1R7YA

Glycosyltransferase a in complex with 3-amino-acceptor analog inhibitor and uridine diphosphate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
264
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 264
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7yA00
1ZJ0A 2D0JA 1H4EA 4G3PA 2WAWA 1ZIZA 2RJ1A 2AM3A 3E26A 4L41C 2APCA 5C49A 4B4GA 3V0QA 1JV3A 5AJOA 5IDTA 1HM8A 2OI6A 3OC9A 4Y7TA 1QG8A 4MNDA 3RMWA 3U2UA 4M28A 4HOCA 3U0XA 4EEMA 5IFYA 4MYBA 2RJ8A 5J49A 3BRKX 3E25A 4XWIA 2GGOA 1TZFA 1VGTA 2ZU8A 4ARWA 1FG5N 1H5RA 3I0EA 5C3DA 3RSBA 2Y4JA 2W0WA 1H7GA 2JCOA 2WEEA 4KQLA 5CMFX 2PA4A 4FRPA 3SX3A 5FYEA 2V0KA 2D7IA 5I1FA 4DDZA 2JCKA 3JUKA 3T7NA 3V91A 3I0KA 4FRDA 1TVYA 5AJNA 4FRMA 2AE7A 5CQOA 1ZI1A 2QKXA 2ICYA 4CVHA 2GGQA 5CMIA 2Y4KA 4D11C 3F1YA 1INJA 1S4PA 4HO3A 3SXDA 1TW1A 1ZJ2A 4ZDQA 2O1HA 1H5SB 1FWYA 2VSHA 2V0IA 5C4FA 4Y7FA 3CKVA 3SX5A 1WSZA 5FTVA 2BO4A 2OI7A 3N9WA 2Y4MA 4KC4A 1VH1A 3HL3A 1ZDFA 1O0RA 1O7QA 2O1FA 4LW3A 1EZIA 1HV9A 3I0CA 5BXCA 3I0FA 3DJ4A 2AESA 1H7HA 5C36A 1GA8A 2I7BA 4HO6A 1R80A 4KXOA 1H5SA 1H4DA 2I5EA 4D0TA 1HJJA 2XWLA 1VGZA 5DDVA 2XWMA 2FFUA 1YROB 1PZTA 3IOJA 1ZJPA 1XZ6A 3V0MA 4B2WA 3T7OA 3ZF8A 1QGQA 1VPAA 1FO8A 4KRVA 4JISA 2Q4JA 1VICA 3JTJA 2FYBA 1ZJOA 1G23A 1MP4A 3D8VA 1H7TA 1VH3A 3ST8A 2PX7A 1JYLA 3TZTA 2Z86A 1R7VA 4Y64A 1GWVA 1ZCYA 2VXLA 5C4EA 2WVLA 4M4KA 3U2TA 1VGUA 4C2SA 4DE7A 3QVBA 4KPXA 3I0LA 3CKQA 5CMHA 1R7XA 5HS2A 1LZ0A 3PKPA 2Y7AA 4LW6A 1ZI5A 2RIZA 2YC5A 4IRQA 1GX0A 4BQHA 4HG6A 1G1LA 1GX4A 1MP5A 4DECA 4IRPA 5FUHA 3V8ZA 2RJ9A 2W0VA 5C4BA 1ZI4A 3SXGA 3OH4A 4HO2A 2RJ6A 2O1GA 1VZUA 1R82A 1R7TA 4D11A 4G3SA 3I0GA 4R7PA 4UEGA 3OKRA 1GQ9A 3OGZA 3D98A 1H3MA 1INIA 4M2BA 2P73A 2JCJA 4KT7A 3SX8A 5EIYA 2D7RA 5CQLX 2FYAA 1KWSA 2E8BA 5EJZA 2YQSA 1YP2A 1YP4A 4AYLA 2A8UA 4G87A 1LL2A 4Y9XA 1NQIB 4AAWA 1S4OA 1W57A 1ZHJA 2YQCA 3KIAA 2XWNA 2RJ4A 1H5SD 3V0PA 1S4NA 2V0HA 2RIYA 2VS5A 2YESA 2YCMA 4Y7VA 5L6VA 3SX7A 3ZLLA 2WE9A 1IINA 4B5BA 3V0OA 3PKQA 4HO5A 1NKHB 4FCEA 4FROA 3I0IX 4HCQA 2UX8A 1FR8A 2FYCB 3FOQA 2AM5A 2YQHA 1Z90A 3U2XA 3I0HA 3R3IA 1QWJA 1ON6A 4KNXA 3DK5A 2ZU7A 1ZCVA 1GWWA 3SPTA 3Q4SA 3D5NA 3IOIA 2RIXA 1MC3A 2QH5A 2XMEA 1LZIA 1ZCTA 3GUEA 3U0YA 1G9RA 1G3LA 1OMXA 5C48A 2OI5A 5C1HA 4YS8A 1TW5A 2VD4A 3ZGGA 2Y4LA 3OH0A 3CGXA 2VS4A 3EE5A 3OH2A 3POLA 1JV1A 5C4DA 1V83A 2NXVA 2V0JA 2X65A 5C3AA 2P6WA 2BO7A 5CMJA 1G2VA 1ZI3A 3SXCA 3ZLKA 2ICXA 1NF5B 1JVDA 1FXOA 5FTSA 4B4MA 1WVCA 1W55A 4AC3A 4B3UA 5C1LA 1FOAA 1G93A 5C4CA 1JYKA 4FRLA 4Y6UA 4KC1A 2X5SA 1IIMA 4Y7GA 5FV9A 4FRAA 1ZDGA 1XHBA 2BO6A 4D0ZA 4EE5A 3ZGFA 1OQMB 1JVGA 1H7LA 2FYDB 1LL0A 1V84A 2WGZA 5CMGX 4EVWA 5EJ1A 4CJ8A 2PGVA 1G97A 1R81A 3I0DA 1FGXA 5C38A 1HJLA 1VZXA 3RMVA 5FU8A 4EE4A 4ECMA 1H5RB 2WVMA 5DDTA 2CU2A 3OH3A 4D48A 4KC2A 3CKNA 3OAMA 4FRBA 4Y62A 1NWGB 2VS3A 4NALA 2A8WA 3FWWA 2YQJA 3I0JA 4EEOA 3O3PA 1NHEB 2VSIA 3USQA 3JUJA 3PNNA 2QGIA 3T7MA 1NMMB 1SS9A 5CQPA 4B42A 5CQNX 1E5KA 5FU0A 3K8DA 4FQWA 4KNRA 1H4CA 3SXBA 3Q80A 5L6SA 1LZ7A 1OMZA 3CKOA 4Y7UA 2YC3A 1VZTA 1HM0A 3U2VA 2OEGA 1H7EA 2VXMA 4CJCA 1FXJA 3V0LA 4KPZA 4FRHA 1G8OA 2AM4A 1PZYB 1G0RA 1W77A 1ZJ1A 4G3QA 3CU0A 1V82A 3V8YA 3TQDA 4Y6NA 1ON8A 1WT0A 2Z87A 4EEGA 5C1GA 2JCLA 4J18A 2X60A 4P00A 1O23B 1LVWA 3R2WA 4Y63A 4ASYA 4HO8A 2RITA 2X5ZA 2VFZA 3OH1A 1R7YA 2PGYA 1WT3A 3V0NA 1LL3A 2Y6PA 1VGWA 1ZJ3A 4GBPA 1FZWA 2BO8A 3LW6A 3F1CA 1GQCA 4B2XA 1R7UA 4K6RA 4FREA 1WT1A 2FY7A 3U2WA 2MZBA 5C8RA 1FO9A 1EYRA 1H7FA 2WVKA 1K4VA 2RJ0A 2FFVA 4M2AA 3SXEA 4EE3A 4HO0A 2AH9A 2V0LA 4NAKA 3USRA 2I5KA 1H5TB 2RJ7A 3DUVA 1I52A 1O7OA 4EEAA 5C3BA 1HM9A 2DPWA 4CJBA 5IDSA 1LZJA 2XMHA 1H7QA 4E1KA 2RJ5A 3SXAA 1ZCUA 1QGSA 4P02A 4NAIA 4BMAA 4NANA 4JD0A 3V90A 2ZU9A 1FGGA 3CKJA 2P72A 1H5SC 5JQQA 3K8EA 4HO9A 4FCUA 3IOHA 4B4BA 3NGWA 1FRWA 1FR9A 1MP3A 5C47A 4AYJA 1G95A 1YP3A 2AGDA 4FRQA 2E3DA 4ASJA 1H5TA 2AECA 1VM8A 4HO4A 3BCVA 2OEFA 3Q7UA 1WT2A 5AJPA 5CQMX
