A;  1FXO A;  2BO6 A;  2FFU A;  1H7L A;  4KNX A;  3OH1 A;  1YP4 A;  2Y7A A;  4Y6U A;  3V0O A;  2X60 A;  4HO4 A;  3RMW A;  4KXO A;  1VGZ A;  3SX8 A;  3Q80 A;  1H7T A;  1R7Y A;  4KNR A;  3SPT A;  3OH2 A;  1GA8 A;  4DE7 A;  4E1K A;  2D7I A;  2WGZ A;  4FQW A;  4B2W A;  1G0R A;  1LL0 A;  1GWW A;  1MP3 A;  5C36 A;  2YC3 A;  3ST8 A;  3EE5 A;  2D0J A;  4CJ8 A;  4ASJ A;  2O1H A;  4Y62 A;  4IRQ A;  3O3P A;  1R7U A;  1VH1 A;  2WE9 A;  1ZI4 A;  3CKV A;  3T7N A;  3SXG A;  2APC A;  2MZB A;  5C1L A;  3D5N A;  1G2V A;  2YES A;  3QVB A;  3PKP A;  4FRE A;  2RJ7 A;  1WT0 A;  2X5Z A;  3TZT A;  1G95 A;  5C4F A;  3I0C A;  4LW3 A;  4P02 A;  2XME A;  4HO8 A;  1ZJO A;  2BO8 A;  5AJN A;  1NWG B;  3U0Y A;  4Y7U A;  3PNN A;  1ZJ1 A;  3TQD A;  2JCO A;  1FXJ A;  1W55 A;  4Y7F A;  3I0L A;  1R81 A;  3I0F A;  2VXM A;  3CKN A;  4M2B A;  4D48 A;  1LZ0 A;  4KRV A;  1H4E A;  5AJP A;  2Z87 A;  3I0K A;  4M2A A;  1HJJ A;  1ZCV A;  1GX0 A;  4FRL A;  1XHB A;  1GQC A;  2AH9 A;  4FRO A;  4UEG A;  1K4V A;  2FYB A;  1S4O A;  2ZU9 A;  1MC3 A;  2RJ4 A;  5CQM X;  5CMH A;  2GGQ A;  1VGW A;  2RIZ A;  1HJL A;  2VD4 A;  1FWY A;  1R80 A;  2RJ0 A;  4G3Q A;  4KT7 A;  4ZDQ A;  2AM5 A;  5C1H A;  2YQS A;  5CQL X;  4DEC A;  2XWM A;  4EE4 A;  3V91 A;  4AYL A;  2QKX A;  1XZ6 A;  5CMJ A;  3Q7U A;  4G3P A;  4AYJ A;  3CGX A;  1VGT A;  1VIC A;  2D7R A;  4D0T A;  1LZ7 A;  1VM8 A;  4CJC A;  4HO0 A;  3F1Y A;  5L6V A;  2E8B A;  3OH4 A;  1ZJ3 A;  3V8Z A;  2Z86 A;  3ZGG A;  1ZCY A;  5IDS A;  2QH5 A;  2FYA A;  3SXB A;  2AM3 A;  2RJ9 A;  1O7Q A;  2OI5 A;  1I52 A;  1ZJ2 A;  1LZJ A;  1EZI A;  3USR A;  5CQO A;  2I5E A;  2Y6P A;  5C3B A;  1WT2 A;  1H4C A;  3I0E A;  4KC4 A;  1ZJP A;  3T7M A;  1FG5 N;  1G1L A;  1H5T A;  5CMI A;  3CKJ A;  1H3M A;  4KQL A;  2BO4 A;  4JIS A;  1PZT A;  5FYE A;  4M4K A;  1V84 A;  5DDT A;  3U2X A;  3I0G A;  2FY7 A;  2ICY A;  4FRD A;  5EJZ A;  1WT1 A;  1VH3 A;  2V0L A;  4MYB A;  2VFZ A;  4KPZ A;  4D0Z A;  4HCQ A;  1WT3 A;  1HV9 A;  2P73 