2C0NA

Crystal structure of a197 from stiv
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
200
structure length
191
Chain Sequence
MRTLFFIPSMGSVRLPLIDFLVKNDIEYVILSRRNHVAVQREIALDMFLEMKDYDTLAFLDEDVVPIEIDFQKVEAKFNEGYDVVCGYYYLKTLRGYSVYRKDWEKEIFDGEVNGCGLGFTFIKREFLEKIKRPAFLAIGEDVYFFSTHKPRTYALSSLKAYHFIDERLALSPDRKLILQNDHVARIKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/transferase
molecule keywords A197
publication title Structure of A197 from Sulfolobus Turreted Icosahedral Virus: A Crenarchaeal Viral Glycosyltransferase Exhibiting the Gt-A Fold.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
total genus 53
structure length 191
sequence length 200
ec nomenclature
pdb deposition date 2005-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.40 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2c0nA00
2C0NA
chains in the Genus database with same CATH superfamily
2AM3A 2E3DA 1Z90A 1H5SB 2RIXA 2RITA 4Y9XA 5C47A 4KXOA 3I0DA 3I0LA 4D48A 4ZDQA 2MZBA 2QH5A 4ASYA 4FRHA 1IIMA 1H5RA 2GGOA 3N9WA 3V0MA 5L6SA 3QVBA 1HM9A 2X60A 3V90A 1ZJ3A 1FGXA 2BO4A 1JYKA 5FU8A 2V0IA 4Y64A 5FTSA 1VH1A 3SXCA 1JVGA 3F1YA 1ZI3A 2OEFA 2WVLA 2XMHA 2OI7A 2P6WA 2V0KA 1FO8A 3JTJA 2ZU7A 4Y7GA 3JUKA 3OH4A 2FY7A 2Y6PA 1I52A 1G9RA 5D92A 3POLA 4Q7CA 3I0GA 4O6MA 1JV1A 3V91A 3V0OA 3CKVA 2O1FA 2RJ1A 1VH3A 2JCLA 1HV9A 1R81A 2OEGA 2Y4LA 1ZI4A 1H4CA 5CMIA 5CMFX 4O6NA 1TZFA 3I0KA 4FCEA 1ON8A 3RMVA 5C38A 2VSIA 1IINA 3E25A 1XZ6A 1G2VA 2OI5A 1NMMB 3I0IX 5C3DA 1LL3A 1ZJOA 1HJJA 1H7FA 2YC5A 5C8RA 2BO8A 4CJ8A 2AE7A 2QKXA 3PKQA 2OI6A 1ZCUA 2YESA 1ZDFA 4M4KA 5I1FA 4KNRA 4E1KA 4FRQA 3OH1A 3DUVA 1OMXA 3IOHA 1NF5B 1ZIZA 1G3LA 2V0JA 4GBPA 2RJ9A 4UEGA 3Q80A 1MP3A 4HO9A 4G3QA 4P02A 4G3PA 4MIXA 3K8EA 1ZCTA 4KPZA 1K4VA 4DE7A 3DK5A 1WT1A 4M2AA 1MP4A 1VGZA 4MNDA 1EZIA 4Y7UA 1NKHB 4AYJA 1R7XA 2FFUA 1W77A 3FWWA 3V0PA 1H4EA 3R2WA 3V0QA 1O23B 4AAWA 3SPTA 1S4PA 1H7EA 3U2XA 1QGSA 1V83A 1JVDA 5CQNX 1V84A 3Q7UA 4M2BA 4Y6NA 1TVYA 3OAMA 1INJA 1PZTA 4FCUA 2D7RA 1WSZA 1V82A 5C4FA 4HG6A 4B3UA 1HM8A 2P73A 2XWMA 2YQHA 3NGWA 1XHBA 5CQPA 2YQCA 1FOAA 1VGTA 1S4OA 1FR8A 4EVWA 2DPWA 1GWWA 5EJ1A 1H5SC 1O7QA 1VICA 3OH0A 4XWIA 3U0XA 2YQSA 4KC4A 4HCQA 3ZF8A 4AYLA 5FU0A 4IRPA 3T7MA 2RJ8A 4B42A 1W57A 1H5SA 1PZYB 2RJ0A 1VGWA 1H7QA 5C1LA 1YP2A 4KQLA 1H5TB 1W55A 5C4BA 4CVHA 1JV3A 2V0HA 4KRVA 3SXGA 2WE9A 4KT7A 4JD0A 1LVWA 4HO8A 4HO6A 4MYBA 4B4BA 4EEAA 1G95A 1NHEB 2RJ6A 3CKNA 2I5KA 1ZDGA 5IFYA 2AM4A 4LW6A 1H5TA 1GX0A 3V0NA 2RIZA 5CQMX 3ZLKA 1TW1A 2YC3A 2BO6A 2Y4JA 2VK9A 5CQLX 5HS2A 2PX7A 4FRDA 1H3MA 1FZWA 3K8DA 2V0LA 5AJNA 2RJ5A 4DDZA 3V0LA 3E26A 2VSHA 3IOIA 4HO4A 1R7UA 3CGXA 4FRAA 1G93A 4NAIA 3SXDA 3SXBA 3OGZA 3TQDA 2RIYA 2VD4A 1WT3A 4M28A 4Y6UA 1FO9A 2E8BA 1WT2A 3O3PA 3I0CA 1R7YA 2AM5A 3BRKX 4R7PA 1GQCA 1YP3A 1LZJA 5EJZA 2P72A 3T7OA 1NWGB 4G3SA 3EE5A 1R80A 2CU2A 2X5ZA 4ASJA 4Y63A 5FTVA 2YQJA 1JYLA 1ZCYA 1MC3A 2NXVA 1GX4A 1H5SD 1VPAA 4B4GA 2AH9A 4FROA 2O1GA 5JQQA 1OMZA 2VS4A 1WT0A 4EEGA 1TW5A 2ICXA 3RMWA 5FV9A 4NALA 2GGQA 2AGDA 4FIXA 4P00A 3KIAA 1VGUA 2I5EA 2ICYA 3I0FA 1ZCVA 3ZGFA 3SX5A 1ZJPA 4EE5A 2WGZA 3V8ZA 2WVMA 2XWLA 2Y4KA 4CJCA 4EEMA 2WVKA 4AC3A 5AJPA 3JUJA 1KWSA 2AECA 4KC2A 3FOQA 4CJBA 3RSBA 1OQMB 1VZXA 3SX3A 3T7NA 5L6VA 3USRA 1YP4A 5J49A 1ZJ0A 5C1GA 1LZIA 1GQ9A 4BQHA 1ZJ1A 5C48A 4FRPA 3ZLLA 5FUHA 2Z86A 5FYEA 4KPXA 2QGIA 3U0YA 4FREA 3CKQA 3CKJA 3I0EA 1LL2A 2ZU8A 3I0JA 1O7OA 1E5KA 3CU0A 5EIYA 3PNNA 4EEOA 1G23A 1HJLA 2FYAA 1MP5A 2W0WA 4NANA 2J0BA 2X65A 2D7IA 3R3IA 2FFVA 3HL3A 1H7HA 1SS9A 5CMJA 1G1LA 3USQA 4FRMA 5D91A 1YROB 1VZTA 3SXAA 1ZJ2A 1G97A 4HO3A 3GUEA 1NQIB 3CKOA 5DDTA 4NAKA 3OC9A 5IDSA 4LW3A 2O1HA 3BCVA 1H7TA 2D0JA 4HO5A 4ARWA 2JCJA 5C36A 1O0RA 3TZTA 4JISA 1FGGA 4D11C 3U2VA 4FIYA 3D5NA 3SXEA 1ZI5A 4K6RA 2UX8A 4KC1A 2VFZA 4EE3A 2J0AA 3V8YA 1H7GA 4C2SA 2APCA 5CMHA 1FRWA 2FYBA 5AJOA 2VXMA 4D11A 3F1CA 3Q4SA 2AESA 4B2WA 3I0HA 1S4NA 4KNXA 1FXJA 4J18A 2ZU9A 4HO0A 1QWJA 2YCMA 5IDTA 2Y7AA 4B2XA 4FQWA 2PGVA 1R7TA 4EE4A 5C3AA 1R7VA 3U2TA 1FXOA 5C4CA 1QGQA 1QG8A 2Q4JA 1GWVA 3D8VA 4IRQA 4B5BA 5CMGX 4HOCA 5BXCA 1H4DA 5C4EA 1VM8A 2RJ4A 2VXLA 4L41C 2PA4A 4G87A 2X5SA 1FR9A 1GA8A 1R82A 1EYRA 2A8WA 2JCKA 1LZ7A 3ZGGA 2JCOA 1H7LA 4Y7FA 2WAWA 2BO7A 1WVCA 1VZUA 4D0TA 2Z87A 5C3BA 1ON6A 3OKRA 5C49A 1FG5N 4FRLA 4FRBA 1INIA 4BMAA 1ZI1A 2A8UA 1FWYA 1LZ0A 3LW6A 4HO2A 5CQOA 5C4DA 2FYCB 2XWNA 1HM0A 3ST8A 2C0NA 4Y7VA 4B4MA 4Y62A 3OH3A 3SX8A 2XMEA 1G0RA 1G8OA 2FYDB 2RJ7A 2W0VA 3PKPA 3SX7A 1ZHJA 3DJ4A 4ECMA 4YS8A 5DDVA 2Y4MA 2PGYA 2VS5A 2VS3A 3IOJA 3U2UA 1LL0A 1H5RB 3U2WA 4D0ZA 2WEEA 3OH2A 4DECA 5C1HA 2I7BA 4Y7TA 3D98A
chains in the Genus database with same CATH topology
