5C4EA

Crystal structure of gtb + udp-glc + h-antigen acceptor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
292
structure length
290
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 290
sequence length 292
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c4eA00
1H5RB 3I0EA 4AAWA 3CKOA 3OAMA 3ZF8A 1FGGA 1H4EA 1HM0A 2PX7A 3I0IX 4DECA 3SXEA 2W0VA 1VH3A 2PGYA 2VXMA 1ZI3A 2YQSA 1MC3A 4NAKA 5C4CA 4ASYA 2AE7A 4FRPA 1EZIA 4FRBA 1NQIB 2RJ5A 4EE4A 1EYRA 3T7MA 3E25A 4K6RA 4FRDA 2FYAA 2JCJA 1LL0A 1H3MA 5C38A 2I7BA 2OI5A 3IOIA 3T7NA 1YP4A 2GGQA 3U2TA 1V82A 2AM4A 1FR9A 1FR8A 2VD4A 4NALA 1TW1A 1ZCYA 5CQPA 3OH0A 3OH2A 3OH1A 2FYDB 1R82A 3CKVA 2X65A 4J18A 4NANA 1LZIA 1ZIZA 1LZJA 3F1YA 4ASJA 1ZDGA 4JD0A 3IOJA 1MP4A 1H7LA 3ZLKA 5L6SA 1R80A 2A8UA 2Y4LA 2WAWA 2FYCB 2I5KA 2GGOA 3E26A 3IOHA 1H7FA 3CKJA 3DK5A 4JISA 5C4BA 1W77A 5C3BA 5EJ1A 1VZXA 1O7OA 3KIAA 1TW5A 2V0HA 1KWSA 4G87A 5FU0A 4CVHA 5C48A 2JCLA 3SX8A 3SXGA 5FU8A 4B4BA 1LVWA 2AESA 2O1GA 2YCMA 1E5KA 3I0GA 1H7HA 3ZGFA 3D8VA 2OI6A 1GWVA 4FRHA 2UX8A 2ICYA 3USQA 2RJ6A 3JTJA 4CJ8A 4ECMA 2VFZA 1VGUA 4M4KA 1JYKA 2QH5A 4DDZA 2APCA 1H4DA 4KPXA 4B3UA 1G97A 3V0MA 4D48A 1OMXA 1G95A 1K4VA 2RJ7A 1QG8A 3SX7A 1NWGB 1NHEB 4KC2A 1NMMB 4KPZA 1LL3A 4EEGA 2D0JA 2BO4A 3ST8A 4NAIA 3RMWA 1IINA 5DDTA 2E8BA 1W57A 2WVMA 3PNNA 1Z90A 1QGSA 1FXJA 1G9RA 1QGQA 1ZCUA 4Y63A 4BQHA 5JQQA 1G93A 3TQDA 3U2XA 2AH9A 1TZFA 2X5ZA 3DJ4A 4Y7UA 1ZJ2A 1R7TA 2FFVA 1V83A 5C49A 2E3DA 1WT2A 2PGVA 1HM9A 3I0FA 4B4MA 2RJ0A 4B42A 5C36A 2MZBA 3SXBA 1O0RA 1FRWA 3F1CA 5IFYA 2YC5A 4Y7VA 2RJ9A 2VS4A 1WSZA 1G3LA 1XHBA 3SX3A 1IIMA 1O7QA 5DDVA 3V8ZA 5CMJA 1FXOA 5FTVA 2YQHA 3GUEA 4ARWA 3CGXA 2RJ1A 2CU2A 2RITA 5FTSA 1WVCA 5HS2A 2QKXA 5FV9A 5IDTA 1JV3A 2BO6A 1ZI5A 2WGZA 3QVBA 3U2VA 1S4PA 4B2XA 1GX0A 4GBPA 1FG5N 2OEGA 3U0YA 2FFUA 5IDSA 3HL3A 3Q7UA 5EJZA 2NXVA 4B5BA 2OEFA 2X5SA 1GQ9A 3Q4SA 1ZCVA 3V8YA 1INJA 4D0ZA 1ZJ1A 4KXOA 1ZI1A 5FUHA 3K8DA 3PKPA 2D7IA 4BMAA 1H5SA 3ZLLA 1G8OA 2RJ4A 4D0TA 1H5RA 3D98A 5C1LA 2XWLA 1ON8A 1FO9A 2XWNA 2DPWA 2PA4A 5CQLX 1SS9A 1JVDA 1XZ6A 1ZJPA 2VSIA 1PZYB 1H5TB 1H5SD 1GA8A 1VH1A 1ZI4A 3SPTA 5C3AA 4FREA 3I0HA 1VZUA 2W0WA 4HOCA 4Y6UA 5C47A 5C4DA 4ZDQA 1WT0A 1HJJA 4G3PA 4FCUA 4Y6NA 3V90A 4EE3A 2AECA 2Y4MA 1YP3A 3LW6A 4LW3A 1W55A 3JUJA 2OI7A 2Z86A 1GX4A 3SXAA 3RSBA 3FOQA 1H7QA 2ZU9A 2O1HA 4FCEA 2BO8A 5CMGX 2Y4JA 1PZTA 5CQNX 4KC4A 2VXLA 1FOAA 1V84A 2JCOA 1OQMB 4Y9XA 1R7UA 3FWWA 3TZTA 1NF5B 1TVYA 5AJNA 2I5EA 2Y7AA 3USRA 3R3IA 2XMEA 4Y7FA 2X60A 4FRQA 4LW6A 1G23A 3O3PA 4D11A 4MYBA 2P72A 4Y64A 2VS5A 3POLA 3NGWA 3CKQA 2VSHA 5FYEA 1VGZA 4DE7A 1VGWA 2V0LA 2YQJA 3V0LA 3U2UA 4B2WA 1YROB 4KNXA 3OH3A 3Q80A 4P00A 1GQCA 2RIZA 4P02A 4EVWA 2D7RA 3OH4A 3JUKA 3OGZA 2Q4JA 1MP5A 4CJCA 1G1LA 1ZDFA 1H4CA 1WT3A 3PKQA 4M2BA 4AYJA 4KT7A 2RIYA 1INIA 4FQWA 1ZCTA 2XWMA 2V0JA 1MP3A 4HO8A 4L41C 4FRMA 1H5SC 3BCVA 2YESA 3CU0A 5C8RA 5CQMX 3R2WA 3OKRA 1VM8A 3SXDA 1JV1A 3RMVA 3V0QA 1FO8A 4FROA 1FGXA 1VGTA 3CKNA 2WEEA 5C4EA 3N9WA 1R7XA 1ON6A 2JCKA 5J49A 4HO2A 1H7GA 2Z87A 1R7VA 5AJOA 2FY7A 4E1KA 3SXCA 5CMFX 2A8WA 2WVLA 4HO0A 4MNDA 5C3DA 2WVKA 4KQLA 3OC9A 3K8EA 4EE5A 3U0XA 2XMHA 2ZU8A 4XWIA 3I0KA 4Y7GA 1FZWA 1WT1A 4HO3A 2Y6PA 1OMZA 4G3SA 4M2AA 1HJLA 5C1HA 4CJBA 4R7PA 5BXCA 2O1FA 2AGDA 2WE9A 3T7OA 2ICXA 5CQOA 1R7YA 4HO9A 4EEAA 4YS8A 1R81A 4IRPA 4M28A 1ZJ0A 4HG6A 4KNRA 3I0LA 1VZTA 2VS3A 2P6WA 2V0KA 4AYLA 1QWJA 2ZU7A 4EEOA 1H7EA 1FWYA 2YQCA 4HO6A 5I1FA 2P73A 1ZHJA 1VPAA 3EE5A 2FYBA 4C2SA 1GWWA 2AM5A 4HO5A 3V0NA 5C4FA 1NKHB 1G2VA 4IRQA 4FRAA 1G0RA 1LZ0A 1O23B 1JYLA 1VICA 2V0IA 4D11C 2QGIA 2YC3A 4HCQA 2RJ8A 3I0DA 2BO7A 4Y62A 5C1GA 1LL2A 3D5NA 3I0JA 5L6VA 1JVGA 1S4OA 3U2WA 4FRLA 3ZGGA 1S4NA 1LZ7A 4KC1A 1I52A 3DUVA 3I0CA 5CMIA 5AJPA 1YP2A 5EIYA 4EEMA 5CMHA 3BRKX 1ZJOA 3V0OA 1H7TA 4KRVA 2Y4KA 1HV9A 3V0PA 4UEGA 1H5TA 4HO4A 3SX5A 4AC3A 4G3QA 1HM8A 1H5SB 1ZJ3A 2RIXA 3V91A 4Y7TA 2AM3A 4B4GA