A;  2VS3 A;  3CKO A;  5FV9 A;  4EEG A;  3SXC A;  3R3I A;  1NF5 B;  2V0H A;  3JUK A;  2P72 A;  1G93 A;  4D11 C;  5FTS A;  2ZU8 A;  4LW6 A;  3I0H A;  4J18 A;  4NAK A;  4HO3 A;  2WVK A;  1H5R B;  1E5K A;  1Z90 A;  3NGW A;  5HS2 A;  1JV3 A;  1ZCU A;  1ZCT A;  2PX7 A;  4B4G A;  5C47 A;  4FCE A;  4HO9 A;  2YCM A;  4HO2 A;  4B5B A;  2FFV A;  2BO7 A;  1ZHJ A;  1ZJ0 A;  3V0P A;  4Y7G A;  4HO6 A;  3DJ4 A;  2Y4M A;  2Y4L A;  2YQJ A;  1FZW A;  3OH0 A;  1NMM B;  3V0N A;  4FRQ A;  2ZU7 A;  3RSB A;  3U2W A;  1OQM B;  4G3S A;  1TW5 A;  4FRA A;  5C48 A;  5CQP A;  2JCK A;  1GQ9 A;  3Q4S A;  4HO5 A;  2PGV A;  1H7Q A;  5C3D A;  4MND A;  4Y6N A;  2V0I A;  5J49 A;  3JTJ A;  4EE5 A;  5I1F A;  4KC1 A;  5C38 A;  4B42 A;  1ZI5 A;  5AJO A;  1R82 A;  4EVW A;  4XWI A;  4B3U A;  5BXC A;  2RJ6 A;  3ZLK A;  1H7G A; 
#chains in the Genus database with same CATH topology
 4YS8 A;  2GGO A;  5C1G A;  3SXE A;  1O7O A;  4EEM A;  5D92 A;  1FRW A;  4Q7C A;  3I0J A;  5DDV A;  3IOI A;  3KIA A;  2UX8 A;  3OAM A;  5FU8 A;  4BMA A;  2RJ1 A;  3V0M A;  3R2W A;  3K8D A;  2VS5 A;  2WAW A;  2YC5 A;  3DUV A;  4FCU A;  1O23 B;  1LL2 A;  5C8R A;  2YQH A;  3U2U A;  1H7F A;  1HM9 A;  1FO9 A;  1GX4 A;  2E3D A;  2YQC A;  1MP4 A;  2VSI A;  4B4B A;  3U2V A;  1S4N A;  3SX5 A;  2I7B A;  3U2T A;  1LZI A;  1FGX A;  2OEF A;  1JYK A;  4HG6 A;  5C4C A;  1INJ A;  1VZU A;  1OMX A;  1TW1 A;  3D8V A;  1VZT A;  2P6W A;  3SX7 A;  2JCL A;  2Y4J A;  2AM4 A;  2VXL A;  1JYL A;  1FR8 A;  5EIY A;  5IDT A;  1GWV A;  1VPA A;  5FUH A;  3K8E A;  4EEA A;  4FRB A;  4NAI A;  3OH3 A;  3ZF8 A;  1JVD A;  4ASY A;  1NQI B;  2PA4 A;  2XWN A;  4M28 A;  4CVH A;  1G9R A;  5C4B A;  4R7P A;  1ZIZ A;  2XMH A;  1G23 A;  4FRP A;  2Q4J A;  1WVC A;  3FWW A;  3LW6 A;  1INI A;  4K6R A;  1TZF A;  3BRK X;  3FOQ A;  5JQQ A;  1HM0 A;  2WVM A;  5EJ1 A;  1ON6 A;  3BCV A;  4EE3 A;  4ARW A;  1H5T B;  2CU2 A;  4KC2 A;  2X65 A;  4JD0 A;  3N9W A;  4Y63 A;  5FU0 A;  5L6S A;  2W0V A;  3F1C A;  