chains in the Genus database with same CATH superfamily
1ZJ0A 2D0JA 1H4EA 4G3PA 2WAWA 1ZIZA 2RJ1A 2AM3A 3E26A 4L41C 2APCA 5C49A 2J0BA 3V0QA 4B4GA 1JV3A 5AJOA 5IDTA 1HM8A 2OI6A 3OC9A 4Y7TA 1QG8A 4MNDA 3RMWA 3U2UA 4M28A 4HOCA 3U0XA 4EEMA 5IFYA 4MYBA 2RJ8A 5J49A 3BRKX 3E25A 4XWIA 2GGOA 1TZFA 1VGTA 2VK9A 2ZU8A 4ARWA 1FG5N 1H5RA 3I0EA 4Q7CA 5C3DA 3RSBA 2Y4JA 2W0WA 1H7GA 2JCOA 2WEEA 4KQLA 5CMFX 2PA4A 4FRPA 3SX3A 5FYEA 2V0KA 2D7IA 5I1FA 4DDZA 2JCKA 3JUKA 3T7NA 3V91A 3I0KA 4FRDA 1TVYA 5AJNA 4FRMA 2AE7A 5CQOA 1ZI1A 2QKXA 2ICYA 4CVHA 2GGQA 5CMIA 2Y4KA 4D11C 3F1YA 1INJA 1S4PA 4HO3A 3SXDA 1TW1A 1ZJ2A 4ZDQA 2O1HA 5D91A 1H5SB 1FWYA 2VSHA 2V0IA 5C4FA 4Y7FA 3CKVA 3SX5A 1WSZA 5FTVA 2BO4A 2OI7A 3N9WA 2Y4MA 4KC4A 1VH1A 3HL3A 1ZDFA 1O0RA 1O7QA 2O1FA 4LW3A 1EZIA 1HV9A 3I0CA 5BXCA 3I0FA 3DJ4A 2AESA 1H7HA 5C36A 1GA8A 2I7BA 4HO6A 1R80A 4KXOA 1H5SA 1H4DA 2I5EA 4D0TA 1HJJA 2XWLA 1VGZA 5DDVA 2XWMA 2FFUA 1YROB 1PZTA 3IOJA 1ZJPA 1XZ6A 3V0MA 4B2WA 3T7OA 3ZF8A 1QGQA 1VPAA 1FO8A 4KRVA 4JISA 2Q4JA 1VICA 3JTJA 2FYBA 1ZJOA 1G23A 1MP4A 3D8VA 1H7TA 1VH3A 3ST8A 2PX7A 1JYLA 3TZTA 2Z86A 1R7VA 4Y64A 1GWVA 1ZCYA 2VXLA 5C4EA 2WVLA 4M4KA 3U2TA 1VGUA 4C2SA 4DE7A 3QVBA 4KPXA 3I0LA 4FIYA 3CKQA 5CMHA 1R7XA 5HS2A 1LZ0A 3PKPA 2Y7AA 4LW6A 1ZI5A 2RIZA 2YC5A 4IRQA 1GX0A 4BQHA 4HG6A 1G1LA 1GX4A 1MP5A 4DECA 4IRPA 5FUHA 3V8ZA 2RJ9A 2W0VA 5C4BA 1ZI4A 3SXGA 3OH4A 4HO2A 2RJ6A 2O1GA 1VZUA 1R82A 1R7TA 4D11A 4G3SA 3I0GA 4R7PA 4UEGA 3OKRA 1GQ9A 3OGZA 3D98A 1H3MA 1INIA 4M2BA 2P73A 2JCJA 4KT7A 3SX8A 5EIYA 2D7RA 5CQLX 2FYAA 1KWSA 2E8BA 5EJZA 2YQSA 1YP2A 1YP4A 4O6MA 4AYLA 2A8UA 4G87A 1LL2A 4Y9XA 1NQIB 4AAWA 4FIXA 1S4OA 1W57A 1ZHJA 2YQCA 3KIAA 2XWNA 2RJ4A 1H5SD 3V0PA 1S4NA 2V0HA 2RIYA 2VS5A 2YESA 2YCMA 4Y7VA 5L6VA 3SX7A 3ZLLA 2WE9A 1IINA 4B5BA 3V0OA 3PKQA 4HO5A 1NKHB 4FCEA 4FROA 3I0IX 4HCQA 2UX8A 1FR8A 2FYCB 3FOQA 2AM5A 2YQHA 1Z90A 3U2XA 3I0HA 3R3IA 1QWJA 1ON6A 4KNXA 3DK5A 2ZU7A 1ZCVA 1GWWA 3SPTA 3Q4SA 3D5NA 3IOIA 2RIXA 1MC3A 2QH5A 2XMEA 2J0AA 1LZIA 1ZCTA 3GUEA 3U0YA 1G9RA 1G3LA 1OMXA 5C48A 2OI5A 5C1HA 4YS8A 1TW5A 2VD4A 3ZGGA 2Y4LA 3OH0A 3CGXA 2VS4A 3EE5A 3OH2A 3POLA 1JV1A 5C4DA 1V83A 2NXVA 2V0JA 2X65A 5C3AA 2P6WA 2BO7A 5CMJA 1G2VA 1ZI3A 3SXCA 3ZLKA 2ICXA 1NF5B 1JVDA 1FXOA 5FTSA 4B4MA 1WVCA 1W55A 4AC3A 4B3UA 5C1LA 1FOAA 1G93A 5C4CA 1JYKA 4FRLA 4Y6UA 4KC1A 2X5SA 1IIMA 4Y7GA 5FV9A 4FRAA 1ZDGA 1XHBA 2BO6A 4D0ZA 4EE5A 3ZGFA 1OQMB 1JVGA 1H7LA 2FYDB 1LL0A 1V84A 2WGZA 5CMGX 4EVWA 5EJ1A 4CJ8A 2PGVA 1G97A 1R81A 3I0DA 1FGXA 5C38A 1HJLA 1VZXA 3RMVA 5FU8A 4EE4A 4ECMA 1H5RB 2WVMA 5DDTA 2CU2A 3OH3A 4D48A 4KC2A 3CKNA 3OAMA 4FRBA 4Y62A 1NWGB 2VS3A 4NALA 2A8WA 3FWWA 2YQJA 3I0JA 4EEOA 3O3PA 1NHEB 2VSIA 3USQA 2C0NA 3JUJA 3PNNA 2QGIA 3T7MA 1NMMB 1SS9A 5CQPA 4B42A 5CQNX 1E5KA 5FU0A 3K8DA 4FQWA 4KNRA 1H4CA 3SXBA 3Q80A 5L6SA 1LZ7A 1OMZA 3CKOA 4Y7UA 2YC3A 1VZTA 1HM0A 3U2VA 2OEGA 1H7EA 2VXMA 4CJCA 1FXJA 3V0LA 4KPZA 4FRHA 1G8OA 2AM4A 1PZYB 1G0RA 1W77A 1ZJ1A 4G3QA 3CU0A 1V82A 3V8YA 3TQDA 4Y6NA 1ON8A 1WT0A 2Z87A 4EEGA 5C1GA 2JCLA 4J18A 2X60A 4P00A 1O23B 1LVWA 3R2WA 4Y63A 4ASYA 4HO8A 2RITA 2X5ZA 2VFZA 3OH1A 1R7YA 