1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
3T7NA 4FRMA 3V0NA 4EVWA 3OAMA 1ZCVA 1H5SC 3R3IA 4C82A 1H7GA 4YS8A 3IEWA 1PZTA 1ZJOA 3F1CA 3I0EA 4FROA 2OI7A 1HM9A 1R7TA 1XZ6A 1YP3A 5EJ1A 3HL3A 1LZIA 2XWLA 2YCMA 4KC1A 2PA4A 5AJNA 3IOIA 3T7OA 4EEMA 4HO0A 3Q4SA 2RJ1A 1O23B 1TW1A 1R82A 4Y7UA 4HOCA 5C3AA 1VZUA 2Y6PA 5FTVA 2V0IA 2BO7A 2ZU8A 1HV9A 1GX1A 2AH9A 3Q8HA 4JD0A 4HO5A 1H5SA 4B4MA 3JUKA 2ZU9A 1H7HA 1O0RA 2RJ0A 1WT1A 1ZCTA 5FU8A 1H7EA 4M28A 4D0TA 4DE7A 1H5RA 4HO8A 3V8YA 1JN1A 5JQQA 1V82A 4FRQA 3D8VA 5CMIA 5L6VA 2O1GA 3U2UA 1LZ0A 2XMEA 3I0CA 3ZLLA 3F0FA 2Y4KA 1ZJPA 2VSHA 2MZBA 4UEGA 2FYCB 1R81A 1GA8A 1OMXA 2RIYA 5IDSA 4J18A 2APCA 1LVWA 4Y9XA 2ZU7A 1ZJ1A 5C48A 3RMWA 1VPAA 4HO3A 2YQSA 4KPZA 1ON6A 2I7BA 5FUHA 3V0MA 1LZJA 1ZJ2A 3D5NA 2OEGA 1R80A 3MBMA 4M2AA 1YROB 2UX8A 5C1GA 1QGSA 1U43A 3T80A 5IDTA 4P02A 2VS4A 1JYKA 1INJA 3I0IX 1VICA 4E1KA 2XWMA 3RSBA 3P10A 4ARWA 2YQCA 2ICXA 5I1FA 1V83A 3GUEA 3K2XA 2YC5A 2WVMA 3QHDA 1ZDGA 2I5EA 2PGVA 1H5SD 3JUJA 3FOQA 3FWWA 1NWGB 2QGIA 4HCQA 3SXAA 3F1YA 4HO9A 4KXOA 1NHEB 2A8WA 4B4BA 3IOJA 1FXJA 3U2VA 4NAKA 3ST8A 4NALA 3SX5A 3V0OA 2D7RA 1OQMB 3K8EA 2FYDB 3V90A 5FYEA 1QWJA 4AYLA 2RJ8A 1GQ9A 2AM4A 1IV2A 5CQPA 3ESJA 1LL0A 3BCVA 3KE1A 1H4DA 1HJJA 1S4NA 2PX7A 4CJBA 5CQMX 2FFVA 1TVYA 4Y7FA 3B6NA 2VD4A 1MP4A 2Y4JA 3ZGFA 4Y7TA 4Y7VA 4D11A 1ZJ0A 2QKXA 3ZF8A 3BRKX 1QGQA 3SX7A 3IEQA 2O1FA 1IIMA 5C36A 3OC9A 4AYJA 4KT7A 2GGQA 2OI5A 1G95A 4EE3A 3PNNA 4G87A 1EYRA 3OH1A 4FCEA 2VXLA 4XWIA 3GHZA 2WEEA 1H5RB 2WGZA 1H4CA 3SXCA 1IINA 4C8IA 2CU2A 4LW3A 1LL3A 4P00A 2GGOA 3KIAA 3NGWA 5CMHA 4JISA 3U0XA 1YP4A 3D98A 2VXMA 1H3MA 1MP3A 2YC3A 2JCJA 1ZI5A 5HS2A 1S4OA 4B42A 1WT3A 1VH1A 2PGYA 3T7MA 3TQDA 3CKNA 3DK5A 1VH8A 4EEGA 5IFYA 1O7OA 1H7LA 2D7IA 3K8DA 3I0LA 3U2TA 5FU0A 4DDZA 4G3PA 4L41C 3SPTA 4M4KA 2XWNA 1LZ7A 1FOAA 4FRDA 4Y6NA 3QVBA 2WE9A 2P6WA 4EE4A 1WT0A 2Q4JA 2A8UA 3V8ZA 1VZXA 1G23A 3IOHA 4IRQA 1EZIA 3I0HA 2RITA 4Y62A 3ZGGA 2YESA 1KNKA 1KWSA 2NXVA 2ICYA 2VFZA 1ZCYA 3ZLKA 1SS9A 3OKRA 3Q7UA 1INIA 5FTSA 4ASYA 2JCKA 3JTJA 4KRVA 4BMAA 5C8RA 1G2VA 1HM0A 1IV3A 4ECMA 2AESA 1NF5B 5CMJA 3SX3A 2DPWA 1H7TA 4Y63A 5CQNX 4ZDQA 3IKEA 3CKOA 1H4EA 1VM8A 3EE5A 4B2WA 2RJ6A 1G97A 3F0GA 5CMGX 1VGUA 2OI6A 1E5KA 5C4FA 4EEOA 4Y6UA 2AGDA 1O7QA 1ZI4A 1NMMB 3PKQA 3SXGA 1JVDA 3CKVA 5C1LA 2RIXA 1ZCUA 4Y7GA 3I0JA 1I52A 3CKJA 1ZIZA 1FZWA 1VGZA 1TW5A 3I0DA 3CGXA 4MYBA 1H5SB 3P0ZA 2UZHA 2D0JA 3POLA 