chains in the Genus database with same CATH superfamily
1H5RB 3I0EA 4AAWA 3CKOA 3OAMA 3ZF8A 1FGGA 1H4EA 1HM0A 2PX7A 3I0IX 4DECA 3SXEA 2W0VA 1VH3A 2PGYA 2VXMA 1ZI3A 2YQSA 1MC3A 4NAKA 5C4CA 4ASYA 2AE7A 4FRPA 1EZIA 4FRBA 1NQIB 2RJ5A 4EE4A 1EYRA 3T7MA 3E25A 4K6RA 4FRDA 2FYAA 2JCJA 1LL0A 1H3MA 5C38A 2I7BA 2OI5A 3IOIA 3T7NA 1YP4A 2GGQA 3U2TA 1V82A 2AM4A 1FR9A 1FR8A 2VD4A 4NALA 1TW1A 1ZCYA 5CQPA 3OH0A 3OH2A 3OH1A 2FYDB 1R82A 3CKVA 2X65A 4J18A 4NANA 1LZIA 1ZIZA 1LZJA 3F1YA 4ASJA 1ZDGA 4JD0A 3IOJA 1MP4A 1H7LA 3ZLKA 5L6SA 1R80A 2A8UA 2Y4LA 2WAWA 2FYCB 2I5KA 2GGOA 5D92A 3E26A 3IOHA 1H7FA 3CKJA 3DK5A 4JISA 5C4BA 1W77A 5C3BA 5EJ1A 1VZXA 1O7OA 3KIAA 1TW5A 2V0HA 1KWSA 4G87A 5FU0A 4CVHA 5C48A 2JCLA 3SX8A 3SXGA 5FU8A 4B4BA 1LVWA 2AESA 2O1GA 2YCMA 1E5KA 3I0GA 1H7HA 3ZGFA 3D8VA 2OI6A 1GWVA 4FRHA 2UX8A 2ICYA 3USQA 2RJ6A 3JTJA 4CJ8A 5D91A 4ECMA 2VFZA 1VGUA 4M4KA 1JYKA 2QH5A 4DDZA 2APCA 1H4DA 4FIXA 4KPXA 4B3UA 1G97A 3V0MA 4D48A 1OMXA 1G95A 1K4VA 2RJ7A 1QG8A 3SX7A 1NWGB 1NHEB 4KC2A 1NMMB 4KPZA 1LL3A 2C0NA 4EEGA 2D0JA 2BO4A 3ST8A 4NAIA 3RMWA 1IINA 5DDTA 2E8BA 1W57A 2WVMA 3PNNA 4Q7CA 1Z90A 1QGSA 1FXJA 1G9RA 1QGQA 1ZCUA 4Y63A 4BQHA 5JQQA 1G93A 3TQDA 3U2XA 2AH9A 1TZFA 2X5ZA 3DJ4A 4Y7UA 1ZJ2A 1R7TA 2FFVA 1V83A 5C49A 2E3DA 1WT2A 2PGVA 1HM9A 3I0FA 4B4MA 2RJ0A 4B42A 5C36A 2MZBA 3SXBA 1O0RA 1FRWA 3F1CA 5IFYA 2YC5A 4Y7VA 2RJ9A 2VS4A 1WSZA 1G3LA 1XHBA 3SX3A 1IIMA 1O7QA 5DDVA 3V8ZA 5CMJA 1FXOA 5FTVA 2YQHA 3GUEA 4ARWA 3CGXA 2RJ1A 2CU2A 2RITA 5FTSA 1WVCA 5HS2A 2QKXA 5FV9A 5IDTA 1JV3A 2BO6A 1ZI5A 2WGZA 3QVBA 3U2VA 1S4PA 4B2XA 1GX0A 4GBPA 1FG5N 2OEGA 3U0YA 2FFUA 5IDSA 3HL3A 3Q7UA 5EJZA 2NXVA 4B5BA 2OEFA 2X5SA 1GQ9A 3Q4SA 1ZCVA 3V8YA 1INJA 4D0ZA 1ZJ1A 4KXOA 1ZI1A 5FUHA 3K8DA 3PKPA 2D7IA 4BMAA 1H5SA 2J0AA 3ZLLA 1G8OA 2RJ4A 4D0TA 1H5RA 3D98A 5C1LA 2XWLA 1ON8A 1FO9A 2XWNA 2DPWA 2PA4A 5CQLX 1SS9A 1JVDA 1XZ6A 1ZJPA 4MIXA 2VSIA 1PZYB 1H5TB 1H5SD 1GA8A 1VH1A 1ZI4A 3SPTA 5C3AA 4FREA 3I0HA 1VZUA 2W0WA 4HOCA 4Y6UA 5C47A 5C4DA 4ZDQA 1WT0A 1HJJA 4G3PA 4FCUA 4Y6NA 3V90A 4EE3A 2AECA 2Y4MA 1YP3A 3LW6A 4LW3A 1W55A 3JUJA 2OI7A 2Z86A 1GX4A 3SXAA 3RSBA 3FOQA 1H7QA 2ZU9A 2O1HA 4FCEA 2BO8A 5CMGX 2Y4JA 1PZTA 5CQNX 4KC4A 2VXLA 1FOAA 1V84A 2JCOA 1OQMB 4Y9XA 1R7UA 3FWWA 3TZTA 1NF5B 1TVYA 5AJNA 2I5EA 2Y7AA 3USRA 3R3IA 2XMEA 4Y7FA 2X60A 4FRQA 4LW6A 1G23A 3O3PA 4FIYA 4D11A 4MYBA 2P72A 4O6MA 2VS5A 4Y64A 3POLA 3NGWA 3CKQA 2VSHA 5FYEA 1VGZA 4DE7A 1VGWA 2V0LA 2YQJA 3V0LA 3U2UA 4B2WA 1YROB 4KNXA 3OH3A 3Q80A 4P00A 1GQCA 2RIZA 4P02A 4EVWA 2D7RA 3OH4A 3JUKA 3OGZA 2Q4JA 1MP5A 4CJCA 1G1LA 1ZDFA 1H4CA 1WT3A 3PKQA 4M2BA 4AYJA 4KT7A 2RIYA 1INIA 4FQWA 1ZCTA 2XWMA 2V0JA 1MP3A 4HO8A 4L41C 4FRMA 1H5SC 3BCVA 2YESA 3CU0A 5C8RA 5CQMX 3R2WA 3OKRA 1VM8A 3SXDA 1JV1A 3RMVA 3V0QA 1FO8A 4FROA 1FGXA 1VGTA 3CKNA 2WEEA 5C4EA 2J0BA 3N9WA 1R7XA 4O6NA 1ON6A 2JCKA 5J49A 4HO2A 1H7GA 2Z87A 1R7VA 5AJOA 2FY7A 4E1KA 3SXCA 5CMFX 2A8WA 2WVLA 4HO0A 4MNDA 5C3DA 2WVKA 4KQLA 3OC9A 3K8EA 4EE5A 3U0XA 2XMHA 2ZU8A 4XWIA 3I0KA 4Y7GA 1FZWA 1WT1A 4HO3A 2Y6PA 1OMZA 4G3SA 4M2AA 1HJLA 5C1HA 4CJBA 4R7PA 5BXCA 2O1FA 2AGDA 2WE9A 3T7OA 