2PGYA 1WT3A 3V0NA 1LL3A 2Y6PA 1VGWA 1ZJ3A 4GBPA 1FZWA 2BO8A 3LW6A 3F1CA 1GQCA 4B2XA 1R7UA 4K6RA 4O6NA 4FREA 1WT1A 2FY7A 3U2WA 2MZBA 5C8RA 1FO9A 1EYRA 1H7FA 2WVKA 1K4VA 2RJ0A 2FFVA 4M2AA 3SXEA 4EE3A 4HO0A 2AH9A 2V0LA 4NAKA 3USRA 2I5KA 1H5TB 2RJ7A 3DUVA 1I52A 1O7OA 4EEAA 5C3BA 1HM9A 2DPWA 4CJBA 5IDSA 1LZJA 5D92A 2XMHA 1H7QA 4E1KA 2RJ5A 3SXAA 1ZCUA 1QGSA 4P02A 4NAIA 4BMAA 4NANA 4JD0A 3V90A 2ZU9A 1FGGA 3CKJA 2P72A 4MIXA 1H5SC 5JQQA 3K8EA 4HO9A 4FCUA 3IOHA 4B4BA 3NGWA 1FRWA 1FR9A 1MP3A 5C47A 4AYJA 1G95A 1YP3A 2AGDA 4FRQA 2E3DA 4ASJA 1H5TA 2AECA 1VM8A 4HO4A 3BCVA 2OEFA 3Q7UA 1WT2A 5AJPA 5CQMX
chains in the Genus database with same CATH topology
1ZJ0A 2D0JA 1H4EA 4G3PA 2WAWA 1ZIZA 2RJ1A 2AM3A 3E26A 4L41C 2APCA 5C49A 2J0BA 3V0QA 4B4GA 1JV3A 5AJOA 5IDTA 1HM8A 2OI6A 3OC9A 4Y7TA 1QG8A 4MNDA 3RMWA 3U2UA 4M28A 4HOCA 3U0XA 4EEMA 5IFYA 4MYBA 2RJ8A 5J49A 3BRKX 3E25A 4XWIA 2GGOA 1TZFA 1VGTA 2VK9A 2ZU8A 4ARWA 1FG5N 1H5RA 3I0EA 4Q7CA 5C3DA 3RSBA 2Y4JA 2W0WA 1H7GA 2JCOA 2WEEA 4KQLA 5CMFX 2PA4A 4FRPA 3SX3A 5FYEA 2V0KA 2D7IA 5I1FA 4DDZA 2JCKA 3JUKA 3T7NA 3V91A 3I0KA 4FRDA 1TVYA 5AJNA 4FRMA 2AE7A 5CQOA 1ZI1A 2QKXA 2ICYA 4CVHA 2GGQA 5CMIA 2Y4KA 4D11C 3F1YA 1INJA 1S4PA 4HO3A 3SXDA 1TW1A 1ZJ2A 4ZDQA 2O1HA 5D91A 1H5SB 1FWYA 2VSHA 2V0IA 5C4FA 4Y7FA 3CKVA 3SX5A 1WSZA 5FTVA 2BO4A 2OI7A 3N9WA 2Y4MA 4KC4A 1VH1A 3HL3A 1ZDFA 1O0RA 1O7QA 2O1FA 4LW3A 1EZIA 1HV9A 3I0CA 5BXCA 3I0FA 3DJ4A 2AESA 1H7HA 5C36A 1GA8A 2I7BA 4HO6A 1R80A 4KXOA 1H5SA 1H4DA 2I5EA 4D0TA 1HJJA 2XWLA 1VGZA 5DDVA 2XWMA 2FFUA 1YROB 1PZTA 3IOJA 1ZJPA 1XZ6A 3V0MA 4B2WA 3T7OA 3ZF8A 1QGQA 1VPAA 1FO8A 4KRVA 4JISA 2Q4JA 1VICA 3JTJA 2FYBA 1ZJOA 1G23A 1MP4A 3D8VA 1H7TA 1VH3A 3ST8A 2PX7A 1JYLA 3TZTA 2Z86A 1R7VA 4Y64A 1GWVA 1ZCYA 2VXLA 5C4EA 2WVLA 4M4KA 3U2TA 1VGUA 4C2SA 4DE7A 3QVBA 4KPXA 3I0LA 4FIYA 3CKQA 5CMHA 1R7XA 5HS2A 1LZ0A 3PKPA 2Y7AA 4LW6A 1ZI5A 2RIZA 2YC5A 4IRQA 1GX0A 4BQHA 4HG6A 1G1LA 1GX4A 1MP5A 4DECA 4IRPA 5FUHA 3V8ZA 2RJ9A 2W0VA 5C4BA 1ZI4A 3SXGA 3OH4A 4HO2A 2RJ6A 2O1GA 1VZUA 1R82A 1R7TA 4D11A 4G3SA 3I0GA 4R7PA 4UEGA 3OKRA 1GQ9A 3OGZA 3D98A 1H3MA 1INIA 4M2BA 2P73A 2JCJA 4KT7A 3SX8A 5EIYA 2D7RA 5CQLX 2FYAA 1KWSA 2E8BA 5EJZA 2YQSA 1YP2A 1YP4A 4O6MA 4AYLA 2A8UA 4G87A 1LL2A 4Y9XA 1NQIB 4AAWA 4FIXA 1S4OA 1W57A 1ZHJA 2YQCA 3KIAA 2XWNA 2RJ4A 1H5SD 3V0PA 1S4NA 2V0HA 2RIYA 2VS5A 2YESA 2YCMA 4Y7VA 5L6VA 3SX7A 3ZLLA 2WE9A 1IINA 4B5BA 3V0OA 3PKQA 4HO5A 1NKHB 4FCEA 4FROA 3I0IX 4HCQA 2UX8A 1FR8A 2FYCB 3FOQA 2AM5A 2YQHA 1Z90A 3U2XA 3I0HA 3R3IA 1QWJA 1ON6A 4KNXA 3DK5A 2ZU7A 1ZCVA 1GWWA 3SPTA 3Q4SA 3D5NA 3IOIA 2RIXA 1MC3A 2QH5A 2XMEA 2J0AA 1LZIA 1ZCTA 3GUEA 3U0YA 1G9RA 1G3LA 1OMXA 5C48A 2OI5A 5C1HA 4YS8A 1TW5A 2VD4A 3ZGGA 2Y4LA 3OH0A 3CGXA 2VS4A 3EE5A 3OH2A 3POLA 1JV1A 5C4DA 1V83A 2NXVA 2V0JA 2X65A 5C3AA 2P6WA 2BO7A 5CMJA 1G2VA 1ZI3A 3SXCA 3ZLKA 2ICXA 1NF5B 1JVDA 1FXOA 5FTSA 4B4MA 1WVCA 1W55A 4AC3A 4B3UA 5C1LA 1FOAA 1G93A 5C4CA 1JYKA 4FRLA 4Y6UA 4KC1A 2X5SA 1IIMA 4Y7GA 5FV9A 4FRAA 1ZDGA 1XHBA 2BO6A 4D0ZA 4EE5A 3ZGFA 1OQMB 1JVGA 1H7LA 2FYDB 1LL0A 1V84A 2WGZA 5CMGX 4EVWA 5EJ1A 4CJ8A 2PGVA 1G97A 1R81A 3I0DA 1FGXA 5C38A 1HJLA 1VZXA 3RMVA 5FU8A 4EE4A 4ECMA 1H5RB 2WVMA 5DDTA 2CU2A 3OH3A 4D48A 4KC2A 3CKNA 3OAMA 4FRBA 4Y62A 1NWGB 2VS3A 4NALA 2A8WA 3FWWA 2YQJA 3I0JA 4EEOA 3O3PA 1NHEB 2VSIA 3USQA 2C0NA 3JUJA 3PNNA 2QGIA 3T7MA 1NMMB 1SS9A 5CQPA 4B42A 5CQNX 1E5KA 5FU0A 3K8DA 4FQWA 4KNRA 1H4CA 3SXBA 3Q80A 5L6SA 1LZ7A 1OMZA 3CKOA 4Y7UA 2YC3A 1VZTA 1HM0A 3U2VA 2OEGA 1H7EA 2VXMA 