5C4EA

Crystal structure of gtb + udp-glc + h-antigen acceptor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
292
structure length
290
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 290
sequence length 292
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c4eA00
5CQLX 2D7IA 1WT0A 2Y4MA 2VS4A 2WAWA 2PGYA 1WT3A 2OI6A 4B3UA 4DE7A 2O1FA 1FO8A 4D11C 4ZDQA 5EJ1A 1PZTA 4HOCA 2BO8A 3V0OA 4C2SA 4EVWA 2YQHA 3U2WA 1FGXA 1VICA 1MP4A 5EIYA 4AC3A 4HO9A 1ZI3A 1O0RA 2YESA 1W55A 3N9WA 1H7HA 1GX4A 3TZTA 3K8DA 1R82A 2RJ6A 4GBPA 4KPXA 1GWVA 1ZJ0A 2JCJA 5C4FA 2E8BA 1FZWA 1FRWA 3SXDA 4EEGA 1G3LA 1G8OA 1H5RB 2P6WA 3CKVA 2PGVA 3V0QA 4BMAA 1OMZA 4EEMA 5C4EA 2V0LA 3U2UA 1FXJA 5C1LA 1S4PA 5BXCA 4FQWA 3OGZA 4EEOA 1JYKA 3PNNA 2XWLA 3Q80A 3EE5A 3CU0A 3FWWA 4CVHA 1R7YA 3JUKA 1GA8A 3SXEA 4YS8A 1JVGA 4G3SA 4KNRA 2QGIA 5C4CA 2I7BA 4NAIA 4HCQA 5IDSA 1EYRA 2E3DA 2O1HA 3USQA 4ASJA 3I0KA 3V8ZA 4B4BA 2V0KA 2GGQA 1W57A 4Y63A 4Y7VA 4EE3A 4KC1A 3RSBA 2RITA 4HO4A 5FUHA 1ZJ3A 5CMFX 2GGOA 3OH4A 1TVYA 3OH1A 5EJZA 1H4CA 3SX3A 1ON6A 1NWGB 3I0EA 1VZXA 1MP5A 4D0TA 1R7TA 4FROA 2VXMA 1LVWA 3T7NA 4FREA 1JV3A 1INJA 1H5SD 1R81A 2FYAA 2JCLA 3BRKX 3E25A 3ST8A 3JTJA 1VZTA 4FRPA 4CJ8A 2BO7A 1NF5B 1H5RA 1H7FA 2AECA 3PKQA 4HG6A 1WT2A 5CMJA 1LL3A 2RJ0A 2VSIA 2RJ1A 4NALA 4Y6NA 5J49A 1HM9A 3I0JA 5IDTA 1QG8A 5C38A 5L6VA 1ZCYA 2XWMA 1G0RA 3JUJA 1ZJ2A 2UX8A 4G87A 3T7MA 3USRA 1G2VA 4Y7UA 4IRPA 3IOJA 4B4MA 4Y64A 4LW3A 1ZCVA 2A8WA 2RIXA 1NKHB 1YP2A 4KRVA 4G3PA 3V90A 2AH9A 4EEAA 1VGWA 4HO8A 2XMHA 4AYLA 2YQCA 1VGZA 1FXOA 2FYDB 3HL3A 4ASYA 2WGZA 2DPWA 2WVMA 4KNXA 2ZU7A 3I0FA 2XWNA 4FCUA 2FYCB 1WT1A 2Y6PA 3CKOA 3SX7A 3FOQA 1FR8A 4HO2A 3SXAA 1H5TA 1FOAA 2YC5A 3V8YA 4B42A 4FRQA 1GWWA 4KQLA 4KXOA 3NGWA 2P72A 4NAKA 5CMIA 1G1LA 1JVDA 1LL2A 5CQNX 2CU2A 1ZHJA 3OKRA 4UEGA 1G95A 3ZGFA 1H3MA 2PX7A 3D8VA 3V91A 2XMEA 1ZI1A 1EZIA 2BO4A 2V0HA 4D48A 3O3PA 2AE7A 5AJOA 5JQQA 5C8RA 3IOIA 5HS2A 3TQDA 3F1YA 1NQIB 5C1GA 1ZJ1A 2ICYA 2ZU9A 4HO5A 3K8EA 4ARWA 5CQMX 3I0DA 3U2VA 4KPZA 5CQOA 1ZCUA 2WE9A 2BO6A 2JCOA 1V83A 1VM8A 3V0MA 4BQHA 1IINA 5CMHA 1FR9A 2I5KA 5C4BA 4Y7TA 3DUVA 1S4OA 3CGXA 2FYBA 5DDVA 1ZDGA 1ZDFA 4NANA 1FGGA 3ZLLA 1JYLA 1H7TA 2O1GA 3E26A 3ZGGA 1H5TB 3I0IX 3SX8A 4P00A 1W77A 3LW6A 5C3AA 2I5EA 3DK5A 3R3IA 4AYJA 4FRLA 5CMGX 4Y62A 2Y4KA 2AESA 2MZBA 5AJNA 5C3DA 1V82A 3V0NA 1G97A 3OH2A 5L6SA 1H7QA 4M2AA 1LZIA 2Y4LA 1R7VA 2PA4A 2AM4A 5I1FA 1TZFA 3OAMA 5IFYA 4Y7GA 4DDZA 1H7EA 2Z87A 4B4GA 3Q7UA 1GQCA 1KWSA 2D7RA 4KC4A 1O7QA 1YP4A 4K6RA 4EE4A 3KIAA 2ICXA 1HM0A 3RMWA 1QGSA 5CQPA 5C4DA 4M28A 3DJ4A 2FFUA 1H7GA 3BCVA 4P02A 5FV9A 1H4DA 1HJLA 4E1KA 5C48A 3I0HA 3IOHA 3CKJA 4EE5A 1XZ6A 3D5NA 2YQSA 1VGTA 3CKQA 5FYEA 4FRBA 1G9RA 1H5SB 2W0VA 5C1HA 2QKXA 1INIA 1PZYB 1WVCA 3CKNA 1VGUA 4MNDA 3OH0A 2RIZA 4KT7A 2Y7AA 4M2BA 2RJ5A 3V0PA 5C47A 3I0GA 1JV1A 1R7XA 1LZ7A 1SS9A 4MYBA 1QWJA 1H7LA 5FTSA 3U2TA 2NXVA 1FWYA 4R7PA 1E5KA 1ZIZA 2FFVA 1HJJA 4FRDA 5C36A 4ECMA 2YCMA 1G23A 1IIMA 2WEEA 2APCA 4J18A 4LW6A 2RJ7A 4CJBA 1XHBA 1ZI4A 4Y9XA 2X5SA 1VH3A 1HM8A 4Y7FA 2OI7A 2AM3A 1H5SC 1MC3A 1S4NA 1ZI5A 4D0ZA 1LZJA 1R80A 1V84A 5DDTA 2V0JA 2YQJA 2VXLA 2OI5A 4D11A 1OMXA 4M4KA 3I0LA 2VS5A 2VSHA 1R7UA 2V0IA 4G3QA 2VFZA 5FTVA 1FG5N 3SXGA 2VD4A 3I0CA 1H5SA 1Z90A 3ZLKA 4AAWA 1NHEB 3F1CA 1TW1A 3RMVA 2Q4JA 1ON8A 3POLA 3SX5A 2X65A 3OH3A 4B2XA 1VPAA 2VS3A 1TW5A 1H4EA 2JCKA 3PKPA 1YROB 1K4VA 4KC2A 5FU0A 2WVLA 2ZU8A 3R2WA 3SXBA 2RJ8A 3ZF8A 3U2XA 1QGQA 3OC9A 2RIYA 4FRHA 2X5ZA 2WVKA 2Z86A 4JD0A 1VH1A 1FO9A 5FU8A 4HO6A 3U0XA 3SXCA 2OEFA 4HO3A 4Y6UA 4FRAA 2QH5A 3SPTA 2YC3A 4XWIA 1GQ9A 4FRMA 1WSZA 1LZ0A 2X60A 1NMMB 4DECA 1ZCTA 4CJCA 1VZUA 5C49A 4IRQA 4B2WA 4HO0A 3U0YA 2RJ4A 2W0WA 1ZJPA 1OQMB 2RJ9A 1O23B 3T7OA 1GX0A 1MP3A 4L41C 1LL0A 1I52A 3V0LA 2A8UA 4B5BA 1G93A 3GUEA 1HV9A 1YP3A 2AM5A 5C3BA 1ZJOA 3Q4SA 2OEGA 2D0JA 2AGDA 2P73A 2Y4JA 4JISA 4FCEA 2FY7A 3QVBA 1O7OA 5AJPA 3D98A