2AM3A 2E3DA 1Z90A 1H5SB 2RIXA 2RITA 4Y9XA 5C47A 4KXOA 3I0DA 3I0LA 4D48A 4ZDQA 2MZBA 2QH5A 4ASYA 4FRHA 1IIMA 1H5RA 2GGOA 3N9WA 3V0MA 5L6SA 3QVBA 1HM9A 2X60A 3V90A 1ZJ3A 1FGXA 2BO4A 1JYKA 5FU8A 2V0IA 4Y64A 5FTSA 1VH1A 3SXCA 1JVGA 3F1YA 1ZI3A 2OEFA 2WVLA 2XMHA 2OI7A 2P6WA 2V0KA 1FO8A 3JTJA 2ZU7A 4Y7GA 3JUKA 3OH4A 2FY7A 2Y6PA 1I52A 1G9RA 5D92A 3POLA 4Q7CA 3I0GA 4O6MA 1JV1A 3V91A 3V0OA 3CKVA 2O1FA 2RJ1A 1VH3A 2JCLA 1HV9A 1R81A 2OEGA 2Y4LA 1ZI4A 1H4CA 5CMIA 5CMFX 4O6NA 1TZFA 3I0KA 4FCEA 1ON8A 3RMVA 5C38A 2VSIA 1IINA 3E25A 1XZ6A 1G2VA 2OI5A 1NMMB 3I0IX 5C3DA 1LL3A 1ZJOA 1HJJA 1H7FA 2YC5A 5C8RA 2BO8A 4CJ8A 2AE7A 2QKXA 3PKQA 2OI6A 1ZCUA 2YESA 1ZDFA 4M4KA 5I1FA 4KNRA 4E1KA 4FRQA 3OH1A 3DUVA 1OMXA 3IOHA 1NF5B 1ZIZA 1G3LA 2V0JA 4GBPA 2RJ9A 4UEGA 3Q80A 1MP3A 4HO9A 4G3QA 4P02A 4G3PA 4MIXA 3K8EA 1ZCTA 4KPZA 1K4VA 4DE7A 3DK5A 1WT1A 4M2AA 1MP4A 1VGZA 4MNDA 1EZIA 4Y7UA 1NKHB 4AYJA 1R7XA 2FFUA 1W77A 3FWWA 3V0PA 1H4EA 3R2WA 3V0QA 1O23B 4AAWA 3SPTA 1S4PA 1H7EA 3U2XA 1QGSA 1V83A 1JVDA 5CQNX 1V84A 3Q7UA 4M2BA 4Y6NA 1TVYA 3OAMA 1INJA 1PZTA 4FCUA 2D7RA 1WSZA 1V82A 5C4FA 4HG6A 4B3UA 1HM8A 2P73A 2XWMA 2YQHA 3NGWA 1XHBA 5CQPA 2YQCA 1FOAA 1VGTA 1S4OA 1FR8A 4EVWA 2DPWA 1GWWA 5EJ1A 1H5SC 1O7QA 1VICA 3OH0A 4XWIA 3U0XA 2YQSA 4KC4A 4HCQA 3ZF8A 4AYLA 5FU0A 4IRPA 3T7MA 2RJ8A 4B42A 1W57A 1H5SA 1PZYB 2RJ0A 1VGWA 1H7QA 5C1LA 1YP2A 4KQLA 1H5TB 1W55A 5C4BA 4CVHA 1JV3A 2V0HA 4KRVA 3SXGA 2WE9A 4KT7A 4JD0A 1LVWA 4HO8A 4HO6A 4MYBA 4B4BA 4EEAA 1G95A 1NHEB 2RJ6A 3CKNA 2I5KA 1ZDGA 5IFYA 2AM4A 4LW6A 1H5TA 1GX0A 3V0NA 2RIZA 5CQMX 3ZLKA 1TW1A 2YC3A 2BO6A 2Y4JA 2VK9A 5CQLX 5HS2A 2PX7A 4FRDA 1H3MA 1FZWA 3K8DA 2V0LA 5AJNA 2RJ5A 4DDZA 3V0LA 3E26A 2VSHA 3IOIA 4HO4A 1R7UA 3CGXA 4FRAA 1G93A 4NAIA 3SXDA 3SXBA 3OGZA 3TQDA 2RIYA 2VD4A 1WT3A 4M28A 4Y6UA 1FO9A 2E8BA 1WT2A 3O3PA 3I0CA 1R7YA 2AM5A 3BRKX 4R7PA 1GQCA 1YP3A 1LZJA 5EJZA 2P72A 3T7OA 1NWGB 4G3SA 3EE5A 1R80A 2CU2A 2X5ZA 4ASJA 4Y63A 5FTVA 2YQJA 1JYLA 1ZCYA 1MC3A 2NXVA 1GX4A 1H5SD 1VPAA 4B4GA 2AH9A 4FROA 2O1GA 5JQQA 1OMZA 2VS4A 1WT0A 4EEGA 1TW5A 2ICXA 3RMWA 5FV9A 4NALA 2GGQA 2AGDA 4FIXA 4P00A 3KIAA 1VGUA 2I5EA 2ICYA 3I0FA 1ZCVA 3ZGFA 3SX5A 1ZJPA 4EE5A 2WGZA 3V8ZA 2WVMA 2XWLA 2Y4KA 4CJCA 4EEMA 2WVKA 4AC3A 5AJPA 3JUJA 1KWSA 2AECA 4KC2A 3FOQA 4CJBA 3RSBA 1OQMB 1VZXA 3SX3A 3T7NA 5L6VA 3USRA 1YP4A 5J49A 1ZJ0A 5C1GA 1LZIA 1GQ9A 4BQHA 1ZJ1A 5C48A 4FRPA 3ZLLA 5FUHA 2Z86A 5FYEA 4KPXA 2QGIA 3U0YA 4FREA 3CKQA 3CKJA 3I0EA 1LL2A 2ZU8A 3I0JA 1O7OA 1E5KA 3CU0A 5EIYA 3PNNA 4EEOA 1G23A 1HJLA 2FYAA 1MP5A 2W0WA 4NANA 2J0BA 2X65A 2D7IA 3R3IA 2FFVA 3HL3A 1H7HA 1SS9A 5CMJA 1G1LA 3USQA 4FRMA 5D91A 1YROB 1VZTA 3SXAA 1ZJ2A 1G97A 4HO3A 3GUEA 1NQIB 