4CJCA 1FXJA 3V0LA 4KPZA 4FRHA 1G8OA 2AM4A 1PZYB 1G0RA 1W77A 1ZJ1A 4G3QA 3CU0A 1V82A 3V8YA 3TQDA 4Y6NA 1ON8A 1WT0A 2Z87A 4EEGA 5C1GA 2JCLA 4J18A 2X60A 4P00A 1O23B 1LVWA 3R2WA 4Y63A 4ASYA 4HO8A 2RITA 2X5ZA 2VFZA 3OH1A 1R7YA 2PGYA 1WT3A 3V0NA 1LL3A 2Y6PA 1VGWA 1ZJ3A 4GBPA 1FZWA 2BO8A 3LW6A 3F1CA 1GQCA 4B2XA 1R7UA 4K6RA 4O6NA 4FREA 1WT1A 2FY7A 3U2WA 2MZBA 5C8RA 1FO9A 1EYRA 1H7FA 2WVKA 1K4VA 2RJ0A 2FFVA 4M2AA 3SXEA 4EE3A 4HO0A 2AH9A 2V0LA 4NAKA 3USRA 2I5KA 1H5TB 2RJ7A 3DUVA 1I52A 1O7OA 4EEAA 5C3BA 1HM9A 2DPWA 4CJBA 5IDSA 1LZJA 5D92A 2XMHA 1H7QA 4E1KA 2RJ5A 3SXAA 1ZCUA 1QGSA 4P02A 4NAIA 4BMAA 4NANA 4JD0A 3V90A 2ZU9A 1FGGA 3CKJA 2P72A 4MIXA 1H5SC 5JQQA 3K8EA 4HO9A 4FCUA 3IOHA 4B4BA 3NGWA 1FRWA 1FR9A 1MP3A 5C47A 4AYJA 1G95A 1YP3A 2AGDA 4FRQA 2E3DA 4ASJA 1H5TA 2AECA 1VM8A 4HO4A 3BCVA 2OEFA 3Q7UA 1WT2A 5AJPA 5CQMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJ0 A;  2D0J A;  1H4E A;  4G3P A;  2WAW A;  1ZIZ A;  2RJ1 A;  2AM3 A;  3E26 A;  4L41 C;  2APC A;  5C49 A;  4B4G A;  3V0Q A;  1JV3 A;  5AJO A;  5IDT A;  1HM8 A;  2OI6 A;  3OC9 A;  4Y7T A;  1QG8 A;  4MND A;  3RMW A;  3U2U A;  4M28 A;  4HOC A;  3U0X A;  4EEM A;  5IFY A;  4MYB A;  2RJ8 A;  5J49 A;  3BRK X;  3E25 A;  4XWI A;  2GGO A;  1TZF A;  1VGT A;  2ZU8 A;  4ARW A;  1FG5 N;  1H5R A;  3I0E A;  5C3D A;  3RSB A;  2Y4J A;  2W0W A;  1H7G A;  2JCO A;  2WEE A;  4KQL A;  5CMF X;  2PA4 A;  4FRP A;  3SX3 A;  5FYE A;  2V0K A;  2D7I A;  5I1F A;  4DDZ A;  2JCK A;  3JUK A;  3T7N A;  3V91 A;  3I0K A;  4FRD A;  1TVY A;  5AJN A;  4FRM A;  2AE7 A;  5CQO A;  1ZI1 A;  2QKX A;  2ICY A;  4CVH A;  2GGQ A;  5CMI A;  2Y4K A;  4D11 C;  3F1Y A;  1INJ A;  1S4P A;  4HO3 A;  3SXD A;  1TW1 A;  1ZJ2 A;  4ZDQ A;  2O1H A;  1H5S B;  1FWY A;  2VSH A;  2V0I A;  5C4F A;  4Y7F A;  3CKV A;  3SX5 A;  1WSZ A;  5FTV A;  2BO4 A;  2OI7 A;  3N9W A;  2Y4M A;  4KC4 A;  1VH1 A;  3HL3 A;  1ZDF A;  1O0R A;  1O7Q A;  2O1F A;  4LW3 A;  1EZI A;  1HV9 A;  3I0C A;  5BXC A;  3I0F A;  3DJ4 A;  2AES A;  1H7H A;  5C36 A;  1GA8 A;  2I7B A;  4HO6 A;  1R80 A;  4KXO A;  1H5S A;  1H4D A;  2I5E A;  4D0T A;  1HJJ A;  2XWL A;  1VGZ A;  5DDV A;  2XWM A;  2FFU A;  1YRO B;  1PZT A;  3IOJ A;  1ZJP A;  1XZ6 A;  3V0M A;  4B2W A;  3T7O A;  3ZF8 A;  1QGQ A;  1VPA A;  1FO8 A;  4KRV A;  4JIS A;  2Q4J A;  1VIC A;  3JTJ A;  2FYB A;  1ZJO A;  1G23 A;  1MP4 A;  3D8V A;  1H7T A;  1VH3 A;  3ST8 A;  2PX7 A;  1JYL A;  3TZT A;  2Z86 A;  1R7V A;  4Y64 A;  1GWV A;  1ZCY A;  2VXL A;  5C4E A;  2WVL A;  4M4K A;  3U2T A;  1VGU A;  4C2S A;  4DE7 A;  3QVB A;  4KPX A;  3I0L A;  3CKQ A;  5CMH A;  1R7X A;  5HS2 A;  1LZ0 A;  3PKP A;  2Y7A A;  4LW6 A;  1ZI5 A;  2RIZ A;  2YC5 A;  4IRQ A;  1GX0 A;  4BQH A;  4HG6 A;  1G1L A;  1GX4 A;  1MP5 A;  4DEC A;  4IRP A;  5FUH A;  3V8Z A;  2RJ9 A;  2W0V A;  5C4B A;  1ZI4 A;  3SXG A;  3OH4 A;  4HO2 A;  2RJ6 A;  2O1G A;  1VZU A;  1R82 A;  1R7T A;  4D11 A;  4G3S A;  3I0G A;  4R7P A;  4UEG A;  3OKR A;  1GQ9 A;  3OGZ A;  3D98 A;  1H3M A;  1INI A;  4M2B A;  2P73 A;  2JCJ A;  4KT7 A;  3SX8 A;  5EIY A;  2D7R A;  5CQL X;  2FYA A;  1KWS A;  2E8B A;  5EJZ A;  2YQS A;  1YP2 A;  1YP4 A;  4AYL A;  2A8U A;  4G87 A;  1LL2 A;  4Y9X A;  1NQI B;  4AAW A;  1S4O A;  1W57 A;  1ZHJ A;  2YQC A;  3KIA A;  2XWN A;  2RJ4 A;  1H5S D;  3V0P A;  1S4N A;  2V0H A;  2RIY A;  2VS5 A;  2YES A;  2YCM A;  4Y7V A;  5L6V A;  3SX7 A;  3ZLL A;  2WE9 A;  1IIN A;  4B5B A;  3V0O A;  3PKQ A;  4HO5 A;  1NKH B;  4FCE A;  4FRO A;  3I0I X;  4HCQ A;  2UX8 A;  1FR8 A;  2FYC B;  3FOQ A;  2AM5 A;  2YQH A;  1Z90 A;  3U2X A;  3I0H A;  3R3I A;  1QWJ A;  1ON6 A;  4KNX A;  3DK5 A;  2ZU7 A;  1ZCV A;  1GWW A;  3SPT A;  3Q4S A;  3D5N A;  3IOI A;  2RIX A;  1MC3 A;  2QH5 A;  2XME A;  1LZI A;  1ZCT A;  3GUE A;  3U0Y A;  1G9R A;  1G3L A;  1OMX A;  5C48 A;  2OI5 A;  5C1H A;  4YS8 A;  1TW5 A;  2VD4 A;  3ZGG A;  2Y4L A;  3OH0 A;  3CGX A;  2VS4 A;  3EE5 A;  3OH2 A;  3POL A;  1JV1 A;  5C4D A;  1V83 A;  2NXV A;  2V0J A;  2X65 A;  5C3A A;  2P6W A;  2BO7 A;  5CMJ A;  1G2V A;  1ZI3 A;  3SXC A;  3ZLK A;  2ICX A;  1NF5 B;  1JVD A;  1FXO A;  5FTS A;  4B4M A;  1WVC A;  1W55 A;  4AC3 A;  4B3U A;  5C1L A;  1FOA A;  1G93 A;  5C4C A;  1JYK A;  4FRL A;  4Y6U A;  4KC1 A;  2X5S A;  1IIM A;  4Y7G A;  5FV9 A;  4FRA A;  1ZDG A;  1XHB A;  2BO6 A;  4D0Z A;  4EE5 A;  3ZGF A;  1OQM B;  1JVG A;  1H7L A;  2FYD B;  1LL0 A;  1V84 A;  2WGZ A;  5CMG X;  4EVW A;  5EJ1 A;  4CJ8 A;  2PGV A;  1G97 A;  1R81 A;  3I0D A;  1FGX A;  5C38 A;  1HJL A;  1VZX A;  3RMV A;  5FU8 A;  4EE4 A;  4ECM A;  1H5R B;  2WVM A;  5DDT A;  2CU2 A;  3OH3 A;  4D48 A;  4KC2 A;  3CKN A;  3OAM A;  4FRB A;  4Y62 A;  1NWG B;  2VS3 A;  4NAL A;  2A8W A;  3FWW A;  2YQJ A;  3I0J A;  4EEO A;  3O3P A;  1NHE B;  2VSI A;  3USQ A;  3JUJ A;  3PNN A;  2QGI A;  3T7M A;  1NMM B;  1SS9 A;  5CQP A;  4B42 A;  5CQN X;  1E5K A;  5FU0 A;  3K8D A;  4FQW A;  4KNR A;  1H4C A;  3SXB A;  3Q80 A;  5L6S A;  1LZ7 A;  1OMZ A;  3CKO A;  4Y7U A;  2YC3 A;  1VZT A;  1HM0 A;  3U2V A;  2OEG A;  1H7E A;  2VXM A;  4CJC A;  1FXJ A;  3V0L A;  4KPZ A;  4FRH A;  1G8O A;  2AM4 A;  1PZY B;  1G0R A;  1W77 A;  1ZJ1 A;  4G3Q A;  3CU0 A;  1V82 A;  3V8Y A;  3TQD A;  4Y6N A;  1ON8 A;  1WT0 A;  2Z87 A;  4EEG A;  5C1G A;  2JCL A;  4J18 A;  2X60 A;  4P00 A;  1O23 B;  1LVW A;  3R2W A;  4Y63 A;  4ASY A;  4HO8 A;  2RIT A;  2X5Z A;  2VFZ A;  3OH1 A;  1R7Y A;  2PGY A;  1WT3 A;  3V0N A;  1LL3 A;  2Y6P A;  1VGW A;  1ZJ3 A;  4GBP A;  1FZW A;  2BO8 A;  3LW6 A;  3F1C A;  1GQC A;  4B2X A;  1R7U A;  4K6R A;  4FRE A;  1WT1 A;  2FY7 A;  3U2W A;  2MZB A;  5C8R A;  1FO9 A;  1EYR A;  1H7F A;  2WVK A;  1K4V A;  2RJ0 A;  2FFV A;  4M2A A;  3SXE A;  4EE3 A;  4HO0 A;  2AH9 A;  2V0L A;  4NAK A;  3USR A;  2I5K A;  1H5T B;  2RJ7 A;  3DUV A;  1I52 A;  1O7O A;  4EEA A;  5C3B A;  1HM9 A;  2DPW A;  4CJB A;  5IDS A;  1LZJ A;  2XMH A;  1H7Q A;  4E1K A;  2RJ5 A;  3SXA A;  1ZCU A;  1QGS A;  4P02 A;  4NAI A;  4BMA A;  4NAN A;  4JD0 A;  3V90 A;  2ZU9 A;  1FGG A;  3CKJ A;  2P72 A;  1H5S C;  5JQQ A;  3K8E A;  4HO9 A;  4FCU A;  3IOH A;  4B4B A;  3NGW A;  1FRW A;  1FR9 A;  1MP3 A;  5C47 A;  4AYJ A;  1G95 A;  1YP3 A;  2AGD A;  4FRQ A;  2E3D A;  4ASJ A;  1H5T A;  2AEC A;  1VM8 A;  4HO4 A;  3BCV A;  2OEF A;  3Q7U A;  1WT2 A;  5AJP A;  5CQM X; 
#chains in the Genus database with same CATH topology
 1ZJ0 A;  2D0J A;  1H4E A;  4G3P A;  2WAW A;  1ZIZ A;  2RJ1 A;  2AM3 A;  3E26 A;  4L41 C;  2APC A;  5C49 A;  2J0B A;  3V0Q A;  4B4G A;  1JV3 A;  5AJO A;  5IDT A;  1HM8 A;  2OI6 A;  3OC9 A;  4Y7T A;  1QG8 A;  4MND A;  3RMW A;  3U2U A;  4M28 A;  4HOC A;  3U0X A;  4EEM A;  5IFY A;  4MYB A;  2RJ8 A;  5J49 A;  3BRK X;  3E25 A;  4XWI A;  2GGO A;  1TZF A;  1VGT A;  2VK9 A;  2ZU8 A;  4ARW A;  1FG5 N;  1H5R A;  3I0E A;  4Q7C A;  5C3D A;  3RSB A;  2Y4J A;  2W0W A;  1H7G A;  2JCO A;  2WEE A;  4KQL A;  5CMF X;  2PA4 A;  4FRP A;  3SX3 A;  5FYE A;  2V0K A;  2D7I A;  5I1F A;  4DDZ A;  2JCK A;  3JUK A;  3T7N A;  3V91 