2ICXA 5CQOA 1R7YA 4HO9A 4EEAA 4YS8A 1R81A 4IRPA 4M28A 1ZJ0A 4HG6A 4KNRA 3I0LA 1VZTA 2VS3A 2P6WA 2V0KA 4AYLA 1QWJA 2ZU7A 4EEOA 1H7EA 1FWYA 2YQCA 4HO6A 5I1FA 2P73A 1ZHJA 1VPAA 3EE5A 2FYBA 4C2SA 1GWWA 2AM5A 4HO5A 3V0NA 5C4FA 1NKHB 1G2VA 4IRQA 4FRAA 1G0RA 1LZ0A 1O23B 1JYLA 1VICA 2V0IA 4D11C 2QGIA 2YC3A 4HCQA 2RJ8A 3I0DA 2BO7A 4Y62A 5C1GA 1LL2A 3D5NA 3I0JA 5L6VA 1JVGA 1S4OA 3U2WA 4FRLA 3ZGGA 1S4NA 1LZ7A 4KC1A 1I52A 3DUVA 3I0CA 5CMIA 5AJPA 1YP2A 5EIYA 4EEMA 5CMHA 3BRKX 1ZJOA 2VK9A 3V0OA 1H7TA 4KRVA 2Y4KA 1HV9A 3V0PA 4UEGA 1H5TA 4HO4A 3SX5A 4AC3A 4G3QA 1HM8A 1H5SB 1ZJ3A 2RIXA 3V91A 4Y7TA 2AM3A 4B4GA
chains in the Genus database with same CATH topology
1H5RB 3I0EA 4AAWA 3CKOA 3OAMA 3ZF8A 1FGGA 1H4EA 1HM0A 2PX7A 3I0IX 4DECA 3SXEA 2W0VA 1VH3A 2PGYA 2VXMA 1ZI3A 2YQSA 1MC3A 4NAKA 5C4CA 4ASYA 2AE7A 4FRPA 1EZIA 4FRBA 1NQIB 2RJ5A 4EE4A 1EYRA 3T7MA 3E25A 4K6RA 4FRDA 2FYAA 2JCJA 1LL0A 1H3MA 5C38A 2I7BA 2OI5A 3IOIA 3T7NA 1YP4A 2GGQA 3U2TA 1V82A 2AM4A 1FR9A 1FR8A 2VD4A 4NALA 1TW1A 1ZCYA 5CQPA 3OH0A 3OH2A 3OH1A 2FYDB 1R82A 3CKVA 2X65A 4J18A 4NANA 1LZIA 1ZIZA 1LZJA 3F1YA 4ASJA 1ZDGA 4JD0A 3IOJA 1MP4A 1H7LA 3ZLKA 5L6SA 1R80A 2A8UA 2Y4LA 2WAWA 2FYCB 2I5KA 2GGOA 5D92A 3E26A 3IOHA 1H7FA 3CKJA 3DK5A 4JISA 5C4BA 1W77A 5C3BA 5EJ1A 1VZXA 1O7OA 3KIAA 1TW5A 2V0HA 1KWSA 4G87A 5FU0A 4CVHA 5C48A 2JCLA 3SX8A 3SXGA 5FU8A 4B4BA 1LVWA 2AESA 2O1GA 2YCMA 1E5KA 3I0GA 1H7HA 3ZGFA 3D8VA 2OI6A 1GWVA 4FRHA 2UX8A 2ICYA 3USQA 2RJ6A 3JTJA 4CJ8A 5D91A 4ECMA 2VFZA 1VGUA 4M4KA 1JYKA 2QH5A 4DDZA 2APCA 1H4DA 4FIXA 4KPXA 4B3UA 1G97A 3V0MA 4D48A 1OMXA 1G95A 1K4VA 2RJ7A 1QG8A 3SX7A 1NWGB 1NHEB 4KC2A 1NMMB 4KPZA 1LL3A 2C0NA 4EEGA 2D0JA 2BO4A 3ST8A 4NAIA 3RMWA 1IINA 5DDTA 2E8BA 1W57A 2WVMA 3PNNA 4Q7CA 1Z90A 1QGSA 1FXJA 1G9RA 1QGQA 1ZCUA 4Y63A 4BQHA 5JQQA 1G93A 3TQDA 3U2XA 2AH9A 1TZFA 2X5ZA 3DJ4A 4Y7UA 1ZJ2A 1R7TA 2FFVA 1V83A 5C49A 2E3DA 1WT2A 2PGVA 1HM9A 3I0FA 4B4MA 2RJ0A 4B42A 5C36A 2MZBA 3SXBA 1O0RA 1FRWA 3F1CA 5IFYA 2YC5A 4Y7VA 2RJ9A 2VS4A 1WSZA 1G3LA 1XHBA 3SX3A 1IIMA 1O7QA 5DDVA 3V8ZA 5CMJA 1FXOA 5FTVA 2YQHA 3GUEA 4ARWA 3CGXA 2RJ1A 2CU2A 2RITA 5FTSA 1WVCA 5HS2A 2QKXA 5FV9A 5IDTA 1JV3A 2BO6A 1ZI5A 2WGZA 3QVBA 3U2VA 1S4PA 4B2XA 1GX0A 4GBPA 1FG5N 2OEGA 3U0YA 2FFUA 5IDSA 3HL3A 3Q7UA 5EJZA 2NXVA 4B5BA 2OEFA 2X5SA 1GQ9A 3Q4SA 1ZCVA 3V8YA 1INJA 4D0ZA 1ZJ1A 4KXOA 1ZI1A 5FUHA 3K8DA 3PKPA 2D7IA 4BMAA 1H5SA 2J0AA 3ZLLA 1G8OA 2RJ4A 4D0TA 1H5RA 3D98A 5C1LA 2XWLA 1ON8A 1FO9A 2XWNA 2DPWA 2PA4A 5CQLX 1SS9A 1JVDA 1XZ6A 1ZJPA 4MIXA 2VSIA 1PZYB 1H5TB 1H5SD 1GA8A 1VH1A 1ZI4A 3SPTA 5C3AA 4FREA 3I0HA 1VZUA 2W0WA 4HOCA 4Y6UA 5C47A 5C4DA 4ZDQA 1WT0A 1HJJA 4G3PA 4FCUA 4Y6NA 3V90A 4EE3A 2AECA 2Y4MA 1YP3A 3LW6A 4LW3A 1W55A 3JUJA 2OI7A 2Z86A 1GX4A 3SXAA 3RSBA 3FOQA 1H7QA 2ZU9A 2O1HA 4FCEA 2BO8A 5CMGX 2Y4JA 1PZTA 5CQNX 4KC4A 2VXLA 1FOAA 1V84A 2JCOA 1OQMB 4Y9XA 1R7UA 3FWWA 3TZTA 1NF5B 1TVYA 5AJNA 2I5EA 2Y7AA 3USRA 3R3IA 2XMEA 4Y7FA 2X60A 4FRQA 4LW6A 1G23A 3O3PA 4FIYA 4D11A 4MYBA 2P72A 4O6MA 2VS5A 4Y64A 3POLA 3NGWA 3CKQA 2VSHA 5FYEA 1VGZA 4DE7A 1VGWA 2V0LA 2YQJA 3V0LA 3U2UA 4B2WA 1YROB 4KNXA 3OH3A 3Q80A 4P00A 1GQCA 2RIZA 4P02A 4EVWA 2D7RA 3OH4A 3JUKA 3OGZA 2Q4JA 1MP5A 4CJCA 1G1LA 1ZDFA 1H4CA 1WT3A 3PKQA 4M2BA 4AYJA 4KT7A 2RIYA 1INIA 4FQWA 1ZCTA 2XWMA 2V0JA 1MP3A 4HO8A 4L41C 4FRMA 1H5SC 3BCVA 2YESA 3CU0A 5C8RA 5CQMX 3R2WA 3OKRA 1VM8A 3SXDA 1JV1A 3RMVA 3V0QA 1FO8A 4FROA 1FGXA 1VGTA 3CKNA 2WEEA 5C4EA 2J0BA 3N9WA 1R7XA 4O6NA 1ON6A 2JCKA 5J49A 4HO2A 1H7GA 2Z87A 1R7VA 5AJOA 