chains in the Genus database with same CATH superfamily
5CQLX 2D7IA 1WT0A 2Y4MA 2VS4A 2WAWA 2PGYA 1WT3A 2OI6A 4B3UA 4DE7A 2O1FA 1FO8A 4D11C 4ZDQA 5EJ1A 1PZTA 4FIXA 4HOCA 2BO8A 3V0OA 4C2SA 4EVWA 2YQHA 3U2WA 1FGXA 1VICA 1MP4A 5EIYA 4AC3A 4HO9A 1ZI3A 1O0RA 2YESA 1W55A 3N9WA 1H7HA 1GX4A 3TZTA 3K8DA 1R82A 2RJ6A 4Q7CA 4GBPA 4KPXA 1GWVA 1ZJ0A 2JCJA 5C4FA 2E8BA 1FZWA 1FRWA 3SXDA 4EEGA 1G3LA 1G8OA 1H5RB 2P6WA 3CKVA 2PGVA 3V0QA 4BMAA 1OMZA 4EEMA 5C4EA 2V0LA 3U2UA 1FXJA 4FIYA 5C1LA 1S4PA 5BXCA 4FQWA 3OGZA 4EEOA 1JYKA 3PNNA 2XWLA 3Q80A 3EE5A 3CU0A 3FWWA 4CVHA 1R7YA 3JUKA 1GA8A 3SXEA 4YS8A 1JVGA 4G3SA 4KNRA 2QGIA 5C4CA 2I7BA 4NAIA 4HCQA 5IDSA 1EYRA 2E3DA 2O1HA 3USQA 4ASJA 3I0KA 3V8ZA 4B4BA 2V0KA 2GGQA 1W57A 4Y63A 4Y7VA 4EE3A 4KC1A 3RSBA 2RITA 4HO4A 5FUHA 1ZJ3A 5CMFX 2GGOA 3OH4A 1TVYA 3OH1A 5EJZA 1H4CA 3SX3A 1ON6A 1NWGB 3I0EA 1VZXA 1MP5A 4D0TA 1R7TA 4FROA 2VXMA 1LVWA 3T7NA 4FREA 1JV3A 1INJA 1H5SD 1R81A 2FYAA 2JCLA 3BRKX 3E25A 3ST8A 3JTJA 1VZTA 4FRPA 4CJ8A 2BO7A 1NF5B 1H5RA 1H7FA 2AECA 3PKQA 4HG6A 1WT2A 5CMJA 1LL3A 2RJ0A 2VSIA 2RJ1A 4NALA 4Y6NA 5J49A 1HM9A 3I0JA 5IDTA 1QG8A 5C38A 5L6VA 2C0NA 1ZCYA 2XWMA 1G0RA 3JUJA 1ZJ2A 2UX8A 4G87A 3T7MA 3USRA 1G2VA 4Y7UA 4IRPA 3IOJA 4B4MA 4Y64A 4LW3A 1ZCVA 2A8WA 2RIXA 1NKHB 1YP2A 4KRVA 4G3PA 3V90A 2AH9A 4EEAA 1VGWA 4HO8A 2XMHA 4AYLA 2YQCA 1VGZA 1FXOA 2FYDB 3HL3A 4ASYA 2WGZA 2DPWA 2WVMA 4KNXA 2ZU7A 3I0FA 2XWNA 4FCUA 2FYCB 1WT1A 2Y6PA 3CKOA 3SX7A 3FOQA 1FR8A 4HO2A 3SXAA 1H5TA 1FOAA 2YC5A 3V8YA 4B42A 4FRQA 1GWWA 4KQLA 4KXOA 3NGWA 2P72A 4NAKA 5CMIA 1G1LA 1JVDA 1LL2A 5CQNX 2CU2A 1ZHJA 3OKRA 4UEGA 1G95A 3ZGFA 1H3MA 2PX7A 3D8VA 3V91A 2XMEA 1ZI1A 1EZIA 2BO4A 2V0HA 4D48A 3O3PA 4MIXA 2AE7A 5AJOA 5JQQA 5C8RA 3IOIA 5HS2A 3TQDA 3F1YA 1NQIB 5C1GA 1ZJ1A 2ICYA 2ZU9A 4HO5A 3K8EA 4ARWA 5CQMX 3I0DA 3U2VA 4KPZA 5CQOA 1ZCUA 2WE9A 2BO6A 2JCOA 1V83A 1VM8A 3V0MA 4BQHA 1IINA 5CMHA 1FR9A 2I5KA 5C4BA 4Y7TA 3DUVA 1S4OA 3CGXA 2FYBA 5DDVA 1ZDGA 1ZDFA 4NANA 1FGGA 3ZLLA 1JYLA 1H7TA 2O1GA 3E26A 3ZGGA 1H5TB 3I0IX 3SX8A 4P00A 1W77A 3LW6A 5C3AA 2I5EA 3DK5A 4O6MA 3R3IA 4AYJA 4FRLA 5CMGX 4Y62A 2Y4KA 2AESA 2MZBA 5AJNA 5C3DA 1V82A 3V0NA 1G97A 3OH2A 5L6SA 1H7QA 4M2AA 1LZIA 2Y4LA 1R7VA 2PA4A 2AM4A 5I1FA 1TZFA 3OAMA 5IFYA 4Y7GA 4DDZA 1H7EA 2Z87A 4B4GA 3Q7UA 1GQCA 1KWSA 2D7RA 4KC4A 1O7QA 1YP4A 4K6RA 4EE4A 3KIAA 2ICXA 1HM0A 3RMWA 1QGSA 5CQPA 5C4DA 4M28A 3DJ4A 2FFUA 1H7GA 3BCVA 4P02A 5FV9A 1H4DA 1HJLA 4E1KA 5C48A 3I0HA 3IOHA 3CKJA 4EE5A 1XZ6A 3D5NA 2YQSA 1VGTA 3CKQA 5FYEA 4FRBA 1G9RA 1H5SB 2W0VA 5C1HA 2QKXA 1INIA 1PZYB 1WVCA 3CKNA 1VGUA 4MNDA 3OH0A 2RIZA 4KT7A 2Y7AA 4M2BA 2RJ5A 3V0PA 5C47A 3I0GA 1JV1A 1R7XA 1LZ7A 1SS9A 4MYBA 1QWJA 1H7LA 5FTSA 3U2TA 2NXVA 1FWYA 4R7PA 1E5KA 1ZIZA 2FFVA 1HJJA 4FRDA 5C36A 4ECMA 2YCMA 1G23A 1IIMA 2WEEA 2APCA 4J18A 4LW6A 2VK9A 2RJ7A 4CJBA 1XHBA 1ZI4A 4Y9XA 2X5SA 1VH3A 1HM8A 4Y7FA 2OI7A 2AM3A 1H5SC 1MC3A 1S4NA 1ZI5A 4D0ZA 1LZJA 1R80A 1V84A 5DDTA 5D92A 2V0JA 2YQJA 2VXLA 2OI5A 4D11A 1OMXA 4M4KA 3I0LA 2VS5A 2VSHA 1R7UA 2V0IA 4G3QA 2VFZA 5FTVA 1FG5N 3SXGA 2VD4A 3I0CA 4O6NA 1H5SA 1Z90A 3ZLKA 4AAWA 1NHEB 3F1CA 1TW1A 