A;  3I0K A;  4FRD A;  1TVY A;  5AJN A;  4FRM A;  2AE7 A;  5CQO A;  1ZI1 A;  2QKX A;  2ICY A;  4CVH A;  2GGQ A;  5CMI A;  2Y4K A;  4D11 C;  3F1Y A;  1INJ A;  1S4P A;  4HO3 A;  3SXD A;  1TW1 A;  1ZJ2 A;  4ZDQ A;  2O1H A;  5D91 A;  1H5S B;  1FWY A;  2VSH A;  2V0I A;  5C4F A;  4Y7F A;  3CKV A;  3SX5 A;  1WSZ A;  5FTV A;  2BO4 A;  2OI7 A;  3N9W A;  2Y4M A;  4KC4 A;  1VH1 A;  3HL3 A;  1ZDF A;  1O0R A;  1O7Q A;  2O1F A;  4LW3 A;  1EZI A;  1HV9 A;  3I0C A;  5BXC A;  3I0F A;  3DJ4 A;  2AES A;  1H7H A;  5C36 A;  1GA8 A;  2I7B A;  4HO6 A;  1R80 A;  4KXO A;  1H5S A;  1H4D A;  2I5E A;  4D0T A;  1HJJ A;  2XWL A;  1VGZ A;  5DDV A;  2XWM A;  2FFU A;  1YRO B;  1PZT A;  3IOJ A;  1ZJP A;  1XZ6 A;  3V0M A;  4B2W A;  3T7O A;  3ZF8 A;  1QGQ A;  1VPA A;  1FO8 A;  4KRV A;  4JIS A;  2Q4J A;  1VIC A;  3JTJ A;  2FYB A;  1ZJO A;  1G23 A;  1MP4 A;  3D8V A;  1H7T A;  1VH3 A;  3ST8 A;  2PX7 A;  1JYL A;  3TZT A;  2Z86 A;  1R7V A;  4Y64 A;  1GWV A;  1ZCY A;  2VXL A;  5C4E A;  2WVL A;  4M4K A;  3U2T A;  1VGU A;  4C2S A;  4DE7 A;  3QVB A;  4KPX A;  3I0L A;  4FIY A;  3CKQ A;  5CMH A;  1R7X A;  5HS2 A;  1LZ0 A;  3PKP A;  2Y7A A;  4LW6 A;  1ZI5 A;  2RIZ A;  2YC5 A;  4IRQ A;  1GX0 A;  4BQH A;  4HG6 A;  1G1L A;  1GX4 A;  1MP5 A;  4DEC A;  4IRP A;  5FUH A;  3V8Z A;  2RJ9 A;  2W0V A;  5C4B A;  1ZI4 A;  3SXG A;  3OH4 A;  4HO2 A;  2RJ6 A;  2O1G A;  1VZU A;  1R82 A;  1R7T A;  4D11 A;  4G3S A;  3I0G A;  4R7P A;  4UEG A;  3OKR A;  1GQ9 A;  3OGZ A;  3D98 A;  1H3M A;  1INI A;  4M2B A;  2P73 A;  2JCJ A;  4KT7 A;  3SX8 A;  5EIY A;  2D7R A;  5CQL X;  2FYA A;  1KWS A;  2E8B A;  5EJZ A;  2YQS A;  1YP2 A;  1YP4 A;  4O6M A;  4AYL A;  2A8U A;  4G87 A;  1LL2 A;  4Y9X A;  1NQI B;  4AAW A;  4FIX A;  1S4O A;  1W57 A;  1ZHJ A;  2YQC A;  3KIA A;  2XWN A;  2RJ4 A;  1H5S D;  3V0P A;  1S4N A;  2V0H A;  2RIY A;  2VS5 A;  2YES A;  2YCM A;  4Y7V A;  5L6V A;  3SX7 A;  3ZLL A;  2WE9 A;  1IIN A;  4B5B A;  3V0O A;  3PKQ A;  4HO5 A;  1NKH B;  4FCE A;  4FRO A;  3I0I X;  4HCQ A;  2UX8 A;  1FR8 A;  2FYC B;  3FOQ A;  2AM5 A;  2YQH A;  1Z90 A;  3U2X A;  3I0H A;  3R3I A;  1QWJ A;  1ON6 A;  4KNX A;  3DK5 A;  2ZU7 A;  1ZCV A;  1GWW A;  3SPT A;  3Q4S A;  3D5N A;  3IOI A;  2RIX A;  1MC3 A;  2QH5 A;  2XME A;  2J0A A;  1LZI A;  1ZCT A;  3GUE A;  3U0Y A;  1G9R A;  1G3L A;  1OMX A;  5C48 A;  2OI5 A;  5C1H A;  4YS8 A;  1TW5 A;  2VD4 A;  3ZGG A;  2Y4L A;  3OH0 A;  3CGX A;  2VS4 A;  3EE5 A;  3OH2 A;  3POL A;  1JV1 A;  5C4D A;  1V83 A;  2NXV A;  2V0J A;  2X65 A;  5C3A A;  2P6W A;  2BO7 A;  5CMJ A;  1G2V A;  1ZI3 A;  3SXC A;  3ZLK A;  2ICX A;  1NF5 B;  1JVD A;  1FXO A;  5FTS A;  4B4M A;  1WVC A;  1W55 A;  4AC3 A;  4B3U A;  5C1L A;  1FOA A;  1G93 A;  5C4C A;  1JYK A;  4FRL A;  4Y6U A;  4KC1 A;  2X5S A;  1IIM A;  4Y7G A;  5FV9 A;  4FRA A;  1ZDG A;  1XHB A;  2BO6 A;  4D0Z A;  4EE5 A;  3ZGF A;  1OQM B;  1JVG A;  1H7L A;  2FYD B;  1LL0 A;  1V84 A;  2WGZ A;  5CMG X;  4EVW A;  5EJ1 A;  4CJ8 A;  2PGV A;  1G97 A;  1R81 A;  3I0D A;  1FGX A;  5C38 A;  1HJL A;  1VZX A;  3RMV A;  5FU8 A;  4EE4 A;  4ECM A;  1H5R B;  2WVM A;  5DDT A;  2CU2 A;  3OH3 A;  4D48 A;  4KC2 A;  3CKN A;  3OAM A;  4FRB A;  4Y62 A;  1NWG B;  2VS3 A;  4NAL A;  2A8W A;  3FWW A;  2YQJ A;  3I0J A;  4EEO A;  3O3P A;  1NHE B;  2VSI A;  3USQ A;  2C0N A;  3JUJ A;  3PNN A;  2QGI A;  3T7M A;  1NMM B;  1SS9 A;  5CQP A;  4B42 A;  5CQN X;  1E5K A;  5FU0 A;  3K8D A;  4FQW A;  4KNR A;  1H4C A;  3SXB A;  3Q80 A;  5L6S A;  1LZ7 A;  