3CKOA 5DDTA 4NAKA 3OC9A 5IDSA 4LW3A 2O1HA 3BCVA 1H7TA 2D0JA 4HO5A 4ARWA 2JCJA 5C36A 1O0RA 3TZTA 4JISA 1FGGA 4D11C 3U2VA 4FIYA 3D5NA 3SXEA 1ZI5A 4K6RA 2UX8A 4KC1A 2VFZA 4EE3A 2J0AA 3V8YA 1H7GA 4C2SA 2APCA 5CMHA 1FRWA 2FYBA 5AJOA 2VXMA 4D11A 3F1CA 3Q4SA 2AESA 4B2WA 3I0HA 1S4NA 4KNXA 1FXJA 4J18A 2ZU9A 4HO0A 1QWJA 2YCMA 5IDTA 2Y7AA 4B2XA 4FQWA 2PGVA 1R7TA 4EE4A 5C3AA 1R7VA 3U2TA 1FXOA 5C4CA 1QGQA 1QG8A 2Q4JA 1GWVA 3D8VA 4IRQA 4B5BA 5CMGX 4HOCA 5BXCA 1H4DA 5C4EA 1VM8A 2RJ4A 2VXLA 4L41C 2PA4A 4G87A 2X5SA 1FR9A 1GA8A 1R82A 1EYRA 2A8WA 2JCKA 1LZ7A 3ZGGA 2JCOA 1H7LA 4Y7FA 2WAWA 2BO7A 1WVCA 1VZUA 4D0TA 2Z87A 5C3BA 1ON6A 3OKRA 5C49A 1FG5N 4FRLA 4FRBA 1INIA 4BMAA 1ZI1A 2A8UA 1FWYA 1LZ0A 3LW6A 4HO2A 5CQOA 5C4DA 2FYCB 2XWNA 1HM0A 3ST8A 2C0NA 4Y7VA 4B4MA 4Y62A 3OH3A 3SX8A 2XMEA 1G0RA 1G8OA 2FYDB 2RJ7A 2W0VA 3PKPA 3SX7A 1ZHJA 3DJ4A 4ECMA 4YS8A 5DDVA 2Y4MA 2PGYA 2VS5A 2VS3A 3IOJA 3U2UA 1LL0A 1H5RB 3U2WA 4D0ZA 2WEEA 3OH2A 4DECA 5C1HA 2I7BA 4Y7TA 3D98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0N A; 
#chains in the Genus database with same CATH topology
 2AM3 A;  2E3D A;  1Z90 A;  1H5S B;  2RIX A;  2RIT A;  4Y9X A;  5C47 A;  4KXO A;  3I0D A;  3I0L A;  4D48 A;  4ZDQ A;  2MZB A;  2QH5 A;  4ASY A;  4FRH A;  1IIM A;  1H5R A;  2GGO A;  3N9W A;  3V0M A;  5L6S A;  3QVB A;  1HM9 A;  2X60 A;  3V90 A;  1ZJ3 A;  1FGX A;  2BO4 A;  1JYK A;  5FU8 A;  2V0I A;  4Y64 A;  5FTS A;  1VH1 A;  3SXC A;  1JVG A;  3F1Y A;  1ZI3 A;  2OEF A;  2WVL A;  2XMH A;  2OI7 A;  2P6W A;  2V0K A;  1FO8 A;  3JTJ A;  2ZU7 A;  4Y7G A;  3JUK A;  3OH4 A;  2FY7 A;  2Y6P A;  1I52 A;  1G9R A;  5D92 A;  3POL A;  4Q7C A;  3I0G A;  4O6M A;  1JV1 A;  3V91 A;  3V0O A;  3CKV A;  2O1F A;  2RJ1 A;  1VH3 A;  2JCL A;  1HV9 A;  1R81 A;  2OEG A;  2Y4L A;  1ZI4 A;  1H4C A;  5CMI A;  5CMF X;  4O6N A;  1TZF A;  3I0K A;  4FCE A;  1ON8 A;  3RMV A;  5C38 A;  2VSI A;  1IIN A;  3E25 A;  1XZ6 A;  1G2V A;  2OI5 A;  1NMM B;  3I0I X;  5C3D A;  1LL3 A;  1ZJO A;  1HJJ A;  1H7F A;  2YC5 A;  5C8R A;  2BO8 A;  4CJ8 A;  2AE7 A;  2QKX A;  3PKQ A;  2OI6 A;  1ZCU A;  2YES A;  1ZDF A;  4M4K A;  5I1F A;  4KNR A;  4E1K A;  4FRQ A;  3OH1 A;  3DUV A;  1OMX A;  3IOH A;  1NF5 B;  1ZIZ A;  1G3L A;  2V0J A;  4GBP A;  2RJ9 A;  4UEG A;  3Q80 A;  1MP3 A;  4HO9 A;  4G3Q A;  4P02 A;  4G3P A;  4MIX A;  3K8E A;  1ZCT A;  4KPZ A;  1K4V A;  4DE7 A;  3DK5 A;  1WT1 A;  4M2A A;  1MP4 A;  1VGZ A;  4MND A;  