3RMVA 2Q4JA 1ON8A 3POLA 2J0BA 3SX5A 2X65A 3OH3A 4B2XA 1VPAA 2VS3A 1TW5A 1H4EA 2JCKA 3PKPA 1YROB 1K4VA 4KC2A 5FU0A 2WVLA 2ZU8A 3R2WA 3SXBA 2RJ8A 3ZF8A 3U2XA 1QGQA 3OC9A 2RIYA 4FRHA 2X5ZA 2WVKA 2Z86A 4JD0A 1VH1A 1FO9A 5FU8A 4HO6A 3U0XA 3SXCA 2OEFA 4HO3A 4Y6UA 4FRAA 2QH5A 3SPTA 2YC3A 4XWIA 1GQ9A 4FRMA 1WSZA 1LZ0A 2X60A 1NMMB 4DECA 1ZCTA 4CJCA 1VZUA 5C49A 4IRQA 4B2WA 4HO0A 3U0YA 2RJ4A 2W0WA 1ZJPA 1OQMB 2RJ9A 1O23B 3T7OA 1GX0A 1MP3A 4L41C 1LL0A 1I52A 2J0AA 3V0LA 2A8UA 4B5BA 5D91A 1G93A 3GUEA 1HV9A 1YP3A 2AM5A 5C3BA 1ZJOA 3Q4SA 2OEGA 2D0JA 2AGDA 2P73A 2Y4JA 4JISA 4FCEA 2FY7A 3QVBA 1O7OA 5AJPA 3D98A
chains in the Genus database with same CATH topology
5CQLX 2D7IA 1WT0A 2Y4MA 2VS4A 2WAWA 2PGYA 1WT3A 2OI6A 4B3UA 4DE7A 2O1FA 1FO8A 4D11C 4ZDQA 5EJ1A 1PZTA 4FIXA 4HOCA 2BO8A 3V0OA 4C2SA 4EVWA 2YQHA 3U2WA 1FGXA 1VICA 1MP4A 5EIYA 4AC3A 4HO9A 1ZI3A 1O0RA 2YESA 1W55A 3N9WA 1H7HA 1GX4A 3TZTA 3K8DA 1R82A 2RJ6A 4Q7CA 4GBPA 4KPXA 1GWVA 1ZJ0A 2JCJA 5C4FA 2E8BA 1FZWA 1FRWA 3SXDA 4EEGA 1G3LA 1G8OA 1H5RB 2P6WA 3CKVA 2PGVA 3V0QA 4BMAA 1OMZA 4EEMA 5C4EA 2V0LA 3U2UA 1FXJA 4FIYA 5C1LA 1S4PA 5BXCA 4FQWA 3OGZA 4EEOA 1JYKA 3PNNA 2XWLA 3Q80A 3EE5A 3CU0A 3FWWA 4CVHA 1R7YA 3JUKA 1GA8A 3SXEA 4YS8A 1JVGA 4G3SA 4KNRA 2QGIA 5C4CA 2I7BA 4NAIA 4HCQA 5IDSA 1EYRA 2E3DA 2O1HA 3USQA 4ASJA 3I0KA 3V8ZA 4B4BA 2V0KA 2GGQA 1W57A 4Y63A 4Y7VA 4EE3A 4KC1A 3RSBA 2RITA 4HO4A 5FUHA 1ZJ3A 5CMFX 2GGOA 3OH4A 1TVYA 3OH1A 5EJZA 1H4CA 3SX3A 1ON6A 1NWGB 3I0EA 1VZXA 1MP5A 4D0TA 1R7TA 4FROA 2VXMA 1LVWA 3T7NA 4FREA 1JV3A 1INJA 1H5SD 1R81A 2FYAA 2JCLA 3BRKX 3E25A 3ST8A 3JTJA 1VZTA 4FRPA 4CJ8A 2BO7A 1NF5B 1H5RA 1H7FA 2AECA 3PKQA 4HG6A 1WT2A 5CMJA 1LL3A 2RJ0A 2VSIA 2RJ1A 4NALA 4Y6NA 5J49A 1HM9A 3I0JA 5IDTA 1QG8A 5C38A 5L6VA 2C0NA 1ZCYA 2XWMA 1G0RA 3JUJA 1ZJ2A 2UX8A 4G87A 3T7MA 3USRA 1G2VA 4Y7UA 4IRPA 3IOJA 4B4MA 4Y64A 4LW3A 1ZCVA 2A8WA 2RIXA 1NKHB 1YP2A 4KRVA 4G3PA 3V90A 2AH9A 4EEAA 1VGWA 4HO8A 2XMHA 4AYLA 2YQCA 1VGZA 1FXOA 2FYDB 3HL3A 4ASYA 2WGZA 2DPWA 2WVMA 4KNXA 2ZU7A 3I0FA 2XWNA 4FCUA 2FYCB 1WT1A 2Y6PA 3CKOA 3SX7A 3FOQA 1FR8A 4HO2A 3SXAA 1H5TA 1FOAA 2YC5A 3V8YA 4B42A 4FRQA 1GWWA 4KQLA 4KXOA 3NGWA 2P72A 4NAKA 5CMIA 1G1LA 1JVDA 1LL2A 5CQNX 2CU2A 1ZHJA 3OKRA 4UEGA 1G95A 3ZGFA 1H3MA 2PX7A 3D8VA 3V91A 2XMEA 1ZI1A 1EZIA 2BO4A 2V0HA 4D48A 3O3PA 4MIXA 2AE7A 5AJOA 5JQQA 5C8RA 3IOIA 5HS2A 3TQDA 3F1YA 1NQIB 5C1GA 1ZJ1A 2ICYA 2ZU9A 4HO5A 3K8EA 4ARWA 5CQMX 3I0DA 3U2VA 4KPZA 5CQOA 1ZCUA 2WE9A 2BO6A 2JCOA 1V83A 1VM8A 3V0MA 4BQHA 1IINA 5CMHA 1FR9A 2I5KA 5C4BA 4Y7TA 3DUVA 1S4OA 3CGXA 2FYBA 5DDVA 1ZDGA 1ZDFA 4NANA 1FGGA 3ZLLA 1JYLA 1H7TA 2O1GA 3E26A 3ZGGA 1H5TB 3I0IX 3SX8A 4P00A 1W77A 3LW6A 5C3AA 2I5EA 3DK5A 4O6MA 3R3IA 4AYJA 4FRLA 5CMGX 4Y62A 2Y4KA 2AESA 2MZBA 5AJNA 5C3DA 1V82A 3V0NA 1G97A 3OH2A 5L6SA 1H7QA 4M2AA 1LZIA 2Y4LA 1R7VA 2PA4A 2AM4A 5I1FA 1TZFA 3OAMA 5IFYA 4Y7GA 4DDZA 1H7EA 2Z87A 4B4GA 3Q7UA 1GQCA 1KWSA 2D7RA 4KC4A 1O7QA 1YP4A 4K6RA 4EE4A 3KIAA 2ICXA 1HM0A 3RMWA 1QGSA 5CQPA 5C4DA 4M28A 3DJ4A 2FFUA 1H7GA 3BCVA 4P02A 5FV9A 1H4DA 1HJLA 4E1KA 5C48A 3I0HA 3IOHA 3CKJA 4EE5A 1XZ6A 3D5NA 2YQSA 1VGTA 3CKQA 5FYEA 4FRBA 1G9RA 1H5SB 2W0VA 5C1HA 2QKXA 1INIA 1PZYB 1WVCA 3CKNA 1VGUA 4MNDA 3OH0A 2RIZA 4KT7A 2Y7AA 4M2BA 2RJ5A 3V0PA 5C47A 3I0GA 1JV1A 1R7XA 1LZ7A 1SS9A 4MYBA 1QWJA 1H7LA 5FTSA 3U2TA 2NXVA 1FWYA 4R7PA 1E5KA 1ZIZA 2FFVA 1HJJA 4FRDA 5C36A 4ECMA 2YCMA 1G23A 1IIMA 2WEEA 2APCA 4J18A 4LW6A 2VK9A 2RJ7A 4CJBA 1XHBA 1ZI4A 4Y9XA 2X5SA 1VH3A 1HM8A 4Y7FA 2OI7A 2AM3A 1H5SC 