1OMZ A;  3CKO A;  4Y7U A;  2YC3 A;  1VZT A;  1HM0 A;  3U2V A;  2OEG A;  1H7E A;  2VXM A;  4CJC A;  1FXJ A;  3V0L A;  4KPZ A;  4FRH A;  1G8O A;  2AM4 A;  1PZY B;  1G0R A;  1W77 A;  1ZJ1 A;  4G3Q A;  3CU0 A;  1V82 A;  3V8Y A;  3TQD A;  4Y6N A;  1ON8 A;  1WT0 A;  2Z87 A;  4EEG A;  5C1G A;  2JCL A;  4J18 A;  2X60 A;  4P00 A;  1O23 B;  1LVW A;  3R2W A;  4Y63 A;  4ASY A;  4HO8 A;  2RIT A;  2X5Z A;  2VFZ A;  3OH1 A;  1R7Y A;  2PGY A;  1WT3 A;  3V0N A;  1LL3 A;  2Y6P A;  1VGW A;  1ZJ3 A;  4GBP A;  1FZW A;  2BO8 A;  3LW6 A;  3F1C A;  1GQC A;  4B2X A;  1R7U A;  4K6R A;  4O6N A;  4FRE A;  1WT1 A;  2FY7 A;  3U2W A;  2MZB A;  5C8R A;  1FO9 A;  1EYR A;  1H7F A;  2WVK A;  1K4V A;  2RJ0 A;  2FFV A;  4M2A A;  3SXE A;  4EE3 A;  4HO0 A;  2AH9 A;  2V0L A;  4NAK A;  3USR A;  2I5K A;  1H5T B;  2RJ7 A;  3DUV A;  1I52 A;  1O7O A;  4EEA A;  5C3B A;  1HM9 A;  2DPW A;  4CJB A;  5IDS A;  1LZJ A;  5D92 A;  2XMH A;  1H7Q A;  4E1K A;  2RJ5 A;  3SXA A;  1ZCU A;  1QGS A;  4P02 A;  4NAI A;  4BMA A;  4NAN A;  4JD0 A;  3V90 A;  2ZU9 A;  1FGG A;  3CKJ A;  2P72 A;  4MIX A;  1H5S C;  5JQQ A;  3K8E A;  4HO9 A;  4FCU A;  3IOH A;  4B4B A;  3NGW A;  1FRW A;  1FR9 A;  1MP3 A;  5C47 A;  4AYJ A;  1G95 A;  1YP3 A;  2AGD A;  4FRQ A;  2E3D A;  4ASJ A;  1H5T A;  2AEC A;  1VM8 A;  4HO4 A;  3BCV A;  2OEF A;  3Q7U A;  1WT2 A;  5AJP A;  5CQM X; 
#chains in the Genus database with same CATH homology
 1ZJ0 A;  2D0J A;  1H4E A;  4G3P A;  2WAW A;  1ZIZ A;  2RJ1 A;  2AM3 A;  3E26 A;  4L41 C;  2APC A;  5C49 A;  2J0B A;  3V0Q A;  4B4G A;  1JV3 A;  5AJO A;  5IDT A;  1HM8 A;  2OI6 A;  3OC9 A;  4Y7T A;  1QG8 A;  4MND A;  3RMW A;  3U2U A;  4M28 A;  4HOC A;  3U0X A;  4EEM A;  5IFY A;  4MYB A;  2RJ8 A;  5J49 A;  3BRK X;  3E25 A;  4XWI A;  2GGO A;  1TZF A;  1VGT A;  2VK9 A;  2ZU8 A;  4ARW A;  1FG5 N;  1H5R A;  3I0E A;  4Q7C A;  5C3D A;  3RSB A;  2Y4J A;  2W0W A;  1H7G A;  2JCO A;  2WEE A;  4KQL A;  5CMF X;  2PA4 A;  4FRP A;  3SX3 A;  5FYE A;  2V0K A;  2D7I A;  5I1F A;  4DDZ A;  2JCK A;  3JUK A;  3T7N A;  3V91 A;  3I0K A;  4FRD A;  1TVY A;  5AJN A;  4FRM A;  2AE7 A;  5CQO A;  1ZI1 A;  2QKX A;  2ICY A;  4CVH A;  2GGQ A;  5CMI A;  2Y4K A;  4D11 C;  3F1Y A;  1INJ A;  1S4P A;  4HO3 A;  3SXD A;  1TW1 A;  1ZJ2 A;  4ZDQ A;  2O1H A;  5D91 A;  1H5S B;  1FWY A;  2VSH A;  2V0I A;  5C4F A;  4Y7F A;  3CKV A;  3SX5 A;  1WSZ A;  5FTV A;  2BO4 A;  2OI7 A;  3N9W A;  2Y4M A;  4KC4 A;  1VH1 A;  3HL3 A;  1ZDF A;  1O0R A;  1O7Q A;  2O1F A;  4LW3 A;  1EZI A;  1HV9 A;  3I0C A;  5BXC A;  3I0F A;  3DJ4 A;  2AES A;  1H7H A;  5C36 A;  1GA8 A;  2I7B A;  4HO6 A;  1R80 A;  4KXO A;  1H5S A;  1H4D A;  2I5E A;  4D0T A;  1HJJ A;  2XWL A;  1VGZ A;  5DDV A;  2XWM A;  2FFU A;  1YRO B;  1PZT A;  3IOJ A;  1ZJP A;  1XZ6 A;  3V0M A;  4B2W A;  3T7O A;  3ZF8 A;  1QGQ A;  1VPA A;  1FO8 A;  4KRV A;  4JIS A;  2Q4J A;  1VIC A;  3JTJ A;  2FYB A;  1ZJO A;  1G23 A;  1MP4 A;  3D8V A;  1H7T A;  1VH3 A;  3ST8 A;  2PX7 A;  1JYL A;  3TZT A;  2Z86 A;  1R7V A;  4Y64 A;  1GWV A;  1ZCY A;  2VXL A;  5C4E A;  2WVL A;  4M4K A;  3U2T A;  1VGU A;  4C2S A;  4DE7 A;  3QVB A;  4KPX A;  3I0L A;  4FIY A;  3CKQ A;  5CMH A;  1R7X A;  5HS2 A;  1LZ0 A;  3PKP A;  2Y7A A;  4LW6 A;  1ZI5 A;  2RIZ A;  2YC5 A;  4IRQ A;  1GX0 A;  4BQH A;  4HG6 A;  1G1L A;  1GX4 A;  1MP5 A;  4DEC A;  4IRP A;  5FUH A;  3V8Z A;  2RJ9 A;  2W0V A;  5C4B A;  1ZI4 A;  3SXG A;  3OH4 A;  4HO2 A;  2RJ6 A;  2O1G A;  1VZU A;  1R82 A;  1R7T A;  4D11 A;  