1EZI A;  4Y7U A;  1NKH B;  4AYJ A;  1R7X A;  2FFU A;  1W77 A;  3FWW A;  3V0P A;  1H4E A;  3R2W A;  3V0Q A;  1O23 B;  4AAW A;  3SPT A;  1S4P A;  1H7E A;  3U2X A;  1QGS A;  1V83 A;  1JVD A;  5CQN X;  1V84 A;  3Q7U A;  4M2B A;  4Y6N A;  1TVY A;  3OAM A;  1INJ A;  1PZT A;  4FCU A;  2D7R A;  1WSZ A;  1V82 A;  5C4F A;  4HG6 A;  4B3U A;  1HM8 A;  2P73 A;  2XWM A;  2YQH A;  3NGW A;  1XHB A;  5CQP A;  2YQC A;  1FOA A;  1VGT A;  1S4O A;  1FR8 A;  4EVW A;  2DPW A;  1GWW A;  5EJ1 A;  1H5S C;  1O7Q A;  1VIC A;  3OH0 A;  4XWI A;  3U0X A;  2YQS A;  4KC4 A;  4HCQ A;  3ZF8 A;  4AYL A;  5FU0 A;  4IRP A;  3T7M A;  2RJ8 A;  4B42 A;  1W57 A;  1H5S A;  1PZY B;  2RJ0 A;  1VGW A;  1H7Q A;  5C1L A;  1YP2 A;  4KQL A;  1H5T B;  1W55 A;  5C4B A;  4CVH A;  1JV3 A;  2V0H A;  4KRV A;  3SXG A;  2WE9 A;  4KT7 A;  4JD0 A;  1LVW A;  4HO8 A;  4HO6 A;  4MYB A;  4B4B A;  4EEA A;  1G95 A;  1NHE B;  2RJ6 A;  3CKN A;  2I5K A;  1ZDG A;  5IFY A;  2AM4 A;  4LW6 A;  1H5T A;  1GX0 A;  3V0N A;  2RIZ A;  5CQM X;  3ZLK A;  1TW1 A;  2YC3 A;  2BO6 A;  2Y4J A;  2VK9 A;  5CQL X;  5HS2 A;  2PX7 A;  4FRD A;  1H3M A;  1FZW A;  3K8D A;  2V0L A;  5AJN A;  2RJ5 A;  4DDZ A;  3V0L A;  3E26 A;  2VSH A;  3IOI A;  4HO4 A;  1R7U A;  3CGX A;  4FRA A;  1G93 A;  4NAI A;  3SXD A;  3SXB A;  3OGZ A;  3TQD A;  2RIY A;  2VD4 A;  1WT3 A;  4M28 A;  4Y6U A;  1FO9 A;  2E8B A;  1WT2 A;  3O3P A;  3I0C A;  1R7Y A;  2AM5 A;  3BRK X;  4R7P A;  1GQC A;  1YP3 A;  1LZJ A;  5EJZ A;  2P72 A;  3T7O A;  1NWG B;  4G3S A;  3EE5 A;  1R80 A;  2CU2 A;  2X5Z A;  4ASJ A;  4Y63 A;  5FTV A;  2YQJ A;  1JYL A;  1ZCY A;  1MC3 A;  2NXV A;  1GX4 A;  1H5S D;  1VPA A;  4B4G A;  2AH9 A;  4FRO A;  2O1G A;  5JQQ A;  1OMZ A;  2VS4 A;  1WT0 A;  4EEG A;  1TW5 A;  2ICX A;  3RMW A;  5FV9 A;  4NAL A;  2GGQ A;  2AGD A;  4FIX A;  4P00 A;  3KIA A;  1VGU A;  2I5E A;  2ICY A;  3I0F A;  1ZCV A;  3ZGF A;  3SX5 A;  1ZJP A;  4EE5 A;  2WGZ A;  3V8Z A;  2WVM A;  2XWL A;  2Y4K A;  4CJC A;  4EEM A;  2WVK A;  4AC3 A;  5AJP A;  3JUJ A;  1KWS A;  2AEC A;  4KC2 A;  3FOQ A;  4CJB A;  3RSB A;  1OQM B;  1VZX A;  3SX3 A;  3T7N A;  5L6V A;  3USR A;  1YP4 A;  5J49 A;  1ZJ0 A;  5C1G A;  1LZI A;  1GQ9 A;  4BQH A;  1ZJ1 A;  5C48 A;  4FRP A;  3ZLL A;  5FUH A;  2Z86 A;  5FYE A;  4KPX A;  2QGI A;  3U0Y A;  4FRE A;  3CKQ A;  3CKJ A;  3I0E A;  1LL2 A;  2ZU8 A;  3I0J A;  1O7O A;  1E5K A;  3CU0 A;  5EIY A;  3PNN A;  4EEO A;  1G23 A;  1HJL A;  