1ZI1 A;  5IFY A;  1V82 A;  4EEO A;  1ZDF A;  2OEG A;  1KWS A;  1H4D A;  1VGU A;  2O1G A;  1ZDG A;  3E26 A;  2AE7 A;  3USQ A;  3CKQ A;  1IIM A;  3V90 A;  1QGS A;  3SXA A;  4G87 A;  3E25 A;  2W0W A;  2WVL A;  2Y4K A;  3GUE A;  4NAN A;  1YP3 A;  1TVY A;  3IOH A;  1H5S D;  1O0R A;  3IOJ A;  2AGD A;  1LL3 A;  5FTV A;  4Y7V A;  2AES A;  1EYR A;  1QGQ A;  1R7X A;  1QWJ A;  3PKQ A;  4Y64 A;  4B2X A;  2RIY A;  1FO8 A;  2RIX A;  2PGY A;  5D91 A;  1PZY B;  5CMG X;  1JV1 A;  3DK5 A;  2C0N A;  2VSH A;  4GBP A;  1ZI3 A;  2AEC A;  1R7T A;  4FRM A;  3OKR A;  2X5S A;  4IRP A;  5CQN X;  2RJ5 A;  3CU0 A;  1FGG A;  2FYD B;  1SS9 A;  2DPW A;  3OC9 A;  4Y7T A;  4L41 C;  1W57 A;  4DDZ A;  1HM8 A;  1H5S A;  2V0J A;  2QGI A;  1ON8 A;  1R7V A;  3I0I X;  2VS4 A;  1YRO B;  2O1F A;  1LVW A;  1G97 A;  2FYC B;  4P00 A;  3SX3 A;  4B4M A;  3ZLL A;  2ICX A;  2A8W A;  1H7H A;  2OI7 A;  5CMF X;  1FR9 A;  2XWL A;  2A8U A;  4KPX A;  3ZGF A;  3SXD A;  4BQH A;  1VZX A;  2RIT A;  1YP2 A;  2I5K A;  2OI6 A;  3RMV A;  3V8Y A;  2RJ8 A;  4MIX A;  4ECM A;  1IIN A;  3OGZ A;  2J0B A;  4FRH A;  4AAW A;  5C4E A;  3D98 A;  4C2S A;  1G8O A;  2JCJ A;  3U0X A;  4CJB A;  4HOC A;  1NKH B;  4D11 A;  1OMZ A;  1H5S B;  1JVG A;  1NHE B;  2NXV A;  1WSZ A;  5C3A A;  5C4D A;  1MP5 A;  1V83 A;  1W77 A;  1H7E A;  3T7O A;  1QG8 A;  3POL A;  4AC3 A;  2WEE A;  4NAL A;  1H5S C;  5C49 A;  3I0D A;  3JUJ A;  3V0L A;  4Y9X A;  1H5R A;  1FOA A;  1S4P A;  2V0K A;  3V0Q A;  1G3L A;  3HL3 A;  1FXO A;  2BO6 A;  2FFU A;  1H7L A;  4KNX A;  3OH1 A;  1YP4 A;  2Y7A A;  4Y6U A;  3V0O A;  2X60 A;  4HO4 A;  3RMW A;  4KXO A;  1VGZ A;  3SX8 A;  3Q80 A;  1H7T A;  1R7Y A;  4KNR A;  3SPT A;  3OH2 A;  1GA8 A;  4DE7 A;  4E1K A;  2D7I A;  2WGZ A;  4FQW A;  4B2W A;  1G0R A;  1LL0 A;  1GWW A;  1MP3 A;  5C36 A;  2YC3 A;  3ST8 A;  2VK9 A;  3EE5 A;  2D0J A;  4CJ8 A;  4ASJ A;  2O1H A;  4Y62 A;  4IRQ A;  3O3P A;  1R7U A;  1VH1 A;  2WE9 A;  1ZI4 A;  3CKV A;  3T7N A;  3SXG A;  2APC