2FY7A 4E1KA 3SXCA 5CMFX 2A8WA 2WVLA 4HO0A 4MNDA 5C3DA 2WVKA 4KQLA 3OC9A 3K8EA 4EE5A 3U0XA 2XMHA 2ZU8A 4XWIA 3I0KA 4Y7GA 1FZWA 1WT1A 4HO3A 2Y6PA 1OMZA 4G3SA 4M2AA 1HJLA 5C1HA 4CJBA 4R7PA 5BXCA 2O1FA 2AGDA 2WE9A 3T7OA 2ICXA 5CQOA 1R7YA 4HO9A 4EEAA 4YS8A 1R81A 4IRPA 4M28A 1ZJ0A 4HG6A 4KNRA 3I0LA 1VZTA 2VS3A 2P6WA 2V0KA 4AYLA 1QWJA 2ZU7A 4EEOA 1H7EA 1FWYA 2YQCA 4HO6A 5I1FA 2P73A 1ZHJA 1VPAA 3EE5A 2FYBA 4C2SA 1GWWA 2AM5A 4HO5A 3V0NA 5C4FA 1NKHB 1G2VA 4IRQA 4FRAA 1G0RA 1LZ0A 1O23B 1JYLA 1VICA 2V0IA 4D11C 2QGIA 2YC3A 4HCQA 2RJ8A 3I0DA 2BO7A 4Y62A 5C1GA 1LL2A 3D5NA 3I0JA 5L6VA 1JVGA 1S4OA 3U2WA 4FRLA 3ZGGA 1S4NA 1LZ7A 4KC1A 1I52A 3DUVA 3I0CA 5CMIA 5AJPA 1YP2A 5EIYA 4EEMA 5CMHA 3BRKX 1ZJOA 2VK9A 3V0OA 1H7TA 4KRVA 2Y4KA 1HV9A 3V0PA 4UEGA 1H5TA 4HO4A 3SX5A 4AC3A 4G3QA 1HM8A 1H5SB 1ZJ3A 2RIXA 3V91A 4Y7TA 2AM3A 4B4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5R B;  3I0E A;  4AAW A;  3CKO A;  3OAM A;  3ZF8 A;  1FGG A;  1H4E A;  1HM0 A;  2PX7 A;  3I0I X;  4DEC A;  3SXE A;  2W0V A;  1VH3 A;  2PGY A;  2VXM A;  1ZI3 A;  2YQS A;  1MC3 A;  4NAK A;  5C4C A;  4ASY A;  2AE7 A;  4FRP A;  1EZI A;  4FRB A;  1NQI B;  2RJ5 A;  4EE4 A;  1EYR A;  3T7M A;  3E25 A;  4K6R A;  4FRD A;  2FYA A;  2JCJ A;  1LL0 A;  1H3M A;  5C38 A;  2I7B A;  2OI5 A;  3IOI A;  3T7N A;  1YP4 A;  2GGQ A;  3U2T A;  1V82 A;  2AM4 A;  1FR9 A;  1FR8 A;  2VD4 A;  4NAL A;  1TW1 A;  1ZCY A;  5CQP A;  3OH0 A;  3OH2 A;  3OH1 A;  2FYD B;  1R82 A;  3CKV A;  2X65 A;  4J18 A;  4NAN A;  1LZI A;  1ZIZ A;  1LZJ A;  3F1Y A;  4ASJ A;  1ZDG A;  4JD0 A;  3IOJ A;  1MP4 A;  1H7L A;  3ZLK A;  5L6S A;  1R80 A;  2A8U A;  2Y4L A;  2WAW A;  2FYC B;  2I5K A;  2GGO A;  3E26 A;  3IOH A;  1H7F A;  3CKJ A;  3DK5 A;  4JIS A;  5C4B A;  1W77 A;  5C3B A;  5EJ1 A;  1VZX A;  1O7O A;  3KIA A;  1TW5 A;  2V0H A;  1KWS A;  4G87 A;  5FU0 A;  4CVH A;  5C48 A;  2JCL A;  3SX8 A;  3SXG A;  5FU8 A;  4B4B A;  1LVW A;  2AES A;  2O1G A;  2YCM A;  1E5K A;  3I0G A;  1H7H A;  3ZGF A;  3D8V A;  2OI6 A;  1GWV A;  4FRH A;  2UX8 A;  2ICY A;  3USQ A;  2RJ6 A;  3JTJ A;  4CJ8 A;  4ECM A;  2VFZ A;  1VGU A;  4M4K A;  1JYK A;  2QH5 A;  4DDZ A;  2APC A;  1H4D A;  4KPX A;  4B3U A;  1G97 A;  3V0M A;  4D48 A;  1OMX A;  1G95 A;  1K4V A;  2RJ7 A;  1QG8 A;  3SX7 A;  1NWG B;  1NHE B;  4KC2 A;  1NMM B;  4KPZ A;  1LL3 A;  4EEG A;  2D0J A;  2BO4 A;  3ST8 A;  4NAI A;  3RMW A;  1IIN A;  5DDT A;  2E8B A;  1W57 A;  2WVM A;  3PNN A;  1Z90 A;  1QGS A;  1FXJ A;  1G9R A;  1QGQ A;  1ZCU A;  4Y63 A;  4BQH A;  5JQQ A;  1G93 A;  3TQD A;  3U2X A;  2AH9 A;  1TZF A;  2X5Z A;  3DJ4 A;  4Y7U A;  1ZJ2 A;  1R7T A;  2FFV A;  1V83 A;  5C49 A;  2E3D A;  1WT2 A;  2PGV A;  1HM9 A;  3I0F A;  4B4M A;  2RJ0 A;  4B42 A;  5C36 A;  2MZB A;  3SXB A;  1O0R A;  1FRW A;  3F1C A;  5IFY A;  2YC5 A;  4Y7V A;  2RJ9 A;  2VS4 A;  1WSZ A;  1G3L A;  1XHB A;  3SX3 A;  1IIM A;  1O7Q A;  5DDV A;  3V8Z A;  5CMJ A;  1FXO A;  5FTV A;  2YQH A;  3GUE A;  4ARW A;  3CGX A;  2RJ1 A;  2CU2 A;  2RIT A;  5FTS A;  1WVC A;  5HS2 A;  2QKX A;  5FV9 A;  5IDT A;  1JV3 A;  2BO6 A;  1ZI5 A;  2WGZ A;  3QVB A;  3U2V A;  1S4P A;  4B2X A;  1GX0 A;  4GBP A;  1FG5 N;  2OEG A;  3U0Y A;  2FFU A;  5IDS A;  3HL3 A;  3Q7U A;  5EJZ A;  2NXV A;  4B5B A;  2OEF A;  2X5S A;  1GQ9 A;  3Q4S A;  1ZCV A;  3V8Y A;  1INJ A;  4D0Z A;  1ZJ1 A;  4KXO A;  1ZI1 A;  5FUH A;  3K8D A;  3PKP A;  2D7I A;  4BMA A;  1H5S A;  3ZLL A;  1G8O A;  2RJ4 A;  4D0T A;  1H5R A;  3D98 A;  5C1L A;  2XWL A;  