2FYA A;  1MP5 A;  2W0W A;  4NAN A;  2J0B A;  2X65 A;  2D7I A;  3R3I A;  2FFV A;  3HL3 A;  1H7H A;  1SS9 A;  5CMJ A;  1G1L A;  3USQ A;  4FRM A;  5D91 A;  1YRO B;  1VZT A;  3SXA A;  1ZJ2 A;  1G97 A;  4HO3 A;  3GUE A;  1NQI B;  3CKO A;  5DDT A;  4NAK A;  3OC9 A;  5IDS A;  4LW3 A;  2O1H A;  3BCV A;  1H7T A;  2D0J A;  4HO5 A;  4ARW A;  2JCJ A;  5C36 A;  1O0R A;  3TZT A;  4JIS A;  1FGG A;  4D11 C;  3U2V A;  4FIY A;  3D5N A;  3SXE A;  1ZI5 A;  4K6R A;  2UX8 A;  4KC1 A;  2VFZ A;  4EE3 A;  2J0A A;  3V8Y A;  1H7G A;  4C2S A;  2APC A;  5CMH A;  1FRW A;  2FYB A;  5AJO A;  2VXM A;  4D11 A;  3F1C A;  3Q4S A;  2AES A;  4B2W A;  3I0H A;  1S4N A;  4KNX A;  1FXJ A;  4J18 A;  2ZU9 A;  4HO0 A;  1QWJ A;  2YCM A;  5IDT A;  2Y7A A;  4B2X A;  4FQW A;  2PGV A;  1R7T A;  4EE4 A;  5C3A A;  1R7V A;  3U2T A;  1FXO A;  5C4C A;  1QGQ A;  1QG8 A;  2Q4J A;  1GWV A;  3D8V A;  4IRQ A;  4B5B A;  5CMG X;  4HOC A;  5BXC A;  1H4D A;  5C4E A;  1VM8 A;  2RJ4 A;  2VXL A;  4L41 C;  2PA4 A;  4G87 A;  2X5S A;  1FR9 A;  1GA8 A;  1R82 A;  1EYR A;  2A8W A;  2JCK A;  1LZ7 A;  3ZGG A;  2JCO A;  1H7L A;  4Y7F A;  2WAW A;  2BO7 A;  1WVC A;  1VZU A;  4D0T A;  2Z87 A;  5C3B A;  1ON6 A;  3OKR A;  5C49 A;  1FG5 N;  4FRL A;  4FRB A;  1INI A;  4BMA A;  1ZI1 A;  2A8U A;  1FWY A;  1LZ0 A;  3LW6 A;  4HO2 A;  5CQO A;  5C4D A;  2FYC B;  2XWN A;  1HM0 A;  3ST8 A;  2C0N A;  4Y7V A;  4B4M A;  4Y62 A;  3OH3 A;  3SX8 A;  2XME A;  1G0R A;  1G8O A;  2FYD B;  2RJ7 A;  2W0V A;  3PKP A;  3SX7 A;  1ZHJ A;  3DJ4 A;  4ECM A;  4YS8 A;  5DDV A;  2Y4M A;  2PGY A;  2VS5 A;  2VS3 A;  3IOJ A;  3U2U A;  1LL0 A;  1H5R B;  3U2W A;  4D0Z A;  2WEE A;  3OH2 A;  4DEC A;  5C1H A;  2I7B A;  4Y7T A;  3D98 A; 
#chains in the Genus database with same CATH homology
 2AM3 A;  2E3D A;  1Z90 A;  1H5S B;  2RIX A;  2RIT A;  4Y9X A;  5C47 A;  4KXO A;  3I0D A;  3I0L A;  4D48 A;  4ZDQ A;  2MZB A;  2QH5 A;  4ASY A;  4FRH A;  1IIM A;  1H5R A;  2GGO A;  3N9W A;  3V0M A;  5L6S A;  3QVB A;  1HM9 A;  2X60 A;  3V90 A;  1ZJ3 A;  1FGX A;  2BO4 A;  1JYK A;  5FU8 A;  2V0I A;  4Y64 A;  5FTS A;  1VH1 A;  3SXC A;  1JVG A;  3F1Y A;  1ZI3 A;  2OEF A;  2WVL A;  2XMH A;  2OI7 A;  2P6W A;  2V0K A;  1FO8 A;  3JTJ A;  2ZU7 A;  4Y7G A;  3JUK A;  3OH4 A;  2FY7 A;  2Y6P A;  1I52 A;  1G9R A;  5D92 A;  3POL A;  4Q7C A;  3I0G A;  4O6M A;  1JV1 A;  3V91 A;  3V0O A;  3CKV A;  2O1F A;  2RJ1 A;  1VH3 A;  2JCL A;  1HV9 A;  1R81 A;  