1MC3A 1S4NA 1ZI5A 4D0ZA 1LZJA 1R80A 1V84A 5DDTA 5D92A 2V0JA 2YQJA 2VXLA 2OI5A 4D11A 1OMXA 4M4KA 3I0LA 2VS5A 2VSHA 1R7UA 2V0IA 4G3QA 2VFZA 5FTVA 1FG5N 3SXGA 2VD4A 3I0CA 4O6NA 1H5SA 1Z90A 3ZLKA 4AAWA 1NHEB 3F1CA 1TW1A 3RMVA 2Q4JA 1ON8A 3POLA 2J0BA 3SX5A 2X65A 3OH3A 4B2XA 1VPAA 2VS3A 1TW5A 1H4EA 2JCKA 3PKPA 1YROB 1K4VA 4KC2A 5FU0A 2WVLA 2ZU8A 3R2WA 3SXBA 2RJ8A 3ZF8A 3U2XA 1QGQA 3OC9A 2RIYA 4FRHA 2X5ZA 2WVKA 2Z86A 4JD0A 1VH1A 1FO9A 5FU8A 4HO6A 3U0XA 3SXCA 2OEFA 4HO3A 4Y6UA 4FRAA 2QH5A 3SPTA 2YC3A 4XWIA 1GQ9A 4FRMA 1WSZA 1LZ0A 2X60A 1NMMB 4DECA 1ZCTA 4CJCA 1VZUA 5C49A 4IRQA 4B2WA 4HO0A 3U0YA 2RJ4A 2W0WA 1ZJPA 1OQMB 2RJ9A 1O23B 3T7OA 1GX0A 1MP3A 4L41C 1LL0A 1I52A 2J0AA 3V0LA 2A8UA 4B5BA 5D91A 1G93A 3GUEA 1HV9A 1YP3A 2AM5A 5C3BA 1ZJOA 3Q4SA 2OEGA 2D0JA 2AGDA 2P73A 2Y4JA 4JISA 4FCEA 2FY7A 3QVBA 1O7OA 5AJPA 3D98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQL X;  2D7I A;  1WT0 A;  2Y4M A;  2VS4 A;  2WAW A;  2PGY A;  1WT3 A;  2OI6 A;  4B3U A;  4DE7 A;  2O1F A;  1FO8 A;  4D11 C;  4ZDQ A;  5EJ1 A;  1PZT A;  4HOC A;  2BO8 A;  3V0O A;  4C2S A;  4EVW A;  2YQH A;  3U2W A;  1FGX A;  1VIC A;  1MP4 A;  5EIY A;  4AC3 A;  4HO9 A;  1ZI3 A;  1O0R A;  2YES A;  1W55 A;  3N9W A;  1H7H A;  1GX4 A;  3TZT A;  3K8D A;  1R82 A;  2RJ6 A;  4GBP A;  4KPX A;  1GWV A;  1ZJ0 A;  2JCJ A;  5C4F A;  2E8B A;  1FZW A;  1FRW A;  3SXD A;  4EEG A;  1G3L A;  1G8O A;  1H5R B;  2P6W A;  3CKV A;  2PGV A;  3V0Q A;  4BMA A;  1OMZ A;  4EEM A;  5C4E A;  2V0L A;  3U2U A;  1FXJ A;  5C1L A;  1S4P A;  5BXC A;  4FQW A;  3OGZ A;  4EEO A;  1JYK A;  3PNN A;  2XWL A;  3Q80 A;  3EE5 A;  3CU0 A;  3FWW A;  4CVH A;  1R7Y A;  3JUK A;  1GA8 A;  3SXE A;  4YS8 A;  1JVG A;  4G3S A;  4KNR A;  2QGI A;  5C4C A;  2I7B A;  4NAI A;  4HCQ A;  5IDS A;  1EYR A;  2E3D A;  2O1H A;  3USQ A;  4ASJ A;  3I0K A;  3V8Z A;  4B4B A;  2V0K A;  2GGQ A;  1W57 A;  4Y63 A;  4Y7V A;  4EE3 A;  4KC1 A;  3RSB A;  2RIT A;  4HO4 A;  5FUH A;  1ZJ3 A;  5CMF X;  2GGO A;  3OH4 A;  1TVY A;  3OH1 A;  5EJZ A;  1H4C A;  3SX3 A;  1ON6 A;  1NWG B;  3I0E A;  1VZX A;  1MP5 A;  4D0T A;  1R7T A;  4FRO A;  2VXM A;  1LVW A;  3T7N A;  4FRE A;  1JV3 A;  1INJ A;  1H5S D;  1R81 A;  2FYA A;  2JCL A;  3BRK X;  3E25 A;  3ST8 A;  3JTJ A;  1VZT A;  4FRP A;  4CJ8 A;  2BO7 A;  1NF5 B;  1H5R A;  1H7F A;  2AEC A;  3PKQ A;  4HG6 A;  1WT2 A;  5CMJ A;  1LL3 A;  2RJ0 A;  2VSI A;  2RJ1 A;  4NAL A;  4Y6N A;  5J49 A;  1HM9 A;  3I0J A;  5IDT A;  1QG8 A;  5C38 A;  5L6V A;  1ZCY A;  2XWM A;  1G0R A;  3JUJ A;  1ZJ2 A;  2UX8 A;  4G87 A;  3T7M A;  3USR A;  1G2V A;  4Y7U A;  4IRP A;  3IOJ A;  4B4M A;  4Y64 A;  4LW3 A;  1ZCV A;  2A8W A;  2RIX A;  1NKH B;  1YP2 A;  4KRV A;  4G3P A;  3V90 A;  2AH9 A;  4EEA A;  1VGW A;  4HO8 A;  2XMH A;  4AYL A;  2YQC A;  1VGZ A;  1FXO A;  2FYD B;  3HL3 A;  4ASY A;  2WGZ A;  2DPW A;  2WVM A;  4KNX A;  2ZU7 A;  3I0F A;  2XWN A;  4FCU A;  2FYC B;  1WT1 A;  2Y6P A;  3CKO A;  3SX7 A;  3FOQ A;  1FR8 A;  4HO2 A;  3SXA A;  1H5T A;  1FOA A;  2YC5 A;  3V8Y A;  4B42 A;  4FRQ A;  1GWW A;  4KQL A;  4KXO A;  3NGW A;  2P72 A;  4NAK A;  5CMI A;  1G1L A;  1JVD A;  1LL2 A;  5CQN X;  2CU2 A;  1ZHJ A;  3OKR A;  4UEG A;  1G95 A;  3ZGF A;  1H3M A;  2PX7 A;  3D8V A;  3V91 A;  2XME A;  1ZI1 A;  1EZI A;  2BO4 A;  2V0H A;  4D48 A;  3O3P A;  2AE7 A;  5AJO A;  5JQQ A;  5C8R A;  3IOI A;  5HS2 A;  3TQD A;  3F1Y A;  1NQI B;  5C1G A;  1ZJ1 A;  2ICY A;  2ZU9 A;  4HO5 A;  3K8E A;  4ARW A;  5CQM X;  3I0D A;  3U2V A;  