1ON8 A;  1FO9 A;  2XWN A;  2DPW A;  2PA4 A;  5CQL X;  1SS9 A;  1JVD A;  1XZ6 A;  1ZJP A;  2VSI A;  1PZY B;  1H5T B;  1H5S D;  1GA8 A;  1VH1 A;  1ZI4 A;  3SPT A;  5C3A A;  4FRE A;  3I0H A;  1VZU A;  2W0W A;  4HOC A;  4Y6U A;  5C47 A;  5C4D A;  4ZDQ A;  1WT0 A;  1HJJ A;  4G3P A;  4FCU A;  4Y6N A;  3V90 A;  4EE3 A;  2AEC A;  2Y4M A;  1YP3 A;  3LW6 A;  4LW3 A;  1W55 A;  3JUJ A;  2OI7 A;  2Z86 A;  1GX4 A;  3SXA A;  3RSB A;  3FOQ A;  1H7Q A;  2ZU9 A;  2O1H A;  4FCE A;  2BO8 A;  5CMG X;  2Y4J A;  1PZT A;  5CQN X;  4KC4 A;  2VXL A;  1FOA A;  1V84 A;  2JCO A;  1OQM B;  4Y9X A;  1R7U A;  3FWW A;  3TZT A;  1NF5 B;  1TVY A;  5AJN A;  2I5E A;  2Y7A A;  3USR A;  3R3I A;  2XME A;  4Y7F A;  2X60 A;  4FRQ A;  4LW6 A;  1G23 A;  3O3P A;  4D11 A;  4MYB A;  2P72 A;  4Y64 A;  2VS5 A;  3POL A;  3NGW A;  3CKQ A;  2VSH A;  5FYE A;  1VGZ A;  4DE7 A;  1VGW A;  2V0L A;  2YQJ A;  3V0L A;  3U2U A;  4B2W A;  1YRO B;  4KNX A;  3OH3 A;  3Q80 A;  4P00 A;  1GQC A;  2RIZ A;  4P02 A;  4EVW A;  2D7R A;  3OH4 A;  3JUK A;  3OGZ A;  2Q4J A;  1MP5 A;  4CJC A;  1G1L A;  1ZDF A;  1H4C A;  1WT3 A;  3PKQ A;  4M2B A;  4AYJ A;  4KT7 A;  2RIY A;  1INI A;  4FQW A;  1ZCT A;  2XWM A;  2V0J A;  1MP3 A;  4HO8 A;  4L41 C;  4FRM A;  1H5S C;  3BCV A;  2YES A;  3CU0 A;  5C8R A;  5CQM X;  3R2W A;  3OKR A;  1VM8 A;  3SXD A;  1JV1 A;  3RMV A;  3V0Q A;  1FO8 A;  4FRO A;  1FGX A;  1VGT A;  3CKN A;  2WEE A;  5C4E A;  3N9W A;  1R7X A;  1ON6 A;  2JCK A;  5J49 A;  4HO2 A;  1H7G A;  2Z87 A;  1R7V A;  5AJO A;  2FY7 A;  4E1K A;  3SXC A;  5CMF X;  2A8W A;  2WVL A;  4HO0 A;  4MND A;  5C3D A;  2WVK A;  4KQL A;  3OC9 A;  3K8E A;  4EE5 A;  3U0X A;  2XMH A;  2ZU8 A;  4XWI A;  3I0K A;  4Y7G A;  1FZW A;  1WT1 A;  4HO3 A;  2Y6P A;  1OMZ A;  4G3S A;  4M2A A;  1HJL A;  5C1H A;  4CJB A;  4R7P A;  5BXC A;  2O1F A;  2AGD A;  2WE9 A;  3T7O A;  2ICX A;  5CQO A;  1R7Y A;  4HO9 A;  4EEA A;  4YS8 A;  1R81 A;  4IRP A;  4M28 A;  1ZJ0 A;  4HG6 A;  4KNR A;  3I0L A;  1VZT A;  2VS3 A;  2P6W A;  2V0K A;  4AYL A;  1QWJ A;  2ZU7 A;  4EEO A;  1H7E A;  1FWY A;  2YQC A;  4HO6 A;  5I1F A;  2P73 A;  1ZHJ A;  1VPA A;  3EE5 A;  2FYB A;  4C2S A;  1GWW A;  2AM5 A;  4HO5 A;  3V0N A;  5C4F A;  1NKH B;  1G2V A;  4IRQ A;  4FRA A;  1G0R A;  1LZ0 A;  1O23 B;  1JYL A;  1VIC A;  2V0I A;  4D11 C;  2QGI A;  2YC3 A;  4HCQ A;  2RJ8 A;  3I0D A;  2BO7 A;  4Y62 A;  5C1G A;  1LL2 A;  3D5N A;  3I0J A;  5L6V A;  1JVG A;  1S4O A;  3U2W A;  4FRL A;  3ZGG A;  1S4N A;  1LZ7 A;  4KC1 A;  1I52 A;  3DUV A;  3I0C A;  5CMI A;  5AJP A;  1YP2 A;  5EIY A;  4EEM A;  5CMH A;  3BRK X;  1ZJO A;  3V0O A;  1H7T A;  4KRV A;  2Y4K A;  1HV9 A;  3V0P A;  4UEG A;  1H5T A;  4HO4 A;  3SX5 A;  4AC3 A;  4G3Q A;  1HM8 A;  1H5S B;  1ZJ3 A;  2RIX A;  3V91 A;  4Y7T A;  2AM3 A;  4B4G A; 
#chains in the Genus database with same CATH topology
 1H5R B;  3I0E A;  4AAW A;  3CKO A;  3OAM A;  3ZF8 A;  1FGG A;  1H4E A;  1HM0 A;  2PX7 A;  3I0I X;  4DEC A;  3SXE A;  2W0V A;  1VH3 A;  2PGY A;  2VXM A;  1ZI3 A;  2YQS A;  1MC3 A;  4NAK A;  5C4C A;  4ASY A;  2AE7 A;  4FRP A;  1EZI A;  4FRB A;  1NQI B;  2RJ5 A;  4EE4 A;  1EYR A;  3T7M A;  3E25 A;  4K6R A;  4FRD A;  2FYA A;  2JCJ A;  1LL0 A;  1H3M A;  5C38 A;  2I7B A;  2OI5 A;  3IOI A;  3T7N A;  1YP4 A;  2GGQ A;  3U2T A;  1V82 A;  2AM4 A;  1FR9 A;  1FR8 A;  2VD4 A;  4NAL A;  1TW1 A;  1ZCY A;  5CQP A;  3OH0 A;  3OH2 A;  3OH1 A;  2FYD B;  1R82 A;  3CKV A;  2X65 A;  4J18 A;  4NAN A;  1LZI A;  1ZIZ A;  1LZJ A;  3F1Y A;  4ASJ A;  1ZDG A;  4JD0 A;  3IOJ A;  1MP4 A;  1H7L A;  3ZLK A;  5L6S A;  1R80 A;  2A8U A;  2Y4L A;  2WAW A;  2FYC B;  2I5K A;  2GGO A;  5D92 A;  3E26 A;  3IOH A;  1H7F A;  3CKJ A;  3DK5 A;  4JIS A;  5C4B A;  1W77 A;  5C3B A;  5EJ1 A;  1VZX A;  1O7O A;  3KIA A;  1TW5 A;  2V0H A;  1KWS A;  4G87 A;  5FU0 A;  4CVH A;  5C48 A;  2JCL A;  3SX8 A;  3SXG A;  5FU8 A;  4B4B A;  1LVW A;  2AES A;  2O1G A;  2YCM A;  1E5K A;  3I0G A;  1H7H A;  3ZGF A;  3D8V A;  2OI6 A;  1GWV A;  4FRH A;  2UX8 A;  2ICY A;  3USQ A;  2RJ6 A;  3JTJ A;  4CJ8 A;  5D91 A;  4ECM A;  2VFZ A;  1VGU A;  4M4K A;  1JYK A;  2QH5 A;  4DDZ A;  2APC A;  1H4D A;  4FIX A;  4KPX A;  4B3U A;  1G97 A;  3V0M A;  4D48 A;  1OMX A;  1G95 A;  1K4V A;  2RJ7 A;  1QG8 A;  3SX7 A;  1NWG B;  1NHE B;  4KC2 A;  1NMM B;  4KPZ A;  1LL3 A;  2C0N A;  4EEG A;  2D0J A;  2BO4 A;  3ST8 A;  4NAI A;  3RMW A;  1IIN A;  5DDT A;  2E8B A;  1W57 A;  2WVM A;  3PNN A;  4Q7C A;  1Z90 A;  1QGS A;  1FXJ A;  1G9R A;  1QGQ A;  1ZCU A;  4Y63 A;  4BQH A;  5JQQ A;  1G93 A;  3TQD A;  3U2X A;  2AH9 A;  1TZF A;  2X5Z A;  3DJ4 A;  4Y7U A;  1ZJ2 A;  1R7T A;  2FFV A;  1V83 A;  5C49 A;  2E3D A;  1WT2 A;  2PGV A;  1HM9 A;  3I0F A;  4B4M A;  2RJ0 A;  4B42 A;  5C36 A;  2MZB A;  3SXB A;  1O0R A;  1FRW A;  3F1C A;  5IFY A;  2YC5 A;  4Y7V A;  2RJ9 A;  2VS4 A;  1WSZ A;  1G3L A;  1XHB A;  3SX3 A;  1IIM A;  1O7Q A;  5DDV A;  3V8Z A;  5CMJ A;  1FXO A;  5FTV A;  2YQH A;  3GUE A;  4ARW A;  3CGX A;  2RJ1 A;  2CU2 A;  2RIT A;  5FTS A;  1WVC A;  5HS2 A;  2QKX A;  5FV9 A;  5IDT A;  1JV3 A;  2BO6 A;  1ZI5 A;  2WGZ A;  3QVB A;  3U2V A;  1S4P A;  4B2X A;  1GX0 A;  4GBP A;  1FG5 N;  2OEG A;  3U0Y A;  2FFU A;  5IDS A;  3HL3 A;  3Q7U A;  5EJZ A;  2NXV A;  4B5B A;  2OEF A;  2X5S A;  1GQ9 A;  3Q4S A;  1ZCV A;  3V8Y A;  1INJ A;  4D0Z A;  1ZJ1 A;  4KXO A;  1ZI1 A;  5FUH A;  3K8D A;  3PKP A;  2D7I A;  4BMA A;  1H5S A;  2J0A A;  3ZLL A;  1G8O A;  2RJ4 A;  4D0T A;  1H5R A;  3D98 A;  5C1L A;  2XWL A;  1ON8 A;  1FO9 A;  2XWN A;  2DPW A;  2PA4 A;  5CQL X;  1SS9 A;  1JVD A;  1XZ6 A;  1ZJP A;  4MIX A;  2VSI A;  1PZY B;  1H5T B;  1H5S D;  1GA8 A;  1VH1 A;  1ZI4 A;  3SPT A;  5C3A A;  4FRE A;  3I0H A;  1VZU A;  2W0W A;  4HOC A;  4Y6U A;  5C47 A;  5C4D A;  4ZDQ A;  1WT0 A;  1HJJ A;  4G3P A;  4FCU A;  4Y6N A;  3V90 A;  4EE3 A;  2AEC A;  2Y4M A;  1YP3 A;  3LW6 A;  4LW3 A;  1W55 A;  3JUJ A;  2OI7 A;  2Z86 A;  1GX4 A;  3SXA A;  3RSB A;  3FOQ A;  1H7Q A;  2ZU9 A;  2O1H A;  4FCE A;  2BO8 A;  5CMG X;  2Y4J A;  1PZT A;  5CQN X;  4KC4 A;  2VXL A;  1FOA A;  1V84 A;  2JCO A;  1OQM B;  4Y9X A;  1R7U A;  3FWW A;  3TZT A;  1NF5 B;  1TVY A;  5AJN A;  2I5E A;  2Y7A A;  3USR A;  3R3I A;  2XME A;  4Y7F A;  2X60 A;  4FRQ A;  4LW6 A;  1G23 A;  3O3P A;  4FIY A;  4D11 A;  4MYB A;  2P72 A;  4O6M A;  2VS5 A;  4Y64 A;  3POL A;  3NGW A;  3CKQ A;  2VSH A;  5FYE A;  1VGZ A;  4DE7 A;  1VGW A;  2V0L A;  2YQJ A;  3V0L A;  3U2U A;  4B2W A;  1YRO B;  4KNX A;  3OH3 A;  3Q80 A;  4P00 A;  1GQC A;  2RIZ A;  4P02 A;  4EVW A;  2D7R A;  3OH4 A;  3JUK A;  3OGZ A;  2Q4J A;  1MP5 A;  4CJC A;  1G1L A;  1ZDF A;  1H4C A;  1WT3 A;  3PKQ A;  4M2B A;  4AYJ A;  4KT7 A;  2RIY A;  1INI A;  4FQW A;  1ZCT A;  2XWM A;  2V0J A;  1MP3 A;  4HO8 A;  4L41 C;  4FRM A;  1H5S C;  3BCV A;  2YES A;  3CU0 A;  5C8R A;  5CQM X;  3R2W A;  3OKR A;  1VM8 A;  3SXD A;  1JV1 A;  3RMV A;  3V0Q A;  1FO8 A;  4FRO A;  1FGX A;  1VGT A;  3CKN A;  2WEE A;  5C4E A;  2J0B A;  3N9W A;  1R7X A;  4O6N A;  1ON6 A;  2JCK A;  5J49 A;  4HO2 A;  1H7G A;  2Z87 A;  1R7V A;  5AJO A;  2FY7 A;  4E1K A;  3SXC A;  5CMF X;  2A8W A;  2WVL A;  4HO0 A;  4MND A;  5C3D A;  2WVK A;  4KQL A;  3OC9 A;  3K8E A;  4EE5 A;  3U0X A;  2XMH A;  2ZU8 A;  4XWI A;  3I0K A;  4Y7G A;  1FZW A;  1WT1 A;  4HO3 A;  2Y6P A;  1OMZ A;  4G3S A;  4M2A A;  1HJL A;  5C1H A;  4CJB A;  4R7P A;  5BXC A;  2O1F A;  2AGD A;  2WE9 A;  3T7O A;  2ICX A;  5CQO A;  1R7Y A;  4HO9 A;  4EEA A;  4YS8 A;  1R81 A;  4IRP A;  4M28 A;  1ZJ0 A;  4HG6 A;  4KNR A;  3I0L A;  1VZT A;  2VS3 A;  2P6W A;  2V0K A;  4AYL A;  1QWJ A;  2ZU7 A;  4EEO A;  1H7E A;  1FWY A;  2YQC A;  4HO6 A;  5I1F A;  2P73 A;  1ZHJ A;  1VPA A;  3EE5 A;  2FYB A;  4C2S A;  1GWW A;  2AM5 A;  4HO5 A;  3V0N A;  5C4F A;  1NKH B;  1G2V A;  4IRQ A;  4FRA A;  1G0R A;  1LZ0 A;  1O23 B;  1JYL A;  1VIC A;  2V0I A;  4D11 C;  2QGI A;  2YC3 A;  4HCQ A;  2RJ8 A;  3I0D A;  2BO7 A;  4Y62 A;  5C1G A;  1LL2 A;  3D5N A;  3I0J A;  5L6V A;  1JVG A;  1S4O A;  3U2W A;  4FRL A;  3ZGG A;  1S4N A;  1LZ7 A;  4KC1 A;  1I52 A;  3DUV A;  3I0C A;  5CMI A;  5AJP A;  1YP2 A;  5EIY A;  4EEM A;  5CMH A;  3BRK X;  1ZJO A;  2VK9 A;  3V0O A;  1H7T A;  4KRV A;  2Y4K A;  1HV9 A;  3V0P A;  4UEG A;  1H5T A;  4HO4 A;  3SX5 A;  4AC3 A;  4G3Q A;  1HM8 A;  1H5S B;  1ZJ3 A;  2RIX A;  3V91 A;  4Y7T A;  2AM3 A;  4B4G A; 
#chains in the Genus database with same CATH homology
 1H5R B;  3I0E A;  4AAW A;  3CKO A;  3OAM A;  3ZF8 A;  1FGG A;  1H4E A;  1HM0 A;  2PX7 A;  3I0I X;  4DEC A;  3SXE A;  2W0V A;  1VH3 A;  2PGY A;  2VXM A;  1ZI3 A;  2YQS A;  1MC3 A;  4NAK A;  5C4C A;  4ASY A;  2AE7 A;  4FRP A;  1EZI A;  4FRB A;  1NQI B;  2RJ5 A;  4EE4 A;  1EYR A;  3T7M A;  3E25 A;  4K6R A;  4FRD A;  2FYA A;  2JCJ A;  1LL0 A;  1H3M A;  5C38 A;  2I7B A;  2OI5 A;  3IOI A;  3T7N A;  1YP4 A;  2GGQ A;  3U2T A;  1V82 A;  2AM4 A;  1FR9 A;  1FR8 A;  2VD4 A;  4NAL A;  1TW1 A;  1ZCY A;  5CQP A;  3OH0 A;  3OH2 A;  3OH1 A;  2FYD B;  1R82 A;  3CKV A;  2X65 A;  4J18 A;  4NAN A;  1LZI A;  1ZIZ A;  1LZJ A;  3F1Y A;  4ASJ A;  1ZDG A;  4JD0 A;  3IOJ A;  1MP4 A;  1H7L A;  3ZLK A;  5L6S A;  1R80 A;  2A8U A;  2Y4L A;  2WAW A;  2FYC B;  2I5K A;  2GGO A;  5D92 A;  3E26 A;  3IOH A;  1H7F A;  3CKJ A;  3DK5 A;  4JIS A;  5C4B A;  1W77 A;  5C3B A;  5EJ1 A;  1VZX A;  1O7O A;  3KIA A;  1TW5 A;  2V0H A;  1KWS A;  4G87 A;  5FU0 A;  4CVH A;  5C48 A;  2JCL A;  3SX8 A;  3SXG A;  5FU8 A;  4B4B A;  1LVW A;  2AES A;  2O1G A;  2YCM A;  1E5K A;  3I0G A;  1H7H A;  3ZGF A;  3D8V A;  2OI6 A;  1GWV A;  4FRH A;  2UX8 A;  2ICY A;  3USQ A;  2RJ6 A;  3JTJ A;  4CJ8 A;  5D91 A;  4ECM A;  2VFZ A;  1VGU A;  4M4K A;  1JYK A;  2QH5 A;  4DDZ A;  2APC A;  1H4D A;  4FIX A;  4KPX A;  4B3U A;  1G97 A;  3V0M A;  4D48 A;  1OMX A;  1G95 A;  1K4V A;  2RJ7 A;  1QG8 A;  3SX7 A;  1NWG B;  1NHE B;  4KC2 A;  1NMM B;  4KPZ A;  1LL3 A;  2C0N A;  4EEG A;  2D0J A;  2BO4 A;  3ST8 A;  4NAI A;  3RMW A;  1IIN A;  5DDT A;  2E8B A;  1W57 A;  2WVM A;  3PNN A;  4Q7C A;  1Z90 A;  1QGS A;  1FXJ A;  1G9R A;  1QGQ A;  1ZCU A;  4Y63 A;  4BQH A;  5JQQ A;  1G93 A;  3TQD A;  3U2X A;  2AH9 A;  1TZF A;  2X5Z A;  3DJ4 A;  4Y7U A;  1ZJ2 A;  1R7T A;  2FFV A;  1V83 A;  5C49 A;  2E3D A;  1WT2 A;  2PGV A;  1HM9 A;  3I0F A;  4B4M A;  2RJ0 A;  4B42 A;  5C36 A;  2MZB A;  3SXB A;  1O0R A;  1FRW A;  3F1C A;  5IFY A;  2YC5 A;  4Y7V A;  2RJ9 A;  2VS4 A;  1WSZ A;  1G3L A;  1XHB A;  3SX3 A;  1IIM A;  1O7Q A;  5DDV A;  3V8Z A;  