2OEG A;  2Y4L A;  1ZI4 A;  1H4C A;  5CMI A;  5CMF X;  4O6N A;  1TZF A;  3I0K A;  4FCE A;  1ON8 A;  3RMV A;  5C38 A;  2VSI A;  1IIN A;  3E25 A;  1XZ6 A;  1G2V A;  2OI5 A;  1NMM B;  3I0I X;  5C3D A;  1LL3 A;  1ZJO A;  1HJJ A;  1H7F A;  2YC5 A;  5C8R A;  2BO8 A;  4CJ8 A;  2AE7 A;  2QKX A;  3PKQ A;  2OI6 A;  1ZCU A;  2YES A;  1ZDF A;  4M4K A;  5I1F A;  4KNR A;  4E1K A;  4FRQ A;  3OH1 A;  3DUV A;  1OMX A;  3IOH A;  1NF5 B;  1ZIZ A;  1G3L A;  2V0J A;  4GBP A;  2RJ9 A;  4UEG A;  3Q80 A;  1MP3 A;  4HO9 A;  4G3Q A;  4P02 A;  4G3P A;  4MIX A;  3K8E A;  1ZCT A;  4KPZ A;  1K4V A;  4DE7 A;  3DK5 A;  1WT1 A;  4M2A A;  1MP4 A;  1VGZ A;  4MND A;  1EZI A;  4Y7U A;  1NKH B;  4AYJ A;  1R7X A;  2FFU A;  1W77 A;  3FWW A;  3V0P A;  1H4E A;  3R2W A;  3V0Q A;  1O23 B;  4AAW A;  3SPT A;  1S4P A;  1H7E A;  3U2X A;  1QGS A;  1V83 A;  1JVD A;  5CQN X;  1V84 A;  3Q7U A;  4M2B A;  4Y6N A;  1TVY A;  3OAM A;  1INJ A;  1PZT A;  4FCU A;  2D7R A;  1WSZ A;  1V82 A;  5C4F A;  4HG6 A;  4B3U A;  1HM8 A;  2P73 A;  2XWM A;  2YQH A;  3NGW A;  1XHB A;  5CQP A;  2YQC A;  1FOA A;  1VGT A;  1S4O A;  1FR8 A;  4EVW A;  2DPW A;  1GWW A;  5EJ1 A;  1H5S C;  1O7Q A;  1VIC A;  3OH0 A;  4XWI A;  3U0X A;  2YQS A;  4KC4 A;  4HCQ A;  3ZF8 A;  4AYL A;  5FU0 A;  4IRP A;  3T7M A;  2RJ8 A;  4B42 A;  1W57 A;  1H5S A;  1PZY B;  2RJ0 A;  1VGW A;  1H7Q A;  5C1L A;  1YP2 A;  4KQL A;  1H5T B;  1W55 A;  5C4B A;  4CVH A;  1JV3 A;  2V0H A;  4KRV A;  3SXG A;  2WE9 A;  4KT7 A;  4JD0 A;  1LVW A;  4HO8 A;  4HO6 A;  4MYB A;  4B4B A;  4EEA A;  1G95 A;  1NHE B;  2RJ6 A;  3CKN A;  2I5K A;  1ZDG A;  5IFY A;  2AM4 A;  4LW6 A;  1H5T A;  1GX0 A;  3V0N A;  2RIZ A;  5CQM X;  3ZLK A;  1TW1 A;  2YC3 A;  2BO6 A;  2Y4J A;  2VK9 A;  5CQL X;  5HS2 A;  2PX7 A;  4FRD A;  1H3M A;  1FZW A;  3K8D A;  2V0L A;  5AJN A;  2RJ5 A;  4DDZ A;  3V0L A;  3E26 A;  2VSH A;  3IOI A;  4HO4 A;  1R7U A;  3CGX A;  4FRA A;  1G93 A;  4NAI A;  3SXD A;  3SXB A;  3OGZ A;  3TQD A;  2RIY A;  2VD4 A;  1WT3 A;  4M28 A;  4Y6U A;  1FO9 A;  2E8B A;  1WT2 A;  3O3P A;  3I0C A;  1R7Y A;  2AM5 A;  3BRK X;  4R7P A;  1GQC A;  1YP3 A;  1LZJ A;  5EJZ A;  2P72 A;  3T7O A;  1NWG B;  4G3S A;  3EE5 A;  1R80 A;  2CU2 A;  2X5Z A;  4ASJ A;  4Y63 A;  5FTV A;  2YQJ A;  1JYL A;  1ZCY A;  1MC3 A;  2NXV A;  1GX4 A;  1H5S D;  1VPA A;  4B4G A;  2AH9 A;  4FRO A;  2O1G A;  5JQQ A;  1OMZ A;  2VS4 A;  1WT0 A;  4EEG A;  1TW5 A;  2ICX A;  3RMW