A;  2MZB A;  5C1L A;  3D5N A;  1G2V A;  2YES A;  3QVB A;  3PKP A;  4FRE A;  2RJ7 A;  1WT0 A;  2X5Z A;  3TZT A;  1G95 A;  5C4F A;  3I0C A;  4LW3 A;  4P02 A;  2XME A;  4HO8 A;  1ZJO A;  2BO8 A;  5AJN A;  1NWG B;  3U0Y A;  4Y7U A;  3PNN A;  1ZJ1 A;  3TQD A;  2JCO A;  1FXJ A;  1W55 A;  4Y7F A;  3I0L A;  1R81 A;  3I0F A;  4O6M A;  2VXM A;  3CKN A;  4M2B A;  4D48 A;  1LZ0 A;  4KRV A;  1H4E A;  5AJP A;  2Z87 A;  3I0K A;  4M2A A;  1HJJ A;  1ZCV A;  1GX0 A;  4FRL A;  1XHB A;  1GQC A;  2AH9 A;  4FRO A;  4UEG A;  1K4V A;  2FYB A;  1S4O A;  2ZU9 A;  1MC3 A;  2RJ4 A;  5CQM X;  5CMH A;  2GGQ A;  1VGW A;  2RIZ A;  1HJL A;  4FIX A;  2VD4 A;  1FWY A;  1R80 A;  2RJ0 A;  4G3Q A;  4KT7 A;  4ZDQ A;  2AM5 A;  5C1H A;  2YQS A;  5CQL X;  4DEC A;  2XWM A;  4EE4 A;  3V91 A;  4AYL A;  2QKX A;  1XZ6 A;  5CMJ A;  3Q7U A;  4G3P A;  4AYJ A;  3CGX A;  1VGT A;  1VIC A;  2D7R A;  4D0T A;  1LZ7 A;  1VM8 A;  4CJC A;  4HO0 A;  3F1Y A;  5L6V A;  2E8B A;  3OH4 A;  1ZJ3 A;  3V8Z A;  2Z86 A;  3ZGG A;  1ZCY A;  5IDS A;  2QH5 A;  2FYA A;  3SXB A;  2AM3 A;  2RJ9 A;  1O7Q A;  2OI5 A;  1I52 A;  1ZJ2 A;  1LZJ A;  1EZI A;  3USR A;  5CQO A;  2I5E A;  2Y6P A;  5C3B A;  1WT2 A;  1H4C A;  3I0E A;  4KC4 A;  1ZJP A;  3T7M A;  1FG5 N;  1G1L A;  1H5T A;  5CMI A;  3CKJ A;  1H3M A;  4KQL A;  2BO4 A;  4JIS A;  1PZT A;  5FYE A;  4M4K A;  1V84 A;  5DDT A;  3U2X A;  3I0G A;  2FY7 A;  2ICY A;  4FRD A;  5EJZ A;  1WT1 A;  1VH3 A;  2V0L A;  4MYB A;  2VFZ A;  4KPZ A;  4D0Z A;  4HCQ A;  1WT3 A;  1HV9 A;  2P73 A;  2VS3 A;  3CKO A;  5FV9 A;  4EEG A;  3SXC A;  3R3I A;  1NF5 B;  2V0H A;  3JUK A;  2P72 A;  1G93 A;  4D11 C;  5FTS A;  2ZU8 A;  4O6N A;  4LW6 A;  3I0H A;  4J18 A;  2J0A A;  4NAK A;  4HO3 A;  2WVK A;  1H5R B;  1E5K A;  4FIY A;  1Z90 A;  3NGW A;  5HS2 A;  1JV3 A;  1ZCU A;  1ZCT A;  2PX7 A;  4B4G A;  5C47 A;  4FCE A;  4HO9 A;  2YCM A;  4HO2 A;  4B5B A;  2FFV A;  2BO7 A;  1ZHJ A;  1ZJ0 A;  3V0P A;  4Y7G A;  4HO6 A;  3DJ4 A;  2Y4M A;  2Y4L A;  2YQJ A;  1FZW A;  3OH0 A;  1NMM B;  3V0N A;  4FRQ A;  2ZU7 A;  3RSB A;  3U2W A;  1OQM B;  4G3S A;  1TW5 A;  4FRA A;  5C48 A;  5CQP A;  2JCK A;  1GQ9 A;  3Q4S A;  4HO5 A;  2PGV A;  1H7Q A;  5C3D A;  4MND A;  4Y6N A;  2V0I A;  5J49 A;  3JTJ A;  4EE5 A;  5I1F A;  4KC1 A;  5C38 A;  4B42 A;  1ZI5 A;  5AJO A;  1R82 A;  4EVW A;  4XWI A;  4B3U A;  5BXC A;  2RJ6 A;  3ZLK A;  1H7G A; 
#chains in the Genus database with same CATH homology
 4YS8 A;  2GGO A;  5C1G A;  3SXE A;  1O7O A;  4EEM A;  5D92 A;  1FRW A;  4Q7C A;  3I0J A;  5DDV A;  3IOI A;  3KIA A;  2UX8 A;  3OAM A;  5FU8 A;  4BMA A;  2RJ1 A;  3V0M A;  3R2W A;  3K8D A;  2VS5 A;  2WAW A;  2YC5 A;  3DUV A;  4FCU A;  1O23 B;  1LL2 A;  5C8R A;  2YQH A;  3U2U A;  1H7F A;  1HM9 A;  1FO9 A;  1GX4 A;  2E3D A;  2YQC A;  1MP4 A;  2VSI A;  4B4B A;  3U2V A;  1S4N A;  3SX5 A;  2I7B A;  3U2T A;  1LZI A;  1FGX A;  2OEF A;  1JYK A;  4HG6 A;  5C4C A;  1INJ A;  1VZU A;  1OMX A;  1TW1 A;  3D8V A;  1VZT A;  2P6W A;  3SX7 A;  2JCL A;  2Y4J A;  2AM4 A;  2VXL A;  1JYL A;  1FR8 A;  5EIY A;  5IDT A;  1GWV A;  1VPA A;  5FUH A;  3K8E A;  4EEA A;  4FRB A;  4NAI A;  3OH3 A;  3ZF8 A;  1JVD A;  4ASY A;  1NQI B;  2PA4 A;  2XWN A;  4M28 A;  4CVH A;  1G9R A;  5C4B A;  4R7P A;  1ZIZ A;  2XMH A;  1G23 A;  4FRP A;  2Q4J A;  1WVC A;  3FWW A;  3LW6 A;  1INI A;  4K6R A;  1TZF A;  3BRK X;  3FOQ A;  5JQQ A;  1HM0 A;  2WVM A;  5EJ1 A;  1ON6 A;  3BCV A;  4EE3 A;  4ARW A;  1H5T B;  2CU2 A;  4KC2 A;  2X65 A;  4JD0 A;  3N9W A;  4Y63 A;  5FU0 A;  5L6S A;  2W0V A;  3F1C A;  1ZI1 A;  5IFY A;  1V82 A;  4EEO A;  1ZDF A;  2OEG A;  1KWS A;  1H4D A;  1VGU A;  2O1G A;  1ZDG A;  3E26 A;  2AE7 A;  3USQ A;  3CKQ A;  1IIM A;  3V90 A;  1QGS A;  3SXA A;  4G87 A;  3E25 A;  2W0W A;  2WVL A;  2Y4K A;  3GUE A;  4NAN A;  1YP3 A;  1TVY A;  3IOH A;  1H5S D;  1O0R A;  3IOJ A;  2AGD A;  1LL3 A;  5FTV A;  4Y7V A;  2AES A;  1EYR A;  1QGQ A;  1R7X A;  1QWJ A;  3PKQ A;  4Y64 A;  4B2X A;  2RIY A;  1FO8 A;  2RIX A;  