5CMJ A;  1FXO A;  5FTV A;  2YQH A;  3GUE A;  4ARW A;  3CGX A;  2RJ1 A;  2CU2 A;  2RIT A;  5FTS A;  1WVC A;  5HS2 A;  2QKX A;  5FV9 A;  5IDT A;  1JV3 A;  2BO6 A;  1ZI5 A;  2WGZ A;  3QVB A;  3U2V A;  1S4P A;  4B2X A;  1GX0 A;  4GBP A;  1FG5 N;  2OEG A;  3U0Y A;  2FFU A;  5IDS A;  3HL3 A;  3Q7U A;  5EJZ A;  2NXV A;  4B5B A;  2OEF A;  2X5S A;  1GQ9 A;  3Q4S A;  1ZCV A;  3V8Y A;  1INJ A;  4D0Z A;  1ZJ1 A;  4KXO A;  1ZI1 A;  5FUH A;  3K8D A;  3PKP A;  2D7I A;  4BMA A;  1H5S A;  2J0A A;  3ZLL A;  1G8O A;  2RJ4 A;  4D0T A;  1H5R A;  3D98 A;  5C1L A;  2XWL A;  1ON8 A;  1FO9 A;  2XWN A;  2DPW A;  2PA4 A;  5CQL X;  1SS9 A;  1JVD A;  1XZ6 A;  1ZJP A;  4MIX A;  2VSI A;  1PZY B;  1H5T B;  1H5S D;  1GA8 A;  1VH1 A;  1ZI4 A;  3SPT A;  5C3A A;  4FRE A;  3I0H A;  1VZU A;  2W0W A;  4HOC A;  4Y6U A;  5C47 A;  5C4D A;  4ZDQ A;  1WT0 A;  1HJJ A;  4G3P A;  4FCU A;  4Y6N A;  3V90 A;  4EE3 A;  2AEC A;  2Y4M A;  1YP3 A;  3LW6 A;  4LW3 A;  1W55 A;  3JUJ A;  2OI7 A;  2Z86 A;  1GX4 A;  3SXA A;  3RSB A;  3FOQ A;  1H7Q A;  2ZU9 A;  2O1H A;  4FCE A;  2BO8 A;  5CMG X;  2Y4J A;  1PZT A;  5CQN X;  4KC4 A;  2VXL A;  1FOA A;  1V84 A;  2JCO A;  1OQM B;  4Y9X A;  1R7U A;  3FWW A;  3TZT A;  1NF5 B;  1TVY A;  5AJN A;  2I5E A;  2Y7A A;  3USR A;  3R3I A;  2XME A;  4Y7F A;  2X60 A;  4FRQ A;  4LW6 A;  1G23 A;  3O3P A;  4FIY A;  4D11 A;  4MYB A;  2P72 A;  4O6M A;  2VS5 A;  4Y64 A;  3POL A;  3NGW A;  3CKQ A;  2VSH A;  5FYE A;  1VGZ A;  4DE7 A;  1VGW A;  2V0L A;  2YQJ A;  3V0L A;  3U2U A;  4B2W A;  1YRO B;  4KNX A;  3OH3 A;  3Q80 A;  4P00 A;  1GQC A;  2RIZ A;  4P02 A;  4EVW A;  2D7R A;  3OH4 A;  3JUK A;  3OGZ A;  2Q4J A;  1MP5 A;  4CJC A;  1G1L A;  1ZDF A;  1H4C A;  1WT3 A;  3PKQ A;  4M2B A;  4AYJ A;  4KT7 A;  2RIY A;  1INI A;  4FQW A;  1ZCT A;  2XWM A;  2V0J A;  1MP3 A;  4HO8 A;  4L41 C;  4FRM A;  1H5S C;  3BCV A;  2YES A;  3CU0 A;  5C8R A;  5CQM X;  3R2W A;  3OKR A;  1VM8 A;  3SXD A;  1JV1 A;  3RMV A;  3V0Q A;  1FO8 A;  4FRO A;  1FGX A;  1VGT A;  3CKN A;  2WEE A;  5C4E A;  2J0B A;  3N9W A;  1R7X A;  4O6N A;  1ON6 A;  2JCK A;  5J49 A;  4HO2 A;  1H7G A;  2Z87 A;  1R7V A;  5AJO A;  2FY7 A;  4E1K A;  3SXC A;  5CMF X;  2A8W A;  2WVL A;  4HO0 A;  4MND A;  5C3D A;  2WVK A;  4KQL A;  3OC9 A;  3K8E A;  4EE5 A;  3U0X A;  2XMH A;  2ZU8 A;  4XWI A;  3I0K A;  4Y7G A;  1FZW A;  1WT1 A;  4HO3 A;  2Y6P A;  1OMZ A;  4G3S A;  4M2A A;  1HJL A;  5C1H A;  4CJB A;  4R7P A;  5BXC A;  2O1F A;  2AGD A;  2WE9 A;  3T7O A;  2ICX A;  5CQO A;  1R7Y A;  4HO9 A;  4EEA A;  4YS8 A;  1R81 A;  4IRP A;  4M28 A;  1ZJ0 A;  4HG6 A;  4KNR A;  3I0L A;  1VZT A;  2VS3 A;  2P6W A;  2V0K A;  4AYL A;  1QWJ A;  2ZU7 A;  4EEO A;  1H7E A;  1FWY A;  2YQC A;  4HO6 A;  5I1F A;  2P73 A;  1ZHJ A;  1VPA A;  3EE5 A;  2FYB A;  4C2S A;  1GWW A;  2AM5 A;  4HO5 A;  3V0N A;  5C4F A;  1NKH B;  1G2V A;  4IRQ A;  4FRA A;  1G0R A;  1LZ0 A;  1O23 B;  1JYL A;  1VIC A;  2V0I A;  4D11 C;  2QGI A;  2YC3 A;  4HCQ A;  2RJ8 A;  3I0D A;  2BO7 A;  4Y62 A;  5C1G A;  1LL2 A;  3D5N A;  3I0J A;  5L6V A;  1JVG A;  1S4O A;  3U2W A;  4FRL A;  3ZGG A;  1S4N A;  1LZ7 A;  4KC1 A;  1I52 A;  3DUV A;  3I0C A;  5CMI A;  5AJP A;  1YP2 A;  5EIY A;  4EEM A;  5CMH A;  3BRK X;  1ZJO A;  2VK9 A;  3V0O A;  1H7T A;  4KRV A;  2Y4K A;  1HV9 A;  3V0P A;  4UEG A;  1H5T A;  4HO4 A;  3SX5 A;  4AC3 A;  4G3Q A;  1HM8 A;  1H5S B;  1ZJ3 A;  2RIX A;  3V91 A;  4Y7T A;  2AM3 A;  4B4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...