4KPZ A;  5CQO A;  1ZCU A;  2WE9 A;  2BO6 A;  2JCO A;  1V83 A;  1VM8 A;  3V0M A;  4BQH A;  1IIN A;  5CMH A;  1FR9 A;  2I5K A;  5C4B A;  4Y7T A;  3DUV A;  1S4O A;  3CGX A;  2FYB A;  5DDV A;  1ZDG A;  1ZDF A;  4NAN A;  1FGG A;  3ZLL A;  1JYL A;  1H7T A;  2O1G A;  3E26 A;  3ZGG A;  1H5T B;  3I0I X;  3SX8 A;  4P00 A;  1W77 A;  3LW6 A;  5C3A A;  2I5E A;  3DK5 A;  3R3I A;  4AYJ A;  4FRL A;  5CMG X;  4Y62 A;  2Y4K A;  2AES A;  2MZB A;  5AJN A;  5C3D A;  1V82 A;  3V0N A;  1G97 A;  3OH2 A;  5L6S A;  1H7Q A;  4M2A A;  1LZI A;  2Y4L A;  1R7V A;  2PA4 A;  2AM4 A;  5I1F A;  1TZF A;  3OAM A;  5IFY A;  4Y7G A;  4DDZ A;  1H7E A;  2Z87 A;  4B4G A;  3Q7U A;  1GQC A;  1KWS A;  2D7R A;  4KC4 A;  1O7Q A;  1YP4 A;  4K6R A;  4EE4 A;  3KIA A;  2ICX A;  1HM0 A;  3RMW A;  1QGS A;  5CQP A;  5C4D A;  4M28 A;  3DJ4 A;  2FFU A;  1H7G A;  3BCV A;  4P02 A;  5FV9 A;  1H4D A;  1HJL A;  4E1K A;  5C48 A;  3I0H A;  3IOH A;  3CKJ A;  4EE5 A;  1XZ6 A;  3D5N A;  2YQS A;  1VGT A;  3CKQ A;  5FYE A;  4FRB A;  1G9R A;  1H5S B;  2W0V A;  5C1H A;  2QKX A;  1INI A;  1PZY B;  1WVC A;  3CKN A;  1VGU A;  4MND A;  3OH0 A;  2RIZ A;  4KT7 A;  2Y7A A;  4M2B A;  2RJ5 A;  3V0P A;  5C47 A;  3I0G A;  1JV1 A;  1R7X A;  1LZ7 A;  1SS9 A;  4MYB A;  1QWJ A;  1H7L A;  5FTS A;  3U2T A;  2NXV A;  1FWY A;  4R7P A;  1E5K A;  1ZIZ A;  2FFV A;  1HJJ A;  4FRD A;  5C36 A;  4ECM A;  2YCM A;  1G23 A;  1IIM A;  2WEE A;  2APC A;  4J18 A;  4LW6 A;  2RJ7 A;  4CJB A;  1XHB A;  1ZI4 A;  4Y9X A;  2X5S A;  1VH3 A;  1HM8 A;  4Y7F A;  2OI7 A;  2AM3 A;  1H5S C;  1MC3 A;  1S4N A;  1ZI5 A;  4D0Z A;  1LZJ A;  1R80 A;  1V84 A;  5DDT A;  2V0J A;  2YQJ A;  2VXL A;  2OI5 A;  4D11 A;  1OMX A;  4M4K A;  3I0L A;  2VS5 A;  2VSH A;  1R7U A;  2V0I A;  4G3Q A;  2VFZ A;  5FTV A;  1FG5 N;  3SXG A;  2VD4 A;  3I0C A;  1H5S A;  1Z90 A;  3ZLK A;  4AAW A;  1NHE B;  3F1C A;  1TW1 A;  3RMV A;  2Q4J A;  1ON8 A;  3POL A;  3SX5 A;  2X65 A;  3OH3 A;  4B2X A;  1VPA A;  2VS3 A;  1TW5 A;  1H4E A;  2JCK A;  3PKP A;  1YRO B;  1K4V A;  4KC2 A;  5FU0 A;  2WVL A;  2ZU8 A;  3R2W A;  3SXB A;  2RJ8 A;  3ZF8 A;  3U2X A;  1QGQ A;  3OC9 A;  2RIY A;  4FRH A;  2X5Z A;  2WVK A;  2Z86 A;  4JD0 A;  1VH1 A;  1FO9 A;  5FU8 A;  4HO6 A;  3U0X A;  3SXC A;  2OEF A;  4HO3 A;  4Y6U A;  4FRA A;  2QH5 A;  3SPT A;  2YC3 A;  4XWI A;  1GQ9 A;  4FRM A;  1WSZ A;  1LZ0 A;  2X60 A;  1NMM B;  4DEC A;  1ZCT A;  4CJC A;  1VZU A;  5C49 A;  4IRQ A;  4B2W A;  4HO0 A;  3U0Y A;  2RJ4 A;  2W0W A;  1ZJP A;  1OQM B;  2RJ9 A;  1O23 B;  3T7O A;  1GX0 A;  1MP3 A;  4L41 C;  1LL0 A;  1I52 A;  3V0L A;  2A8U A;  4B5B A;  1G93 A;  3GUE A;  1HV9 A;  1YP3 A;  2AM5 A;  5C3B A;  1ZJO A;  3Q4S A;  2OEG A;  2D0J A;  2AGD A;  2P73 A;  2Y4J A;  4JIS A;  4FCE A;  2FY7 A;  3QVB A;  1O7O A;  5AJP A;  3D98 A; 
#chains in the Genus database with same CATH topology
 5CQL X;  2D7I A;  1WT0 A;  2Y4M A;  2VS4 A;  2WAW A;  2PGY A;  1WT3 A;  2OI6 A;  4B3U A;  4DE7 A;  2O1F A;  1FO8 A;  4D11 C;  4ZDQ A;  5EJ1 A;  1PZT A;  4FIX A;  4HOC A;  2BO8 A;  3V0O A;  4C2S A;  4EVW A;  2YQH A;  3U2W A;  1FGX A;  1VIC A;  1MP4 A;  5EIY A;  4AC3 A;  4HO9 A;  1ZI3 A;  1O0R A;  2YES A;  1W55 A;  3N9W A;  1H7H A;  1GX4 A;  3TZT A;  3K8D A;  1R82 A;  2RJ6 A;  4Q7C A;  4GBP A;  4KPX A;  1GWV A;  1ZJ0 A;  2JCJ A;  5C4F A;  2E8B A;  1FZW A;  1FRW A;  3SXD A;  4EEG A;  1G3L A;  1G8O A;  1H5R B;  2P6W A;  3CKV A;  2PGV A;  3V0Q A;  4BMA A;  1OMZ A;  4EEM A;  5C4E A;  2V0L A;  3U2U A;  1FXJ A;  4FIY A;  5C1L A;  1S4P A;  5BXC A;  4FQW A;  3OGZ A;  4EEO A;  1JYK A;  3PNN A;  2XWL A;  3Q80 A;  3EE5 A;  3CU0 A;  3FWW A;  4CVH A;  1R7Y A;  3JUK A;  1GA8 A;  3SXE A;  4YS8 A;  1JVG A;  4G3S A;  4KNR A;  2QGI A;  5C4C A;  2I7B A;  4NAI A;  4HCQ A;  5IDS A;  1EYR A;  2E3D A;  2O1H A;  3USQ A;  4ASJ A;  3I0K A;  3V8Z A;  4B4B A;  2V0K A;  2GGQ A;  1W57 A;  4Y63 A;  4Y7V A;  4EE3 A;  4KC1 A;  3RSB A;  2RIT A;  4HO4 A;  5FUH A;  1ZJ3 A;  5CMF X;  2GGO A;  3OH4 A;  1TVY A;  3OH1 A;  5EJZ A;  1H4C A;  3SX3 A;  1ON6 A;  1NWG B;  3I0E A;  1VZX A;  1MP5 A;  4D0T A;  1R7T A;  4FRO A;  2VXM A;  1LVW A;  3T7N A;  4FRE A;  1JV3 A;  1INJ A;  1H5S D;  1R81 A;  2FYA A;  2JCL A;  3BRK X;  3E25 A;  3ST8 A;  3JTJ A;  1VZT A;  4FRP A;  4CJ8 A;  2BO7 A;  1NF5 B;  1H5R A;  1H7F A;  2AEC A;  3PKQ A;  4HG6 A;  1WT2 A;  5CMJ A;  1LL3 A;  2RJ0 A;  2VSI A;  2RJ1 A;  4NAL A;  4Y6N A;  5J49 A;  1HM9 A;  3I0J A;  5IDT A;  1QG8 A;  5C38 A;  5L6V A;  2C0N A;  1ZCY A;  2XWM A;  1G0R A;  3JUJ A;  1ZJ2 A;  2UX8 A;  4G87 A;  3T7M A;  3USR A;  1G2V A;  4Y7U A;  4IRP A;  3IOJ A;  4B4M A;  4Y64 A;  4LW3 A;  1ZCV A;  2A8W A;  2RIX A;  1NKH B;  1YP2 A;  4KRV A;  4G3P A;  3V90 A;  2AH9 A;  4EEA A;  1VGW A;  4HO8 A;  2XMH A;  4AYL A;  2YQC A;  1VGZ A;  1FXO A;  2FYD B;  3HL3 A;  4ASY A;  2WGZ A;  2DPW A;  2WVM A;  4KNX A;  2ZU7 A;  3I0F A;  2XWN A;  4FCU A;  2FYC B;  1WT1 A;  2Y6P A;  3CKO A;  3SX7 A;  3FOQ A;  1FR8 A;  4HO2 A;  3SXA A;  1H5T A;  1FOA A;  2YC5 A;  3V8Y A;  4B42 A;  4FRQ A;  1GWW A;  4KQL A;  4KXO A;  3NGW A;  2P72 A;  4NAK A;  5CMI A;  1G1L A;  1JVD A;  1LL2 A;  5CQN X;  2CU2 A;  1ZHJ A;  3OKR A;  4UEG A;  1G95 A;  3ZGF A;  1H3M A;  2PX7 A;  3D8V A;  3V91 A;  2XME A;  1ZI1 A;  1EZI A;  2BO4 A;  2V0H A;  4D48 A;  3O3P A;  4MIX A;  2AE7 A;  5AJO A;  5JQQ A;  5C8R A;  3IOI A;  5HS2 A;  3TQD A;  3F1Y A;  1NQI B;  5C1G A;  1ZJ1 A;  2ICY A;  2ZU9 A;  4HO5 A;  3K8E A;  4ARW A;  5CQM X;  3I0D A;  3U2V A;  4KPZ A;  5CQO A;  1ZCU A;  2WE9 A;  2BO6 A;  2JCO A;  1V83 A;  1VM8 A;  3V0M A;  4BQH A;  1IIN A;  5CMH A;  1FR9 A;  2I5K A;  5C4B A;  4Y7T A;  3DUV A;  1S4O A;  3CGX A;  2FYB A;  5DDV A;  1ZDG A;  1ZDF A;  4NAN A;  1FGG A;  3ZLL A;  1JYL A;  1H7T A;  2O1G A;  3E26 A;  3ZGG A;  1H5T B;  3I0I X;  3SX8 A;  4P00 A;  1W77 A;  3LW6 A;  5C3A A;  2I5E A;  3DK5 A;  4O6M A;  3R3I A;  4AYJ A;  4FRL A;  5CMG X;  4Y62 A;  2Y4K A;  2AES A;  2MZB A;  5AJN A;  5C3D A;  1V82 A;  3V0N A;  1G97 A;  3OH2 A;  5L6S A;  1H7Q A;  4M2A A;  1LZI A;  2Y4L A;  1R7V A;  2PA4 A;  2AM4 A;  5I1F A;  1TZF A;  3OAM A;  5IFY A;  4Y7G A;  4DDZ A;  1H7E A;  2Z87 A;  4B4G A;  3Q7U A;  1GQC A;  1KWS A;  2D7R A;  4KC4 A;  1O7Q A;  1YP4 A;  4K6R A;  4EE4 A;  3KIA A;  2ICX A;  1HM0 A;  3RMW A;  1QGS A;  5CQP A;  5C4D A;  4M28 A;  3DJ4 A;  2FFU A;  1H7G A;  3BCV A;  4P02 A;  5FV9 A;  1H4D A;  1HJL A;  4E1K A;  5C48 A;  3I0H A;  3IOH A;  3CKJ A;  4EE5 A;  1XZ6 A;  3D5N A;  2YQS A;  1VGT A;  3CKQ A;  5FYE A;  4FRB A;  1G9R A;  1H5S B;  2W0V A;  5C1H A;  2QKX A;  1INI A;  1PZY B;  1WVC A;  3CKN A;  1VGU A;  4MND A;  3OH0 A;  2RIZ A;  4KT7 A;  2Y7A A;  4M2B A;  2RJ5 A;  3V0P A;  5C47 A;  3I0G A;  1JV1 A;  1R7X A;  1LZ7 A;  1SS9 A;  4MYB A;  1QWJ A;  1H7L A;  5FTS A;  3U2T A;  2NXV A;  1FWY A;  4R7P A;  1E5K A;  1ZIZ A;  2FFV A;  1HJJ A;  4FRD A;  5C36 A;  4ECM A;  2YCM A;  1G23 A;  1IIM A;  2WEE A;  2APC A;  4J18 A;  4LW6 A;  2VK9 A;  2RJ7 A;  4CJB A;  