2PGY A;  5D91 A;  1PZY B;  5CMG X;  1JV1 A;  3DK5 A;  2C0N A;  2VSH A;  4GBP A;  1ZI3 A;  2AEC A;  1R7T A;  4FRM A;  3OKR A;  2X5S A;  4IRP A;  5CQN X;  2RJ5 A;  3CU0 A;  1FGG A;  2FYD B;  1SS9 A;  2DPW A;  3OC9 A;  4Y7T A;  4L41 C;  1W57 A;  4DDZ A;  1HM8 A;  1H5S A;  2V0J A;  2QGI A;  1ON8 A;  1R7V A;  3I0I X;  2VS4 A;  1YRO B;  2O1F A;  1LVW A;  1G97 A;  2FYC B;  4P00 A;  3SX3 A;  4B4M A;  3ZLL A;  2ICX A;  2A8W A;  1H7H A;  2OI7 A;  5CMF X;  1FR9 A;  2XWL A;  2A8U A;  4KPX A;  3ZGF A;  3SXD A;  4BQH A;  1VZX A;  2RIT A;  1YP2 A;  2I5K A;  2OI6 A;  3RMV A;  3V8Y A;  2RJ8 A;  4MIX A;  4ECM A;  1IIN A;  3OGZ A;  2J0B A;  4FRH A;  4AAW A;  5C4E A;  3D98 A;  4C2S A;  1G8O A;  2JCJ A;  3U0X A;  4CJB A;  4HOC A;  1NKH B;  4D11 A;  1OMZ A;  1H5S B;  1JVG A;  1NHE B;  2NXV A;  1WSZ A;  5C3A A;  5C4D A;  1MP5 A;  1V83 A;  1W77 A;  1H7E A;  3T7O A;  1QG8 A;  3POL A;  4AC3 A;  2WEE A;  4NAL A;  1H5S C;  5C49 A;  3I0D A;  3JUJ A;  3V0L A;  4Y9X A;  1H5R A;  1FOA A;  1S4P A;  2V0K A;  3V0Q A;  1G3L A;  3HL3 A;  1FXO A;  2BO6 A;  2FFU A;  1H7L A;  4KNX A;  3OH1 A;  1YP4 A;  2Y7A A;  4Y6U A;  3V0O A;  2X60 A;  4HO4 A;  3RMW A;  4KXO A;  1VGZ A;  3SX8 A;  3Q80 A;  1H7T A;  1R7Y A;  4KNR A;  3SPT A;  3OH2 A;  1GA8 A;  4DE7 A;  4E1K A;  2D7I A;  2WGZ A;  4FQW A;  4B2W A;  1G0R A;  1LL0 A;  1GWW A;  1MP3 A;  5C36 A;  2YC3 A;  3ST8 A;  2VK9 A;  3EE5 A;  2D0J A;  4CJ8 A;  4ASJ A;  2O1H A;  4Y62 A;  4IRQ A;  3O3P A;  1R7U A;  1VH1 A;  2WE9 A;  1ZI4 A;  3CKV A;  3T7N A;  3SXG A;  2APC A;  2MZB A;  5C1L A;  3D5N A;  1G2V A;  2YES A;  3QVB A;  3PKP A;  4FRE A;  2RJ7 A;  1WT0 A;  2X5Z A;  3TZT A;  1G95 A;  5C4F A;  3I0C A;  4LW3 A;  4P02 A;  2XME A;  4HO8 A;  1ZJO A;  2BO8 A;  5AJN A;  1NWG B;  3U0Y A;  4Y7U A;  3PNN A;  1ZJ1 A;  3TQD A;  2JCO A;  1FXJ A;  1W55 A;  4Y7F A;  3I0L A;  1R81 A;  3I0F A;  4O6M A;  2VXM A;  3CKN A;  4M2B A;  4D48 A;  1LZ0 A;  4KRV A;  1H4E A;  5AJP A;  2Z87 A;  3I0K A;  4M2A A;  