4G3S A;  3I0G A;  4R7P A;  4UEG A;  3OKR A;  1GQ9 A;  3OGZ A;  3D98 A;  1H3M A;  1INI A;  4M2B A;  2P73 A;  2JCJ A;  4KT7 A;  3SX8 A;  5EIY A;  2D7R A;  5CQL X;  2FYA A;  1KWS A;  2E8B A;  5EJZ A;  2YQS A;  1YP2 A;  1YP4 A;  4O6M A;  4AYL A;  2A8U A;  4G87 A;  1LL2 A;  4Y9X A;  1NQI B;  4AAW A;  4FIX A;  1S4O A;  1W57 A;  1ZHJ A;  2YQC A;  3KIA A;  2XWN A;  2RJ4 A;  1H5S D;  3V0P A;  1S4N A;  2V0H A;  2RIY A;  2VS5 A;  2YES A;  2YCM A;  4Y7V A;  5L6V A;  3SX7 A;  3ZLL A;  2WE9 A;  1IIN A;  4B5B A;  3V0O A;  3PKQ A;  4HO5 A;  1NKH B;  4FCE A;  4FRO A;  3I0I X;  4HCQ A;  2UX8 A;  1FR8 A;  2FYC B;  3FOQ A;  2AM5 A;  2YQH A;  1Z90 A;  3U2X A;  3I0H A;  3R3I A;  1QWJ A;  1ON6 A;  4KNX A;  3DK5 A;  2ZU7 A;  1ZCV A;  1GWW A;  3SPT A;  3Q4S A;  3D5N A;  3IOI A;  2RIX A;  1MC3 A;  2QH5 A;  2XME A;  2J0A A;  1LZI A;  1ZCT A;  3GUE A;  3U0Y A;  1G9R A;  1G3L A;  1OMX A;  5C48 A;  2OI5 A;  5C1H A;  4YS8 A;  1TW5 A;  2VD4 A;  3ZGG A;  2Y4L A;  3OH0 A;  3CGX A;  2VS4 A;  3EE5 A;  3OH2 A;  3POL A;  1JV1 A;  5C4D A;  1V83 A;  2NXV A;  2V0J A;  2X65 A;  5C3A A;  2P6W A;  2BO7 A;  5CMJ A;  1G2V A;  1ZI3 A;  3SXC A;  3ZLK A;  2ICX A;  1NF5 B;  1JVD A;  1FXO A;  5FTS A;  4B4M A;  1WVC A;  1W55 A;  4AC3 A;  4B3U A;  5C1L A;  1FOA A;  1G93 A;  5C4C A;  1JYK A;  4FRL A;  4Y6U A;  4KC1 A;  2X5S A;  1IIM A;  4Y7G A;  5FV9 A;  4FRA A;  1ZDG A;  1XHB A;  2BO6 A;  4D0Z A;  4EE5 A;  3ZGF A;  1OQM B;  1JVG A;  1H7L A;  2FYD B;  1LL0 A;  1V84 A;  2WGZ A;  5CMG X;  4EVW A;  5EJ1 A;  4CJ8 A;  2PGV A;  1G97 A;  1R81 A;  3I0D A;  1FGX A;  5C38 A;  1HJL A;  1VZX A;  3RMV A;  5FU8 A;  4EE4 A;  4ECM A;  1H5R B;  2WVM A;  5DDT A;  2CU2 A;  3OH3 A;  4D48 A;  4KC2 A;  3CKN A;  3OAM A;  4FRB A;  4Y62 A;  1NWG B;  2VS3 A;  4NAL A;  2A8W A;  3FWW A;  2YQJ A;  3I0J A;  4EEO A;  3O3P A;  1NHE B;  2VSI A;  3USQ A;  2C0N A;  3JUJ A;  3PNN A;  2QGI A;  3T7M A;  1NMM B;  1SS9 A;  5CQP A;  4B42 A;  5CQN X;  1E5K A;  5FU0 A;  3K8D A;  4FQW A;  4KNR A;  1H4C A;  3SXB A;  3Q80 A;  5L6S A;  1LZ7 A;  1OMZ A;  3CKO A;  4Y7U A;  2YC3 A;  1VZT A;  1HM0 A;  3U2V A;  2OEG A;  1H7E A;  2VXM A;  4CJC A;  1FXJ A;  3V0L A;  4KPZ A;  4FRH A;  1G8O A;  2AM4 A;  1PZY B;  1G0R A;  1W77 A;  1ZJ1 A;  4G3Q A;  3CU0 A;  1V82 A;  3V8Y A;  3TQD A;  4Y6N A;  1ON8 A;  1WT0 A;  2Z87 A;  4EEG A;  5C1G A;  2JCL A;  4J18 A;  2X60 A;  4P00 A;  1O23 B;  1LVW A;  3R2W A;  4Y63 A;  4ASY A;  4HO8 A;  2RIT A;  2X5Z A;  2VFZ A;  3OH1 A;  1R7Y A;  2PGY A;  1WT3 A;  3V0N A;  1LL3 A;  2Y6P A;  1VGW A;  1ZJ3 A;  4GBP A;  1FZW A;  2BO8 A;  3LW6 A;  3F1C A;  1GQC A;  4B2X A;  1R7U A;  4K6R A;  4O6N A;  4FRE A;  1WT1 A;  2FY7 A;  3U2W A;  2MZB A;  5C8R A;  1FO9 A;  1EYR A;  1H7F A;  2WVK A;  1K4V A;  2RJ0 A;  2FFV A;  4M2A A;  3SXE A;  4EE3 A;  4HO0 A;  2AH9 A;  2V0L A;  4NAK A;  3USR A;  2I5K A;  1H5T B;  2RJ7 A;  3DUV A;  1I52 A;  1O7O A;  4EEA A;  5C3B A;  1HM9 A;  2DPW A;  4CJB A;  5IDS A;  1LZJ A;  5D92 A;  2XMH A;  1H7Q A;  4E1K A;  2RJ5 A;  3SXA A;  1ZCU A;  1QGS A;  4P02 A;  4NAI A;  4BMA A;  4NAN A;  4JD0 A;  3V90 A;  2ZU9 A;  1FGG A;  3CKJ A;  2P72 A;  4MIX A;  1H5S C;  5JQQ A;  3K8E A;  4HO9 A;  4FCU A;  3IOH A;  4B4B A;  3NGW A;  1FRW A;  1FR9 A;  1MP3 A;  5C47 A;  4AYJ A;  1G95 A;  1YP3 A;  2AGD A;  4FRQ A;  2E3D A;  4ASJ A;  1H5T A;  2AEC A;  1VM8 A;  4HO4 A;  3BCV A;  2OEF A;  3Q7U A;  1WT2 A;  5AJP A;  5CQM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...