1XHB A;  1ZI4 A;  4Y9X A;  2X5S A;  1VH3 A;  1HM8 A;  4Y7F A;  2OI7 A;  2AM3 A;  1H5S C;  1MC3 A;  1S4N A;  1ZI5 A;  4D0Z A;  1LZJ A;  1R80 A;  1V84 A;  5DDT A;  5D92 A;  2V0J A;  2YQJ A;  2VXL A;  2OI5 A;  4D11 A;  1OMX A;  4M4K A;  3I0L A;  2VS5 A;  2VSH A;  1R7U A;  2V0I A;  4G3Q A;  2VFZ A;  5FTV A;  1FG5 N;  3SXG A;  2VD4 A;  3I0C A;  4O6N A;  1H5S A;  1Z90 A;  3ZLK A;  4AAW A;  1NHE B;  3F1C A;  1TW1 A;  3RMV A;  2Q4J A;  1ON8 A;  3POL A;  2J0B A;  3SX5 A;  2X65 A;  3OH3 A;  4B2X A;  1VPA A;  2VS3 A;  1TW5 A;  1H4E A;  2JCK A;  3PKP A;  1YRO B;  1K4V A;  4KC2 A;  5FU0 A;  2WVL A;  2ZU8 A;  3R2W A;  3SXB A;  2RJ8 A;  3ZF8 A;  3U2X A;  1QGQ A;  3OC9 A;  2RIY A;  4FRH A;  2X5Z A;  2WVK A;  2Z86 A;  4JD0 A;  1VH1 A;  1FO9 A;  5FU8 A;  4HO6 A;  3U0X A;  3SXC A;  2OEF A;  4HO3 A;  4Y6U A;  4FRA A;  2QH5 A;  3SPT A;  2YC3 A;  4XWI A;  1GQ9 A;  4FRM A;  1WSZ A;  1LZ0 A;  2X60 A;  1NMM B;  4DEC A;  1ZCT A;  4CJC A;  1VZU A;  5C49 A;  4IRQ A;  4B2W A;  4HO0 A;  3U0Y A;  2RJ4 A;  2W0W A;  1ZJP A;  1OQM B;  2RJ9 A;  1O23 B;  3T7O A;  1GX0 A;  1MP3 A;  4L41 C;  1LL0 A;  1I52 A;  2J0A A;  3V0L A;  2A8U A;  4B5B A;  5D91 A;  1G93 A;  3GUE A;  1HV9 A;  1YP3 A;  2AM5 A;  5C3B A;  1ZJO A;  3Q4S A;  2OEG A;  2D0J A;  2AGD A;  2P73 A;  2Y4J A;  4JIS A;  4FCE A;  2FY7 A;  3QVB A;  1O7O A;  5AJP A;  3D98 A; 
#chains in the Genus database with same CATH homology
 5CQL X;  2D7I A;  1WT0 A;  2Y4M A;  2VS4 A;  2WAW A;  2PGY A;  1WT3 A;  2OI6 A;  4B3U A;  4DE7 A;  2O1F A;  1FO8 A;  4D11 C;  4ZDQ A;  5EJ1 A;  1PZT A;  4FIX A;  4HOC A;  2BO8 A;  3V0O A;  4C2S A;  4EVW A;  2YQH A;  3U2W A;  1FGX A;  1VIC A;  1MP4 A;  5EIY A;  4AC3 A;  4HO9 A;  1ZI3 A;  1O0R A;  2YES A;  1W55 A;  3N9W A;  1H7H A;  1GX4 A;  3TZT A;  3K8D A;  1R82 A;  2RJ6 A;  4Q7C A;  4GBP A;  4KPX A;  1GWV A;  1ZJ0 A;  2JCJ A;  5C4F A;  2E8B A;  1FZW A;  1FRW A;  3SXD A;  4EEG A;  1G3L A;  1G8O A;  1H5R B;  2P6W A;  3CKV A;  2PGV A;  3V0Q A;  4BMA A;  1OMZ A;  4EEM A;  5C4E A;  2V0L A;  3U2U A;  1FXJ A;  4FIY A;  5C1L A;  1S4P A;  5BXC A;  4FQW A;  3OGZ A;  4EEO A;  1JYK A;  3PNN A;  2XWL A;  3Q80 A;  3EE5 A;  3CU0 A;  3FWW A;  4CVH A;  1R7Y A;  3JUK A;  1GA8 A;  3SXE A;  4YS8 A;  1JVG A;  4G3S A;  4KNR A;  2QGI A;  5C4C A;  2I7B A;  4NAI A;  4HCQ A;  5IDS A;  1EYR A;  2E3D A;  2O1H A;  3USQ A;  4ASJ A;  3I0K A;  3V8Z A;  4B4B A;  2V0K A;  2GGQ A;  1W57 A;  4Y63 A;  4Y7V A;  4EE3 A;  4KC1 A;  3RSB A;  2RIT A;  4HO4 A;  5FUH A;  1ZJ3 A;  5CMF X;  2GGO A;  3OH4 A;  1TVY A;  3OH1 A;  5EJZ A;  1H4C A;  3SX3 A;  1ON6 A;  1NWG B;  3I0E A;  1VZX A;  1MP5 A;  4D0T A;  1R7T A;  4FRO A;  2VXM A;  1LVW A;  3T7N A;  4FRE A;  1JV3 A;  1INJ A;  1H5S D;  1R81 A;  2FYA A;  2JCL A;  3BRK X;  3E25 A;  3ST8 A;  3JTJ A;  1VZT A;  4FRP A;  4CJ8 A;  2BO7 A;  1NF5 B;  1H5R A;  1H7F A;  2AEC A;  3PKQ A;  4HG6 A;  1WT2 A;  5CMJ A;  1LL3 A;  2RJ0 A;  2VSI A;  2RJ1 A;  4NAL A;  4Y6N A;  5J49 A;  1HM9 A;  3I0J A;  5IDT A;  1QG8 A;  5C38 A;  5L6V A;  2C0N A;  1ZCY A;  2XWM A;  1G0R A;  3JUJ A;  1ZJ2 A;  2UX8 A;  4G87 A;  3T7M A;  3USR A;  1G2V A;  4Y7U A;  4IRP A;  3IOJ A;  4B4M A;  4Y64 A;  4LW3 A;  1ZCV A;  2A8W A;  2RIX A;  1NKH B;  1YP2 A;  4KRV A;  4G3P A;  3V90 A;  2AH9 A;  4EEA A;  1VGW A;  4HO8 A;  2XMH A;  4AYL A;  2YQC A;  1VGZ A;  1FXO A;  2FYD B;  3HL3 A;  4ASY A;  2WGZ A;  2DPW A;  2WVM A;  4KNX A;  2ZU7 A;  3I0F A;  2XWN A;  4FCU A;  2FYC B;  1WT1 A;  