A;  5FV9 A;  4NAL A;  2GGQ A;  2AGD A;  4FIX A;  4P00 A;  3KIA A;  1VGU A;  2I5E A;  2ICY A;  3I0F A;  1ZCV A;  3ZGF A;  3SX5 A;  1ZJP A;  4EE5 A;  2WGZ A;  3V8Z A;  2WVM A;  2XWL A;  2Y4K A;  4CJC A;  4EEM A;  2WVK A;  4AC3 A;  5AJP A;  3JUJ A;  1KWS A;  2AEC A;  4KC2 A;  3FOQ A;  4CJB A;  3RSB A;  1OQM B;  1VZX A;  3SX3 A;  3T7N A;  5L6V A;  3USR A;  1YP4 A;  5J49 A;  1ZJ0 A;  5C1G A;  1LZI A;  1GQ9 A;  4BQH A;  1ZJ1 A;  5C48 A;  4FRP A;  3ZLL A;  5FUH A;  2Z86 A;  5FYE A;  4KPX A;  2QGI A;  3U0Y A;  4FRE A;  3CKQ A;  3CKJ A;  3I0E A;  1LL2 A;  2ZU8 A;  3I0J A;  1O7O A;  1E5K A;  3CU0 A;  5EIY A;  3PNN A;  4EEO A;  1G23 A;  1HJL A;  2FYA A;  1MP5 A;  2W0W A;  4NAN A;  2J0B A;  2X65 A;  2D7I A;  3R3I A;  2FFV A;  3HL3 A;  1H7H A;  1SS9 A;  5CMJ A;  1G1L A;  3USQ A;  4FRM A;  5D91 A;  1YRO B;  1VZT A;  3SXA A;  1ZJ2 A;  1G97 A;  4HO3 A;  3GUE A;  1NQI B;  3CKO A;  5DDT A;  4NAK A;  3OC9 A;  5IDS A;  4LW3 A;  2O1H A;  3BCV A;  1H7T A;  2D0J A;  4HO5 A;  4ARW A;  2JCJ A;  5C36 A;  1O0R A;  3TZT A;  4JIS A;  1FGG A;  4D11 C;  3U2V A;  4FIY A;  3D5N A;  3SXE A;  1ZI5 A;  4K6R A;  2UX8 A;  4KC1 A;  2VFZ A;  4EE3 A;  2J0A A;  3V8Y A;  1H7G A;  4C2S A;  2APC A;  5CMH A;  1FRW A;  2FYB A;  5AJO A;  2VXM A;  4D11 A;  3F1C A;  3Q4S A;  2AES A;  4B2W A;  3I0H A;  1S4N A;  4KNX A;  1FXJ A;  4J18 A;  2ZU9 A;  4HO0 A;  1QWJ A;  2YCM A;  5IDT A;  2Y7A A;  4B2X A;  4FQW A;  2PGV A;  1R7T A;  4EE4 A;  5C3A A;  1R7V A;  3U2T A;  1FXO A;  5C4C A;  1QGQ A;  1QG8 A;  2Q4J A;  1GWV A;  3D8V A;  4IRQ A;  4B5B A;  5CMG X;  4HOC A;  5BXC A;  1H4D A;  5C4E A;  1VM8 A;  2RJ4 A;  2VXL A;  4L41 C;  2PA4 A;  4G87 A;  2X5S A;  1FR9 A;  1GA8 A;  1R82 A;  1EYR A;  2A8W A;  2JCK A;  1LZ7 A;  3ZGG A;  2JCO A;  1H7L A;  4Y7F A;  2WAW A;  2BO7 A;  1WVC A;  1VZU A;  4D0T A;  2Z87 A;  5C3B A;  1ON6 A;  3OKR A;  5C49 A;  1FG5 N;  4FRL A;  4FRB A;  1INI A;  4BMA A;  1ZI1 A;  2A8U A;  1FWY A;  1LZ0 A;  3LW6 A;  4HO2 A;  5CQO A;  5C4D A;  2FYC B;  2XWN A;  1HM0 A;  3ST8 A;  2C0N A;  4Y7V A;  4B4M A;  4Y62 A;  3OH3 A;  3SX8 A;  2XME A;  1G0R A;  1G8O A;  2FYD B;  2RJ7 A;  2W0V A;  3PKP A;  3SX7 A;  1ZHJ A;  3DJ4 A;  4ECM A;  4YS8 A;  5DDV A;  2Y4M A;  2PGY A;  2VS5 A;  2VS3 A;  3IOJ A;  3U2U A;  1LL0 A;  1H5R B;  3U2W A;  4D0Z A;  2WEE A;  3OH2 A;  4DEC A;  5C1H A;  2I7B A;  4Y7T A;  3D98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...