1HJJ A;  1ZCV A;  1GX0 A;  4FRL A;  1XHB A;  1GQC A;  2AH9 A;  4FRO A;  4UEG A;  1K4V A;  2FYB A;  1S4O A;  2ZU9 A;  1MC3 A;  2RJ4 A;  5CQM X;  5CMH A;  2GGQ A;  1VGW A;  2RIZ A;  1HJL A;  4FIX A;  2VD4 A;  1FWY A;  1R80 A;  2RJ0 A;  4G3Q A;  4KT7 A;  4ZDQ A;  2AM5 A;  5C1H A;  2YQS A;  5CQL X;  4DEC A;  2XWM A;  4EE4 A;  3V91 A;  4AYL A;  2QKX A;  1XZ6 A;  5CMJ A;  3Q7U A;  4G3P A;  4AYJ A;  3CGX A;  1VGT A;  1VIC A;  2D7R A;  4D0T A;  1LZ7 A;  1VM8 A;  4CJC A;  4HO0 A;  3F1Y A;  5L6V A;  2E8B A;  3OH4 A;  1ZJ3 A;  3V8Z A;  2Z86 A;  3ZGG A;  1ZCY A;  5IDS A;  2QH5 A;  2FYA A;  3SXB A;  2AM3 A;  2RJ9 A;  1O7Q A;  2OI5 A;  1I52 A;  1ZJ2 A;  1LZJ A;  1EZI A;  3USR A;  5CQO A;  2I5E A;  2Y6P A;  5C3B A;  1WT2 A;  1H4C A;  3I0E A;  4KC4 A;  1ZJP A;  3T7M A;  1FG5 N;  1G1L A;  1H5T A;  5CMI A;  3CKJ A;  1H3M A;  4KQL A;  2BO4 A;  4JIS A;  1PZT A;  5FYE A;  4M4K A;  1V84 A;  5DDT A;  3U2X A;  3I0G A;  2FY7 A;  2ICY A;  4FRD A;  5EJZ A;  1WT1 A;  1VH3 A;  2V0L A;  4MYB A;  2VFZ A;  4KPZ A;  4D0Z A;  4HCQ A;  1WT3 A;  1HV9 A;  2P73 A;  2VS3 A;  3CKO A;  5FV9 A;  4EEG A;  3SXC A;  3R3I A;  1NF5 B;  2V0H A;  3JUK A;  2P72 A;  1G93 A;  4D11 C;  5FTS A;  2ZU8 A;  4O6N A;  4LW6 A;  3I0H A;  4J18 A;  2J0A A;  4NAK A;  4HO3 A;  2WVK A;  1H5R B;  1E5K A;  4FIY A;  1Z90 A;  3NGW A;  5HS2 A;  1JV3 A;  1ZCU A;  1ZCT A;  2PX7 A;  4B4G A;  5C47 A;  4FCE A;  4HO9 A;  2YCM A;  4HO2 A;  4B5B A;  2FFV A;  2BO7 A;  1ZHJ A;  1ZJ0 A;  3V0P A;  4Y7G A;  4HO6 A;  3DJ4 A;  2Y4M A;  2Y4L A;  2YQJ A;  1FZW A;  3OH0 A;  1NMM B;  3V0N A;  4FRQ A;  2ZU7 A;  3RSB A;  3U2W A;  1OQM B;  4G3S A;  1TW5 A;  4FRA A;  5C48 A;  5CQP A;  2JCK A;  1GQ9 A;  3Q4S A;  4HO5 A;  2PGV A;  1H7Q A;  5C3D A;  4MND A;  4Y6N A;  2V0I A;  5J49 A;  3JTJ A;  4EE5 A;  5I1F A;  4KC1 A;  5C38 A;  4B42 A;  1ZI5 A;  5AJO A;  1R82 A;  4EVW A;  4XWI A;  4B3U A;  5BXC A;  2RJ6 A;  3ZLK A;  1H7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...