2Y6P A;  3CKO A;  3SX7 A;  3FOQ A;  1FR8 A;  4HO2 A;  3SXA A;  1H5T A;  1FOA A;  2YC5 A;  3V8Y A;  4B42 A;  4FRQ A;  1GWW A;  4KQL A;  4KXO A;  3NGW A;  2P72 A;  4NAK A;  5CMI A;  1G1L A;  1JVD A;  1LL2 A;  5CQN X;  2CU2 A;  1ZHJ A;  3OKR A;  4UEG A;  1G95 A;  3ZGF A;  1H3M A;  2PX7 A;  3D8V A;  3V91 A;  2XME A;  1ZI1 A;  1EZI A;  2BO4 A;  2V0H A;  4D48 A;  3O3P A;  4MIX A;  2AE7 A;  5AJO A;  5JQQ A;  5C8R A;  3IOI A;  5HS2 A;  3TQD A;  3F1Y A;  1NQI B;  5C1G A;  1ZJ1 A;  2ICY A;  2ZU9 A;  4HO5 A;  3K8E A;  4ARW A;  5CQM X;  3I0D A;  3U2V A;  4KPZ A;  5CQO A;  1ZCU A;  2WE9 A;  2BO6 A;  2JCO A;  1V83 A;  1VM8 A;  3V0M A;  4BQH A;  1IIN A;  5CMH A;  1FR9 A;  2I5K A;  5C4B A;  4Y7T A;  3DUV A;  1S4O A;  3CGX A;  2FYB A;  5DDV A;  1ZDG A;  1ZDF A;  4NAN A;  1FGG A;  3ZLL A;  1JYL A;  1H7T A;  2O1G A;  3E26 A;  3ZGG A;  1H5T B;  3I0I X;  3SX8 A;  4P00 A;  1W77 A;  3LW6 A;  5C3A A;  2I5E A;  3DK5 A;  4O6M A;  3R3I A;  4AYJ A;  4FRL A;  5CMG X;  4Y62 A;  2Y4K A;  2AES A;  2MZB A;  5AJN A;  5C3D A;  1V82 A;  3V0N A;  1G97 A;  3OH2 A;  5L6S A;  1H7Q A;  4M2A A;  1LZI A;  2Y4L A;  1R7V A;  2PA4 A;  2AM4 A;  5I1F A;  1TZF A;  3OAM A;  5IFY A;  4Y7G A;  4DDZ A;  1H7E A;  2Z87 A;  4B4G A;  3Q7U A;  1GQC A;  1KWS A;  2D7R A;  4KC4 A;  1O7Q A;  1YP4 A;  4K6R A;  4EE4 A;  3KIA A;  2ICX A;  1HM0 A;  3RMW A;  1QGS A;  5CQP A;  5C4D A;  4M28 A;  3DJ4 A;  2FFU A;  1H7G A;  3BCV A;  4P02 A;  5FV9 A;  1H4D A;  1HJL A;  4E1K A;  5C48 A;  3I0H A;  3IOH A;  3CKJ A;  4EE5 A;  1XZ6 A;  3D5N A;  2YQS A;  1VGT A;  3CKQ A;  5FYE A;  4FRB A;  1G9R A;  1H5S B;  2W0V A;  5C1H A;  2QKX A;  1INI A;  1PZY B;  1WVC A;  3CKN A;  1VGU A;  4MND A;  3OH0 A;  2RIZ A;  4KT7 A;  2Y7A A;  4M2B A;  2RJ5 A;  3V0P A;  5C47 A;  3I0G A;  1JV1 A;  1R7X A;  1LZ7 A;  1SS9 A;  4MYB A;  1QWJ A;  1H7L A;  5FTS A;  3U2T A;  2NXV A;  1FWY A;  4R7P A;  1E5K A;  1ZIZ A;  2FFV A;  1HJJ A;  4FRD A;  5C36 A;  4ECM A;  2YCM A;  1G23 A;  1IIM A;  2WEE A;  2APC A;  4J18 A;  4LW6 A;  2VK9 A;  2RJ7 A;  4CJB A;  1XHB A;  1ZI4 A;  4Y9X A;  2X5S A;  1VH3 A;  1HM8 A;  4Y7F A;  2OI7 A;  2AM3 A;  1H5S C;  1MC3 A;  1S4N A;  1ZI5 A;  4D0Z A;  1LZJ A;  1R80 A;  1V84 A;  5DDT A;  5D92 A;  2V0J A;  2YQJ A;  2VXL A;  2OI5 A;  4D11 A;  1OMX A;  4M4K A;  3I0L A;  2VS5 A;  2VSH A;  1R7U A;  2V0I A;  4G3Q A;  2VFZ A;  5FTV A;  1FG5 N;  3SXG A;  2VD4 A;  3I0C A;  4O6N A;  1H5S A;  1Z90 A;  3ZLK A;  4AAW A;  1NHE B;  3F1C A;  1TW1 A;  3RMV A;  2Q4J A;  1ON8 A;  3POL A;  2J0B A;  3SX5 A;  2X65 A;  3OH3 A;  4B2X A;  1VPA A;  2VS3 A;  1TW5 A;  1H4E A;  2JCK A;  3PKP A;  1YRO B;  1K4V A;  4KC2 A;  5FU0 A;  2WVL A;  2ZU8 A;  3R2W A;  3SXB A;  2RJ8 A;  3ZF8 A;  3U2X A;  1QGQ A;  3OC9 A;  2RIY A;  4FRH A;  2X5Z A;  2WVK A;  2Z86 A;  4JD0 A;  1VH1 A;  1FO9 A;  5FU8 A;  4HO6 A;  3U0X A;  3SXC A;  2OEF A;  4HO3 A;  4Y6U A;  4FRA A;  2QH5 A;  3SPT A;  2YC3 A;  4XWI A;  1GQ9 A;  4FRM A;  1WSZ A;  1LZ0 A;  2X60 A;  1NMM B;  4DEC A;  1ZCT A;  4CJC A;  1VZU A;  5C49 A;  4IRQ A;  4B2W A;  4HO0 A;  3U0Y A;  2RJ4 A;  2W0W A;  1ZJP A;  1OQM B;  2RJ9 A;  1O23 B;  3T7O A;  1GX0 A;  1MP3 A;  4L41 C;  1LL0 A;  1I52 A;  2J0A A;  3V0L A;  2A8U A;  4B5B A;  5D91 A;  1G93 A;  3GUE A;  1HV9 A;  1YP3 A;  2AM5 A;  5C3B A;  1ZJO A;  3Q4S A;  2OEG A;  2D0J A;  2AGD A;  2P73 A;  2Y4J A;  4JIS A;  4FCE A;  2FY7 A;  3QVB A;  1O7O A;  5AJP A;  3D98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...