1GX4A 3OH3A 3I0GA 4CVHA 1VHAA 1GQCA 4CJCA 4NANA 2X65A 3IKFA 1FGXA 5B8FA 1W57A 4R7PA 4FRPA 5C4DA 1PZYB 2V0KA 1LL2A 2OEFA 2P72A 1V84A 4M2BA 1HM8A 2GZLA 1KNJA 1GWWA 2AECA 3V0LA 1H5TA 2Z87A 4FQWA 2V0LA 3N9WA 2QH5A 3PKPA 1QG8A 5FV9A 4C2SA 4C8GA 1WVCA 2FY7A 1FR8A 2V0JA 1G0RA 2RJ7A 1R7XA 2W0WA 4FRBA 3U2XA 3R2WA 1FGGA 4FCUA 3O3PA 1YQNA 1IV1A 2BO6A 2JCLA 4C8EA 2VS5A 1FR9A 1HJLA 4FRHA 1G9RA 1W77A 4NAIA 3FPIA 2FYBA 3OH4A 1T0AA 4HG6A 5AJOA 1FWYA 4BQHA 4HO2A 4CJ8A 5J49A 2X5ZA 1H7QA 2FFUA 2VSIA 1FO9A 5L6SA 2YQJA 1XHBA 5BXCA 4KPXA 1ZI1A 2E3DA 3EORA 4FREA 4KC4A 4KC2A 1ZHJA 3DJ4A 3ELCA 1G8OA 3Q80A 3OH2A 1ON8A 1Z90A 4B4GA 4LW6A 3U0YA 5C4BA 1FRWA 5CQLX 4KNRA 2RJ9A 2FYAA 4FRAA 3SXDA 2RIZA 3K14A 2BO8A 1MP5A 2W0VA 1W55A 4ASJA 4D0ZA 1G1LA 3SXBA 4GBPA 4G3QA 1WT2A 3RMVA 2Y4LA 1WSZA 3F0DA 4K6RA 5DDVA 2AM5A 1VGTA 2X60A 1OMZA 1MC3A 2Y7AA 1JY8A 1H7FA 3SX8A 3USQA 4B5BA 2Y4MA 2AMTA 4B3UA 5C3DA 2AM3A 4C81A 3RE3A 1ZJ3A 1R7UA 3E26A 5C4CA 4EE5A 2P73A 1FG5N 4D11C 4EEAA 3OGZA 5C1HA 1GWVA 1NQIB 1H47A 4D48A 2E8BA 3ERNA 4IRPA 4B2XA 1TZFA 1S4PA 4AC3A 3DUVA 4G3SA 5C49A 3E25A 2O1HA 3LW6A 5C3BA 1ZI3A 3TZTA 1R7VA 2Z86A 5CMFX 3USRA 2WVKA 5DDTA 1G93A 1H5TB 4HO4A 2VS3A 4MNDA 4FRLA 2WAWA 2PMPA 5C38A 3I0FA 4KQLA 1ZDFA 3CU0A 1FO8A 1U40A 1JV3A 3F0EA 5AJPA 3FBAA 5EIYA 1R7YA 2I5KA 3V91A 2X5SA 5C4EA 2YQHA 1U3LA 2XMHA 3JVHA 1G3LA 1GX0A 1VH3A 3CKQA 1U3PA 4HO6A 5EJZA 3OH0A 2JCOA 3V0QA 3U2WA 1H48A 4AAWA 5CQOA 1YP2A 4Y64A 2RJ5A 1VZTA 1NKHB 2AE7A 1K4VA 4DECA 2RJ4A 1JYLA 4KNXA 5C47A 1JVGA 1JV1A 1VGWA 3SXEA 3I0KA 2BO4A 1IV4A 2WVLA 3V0PA 3F6MA 1FXOA 2V0HA
chains in the Genus database with same CATH superfamily
3T7NA 4I4TA 4FRMA 3V0NA 4EVWA 3OAMA 1ZCVA 1H5SC 3RYIB 3R3IA 4C82A 1H7GA 4YS8A 1OFUA 3IEWA 4BVQA 5IJ0B 1W581 1PZTA 1ZJOA 3F1CA 4TV8A 5KX5A 2HP0B 2KTVA 3I0EA 2VAWA 2W8BC 3WJRA 5LA6B 4FROA 3FD5A 3CCMF 2OI7A 4EI8A 1HM9A 1R7TA 1XZ6A 1YP3A 5EJ1A 2NMUA 5FNVB 1W59A 3HL3A 1LZIA 2GLZA 5MN6A 2XWLA 1W40A 2HX0A 1FNJA 4TUYB 2PA4A 2YCMA 5AJNA 4DRXB 4TV9A 3IOIA 1YITF 3T7OA 5GONA 5HWEA 5KMGA 4EEMA 2CHSA 4HO0A 5CB4B 2AIZP 3JAKA 3Q4SA 2RJ1A 1YGYA 1O23B 1TW1A 1R82A 1XV2A 4Y7UA 5EYPA 3HWUA 1KD1H 3HKEA 4O4LA 4HOCA 5C3AA 1K73H 1VZUA 2Y6PA 5FTVA 3M4SA 4FFBA 3ZP4A 2RHHA 2V0IA 3N2GB 2BO7A 2ZU8A 5EIBC 1HV9A 2CZWA 1GX1A 4ZHQA 5IJ9B 5BMVA 2AH9A 5AVMA 4F6RB 3CCJF 1FSZA 1Q8RA 2RHJA 3Q8HA 3RYHA 4JD0A 3NVKE 4HO5A 1H5SA 4B4MA 3FFMA 3JUKA 2ZU9A 1H7HA 1O0RA 2RJ0A 1WT1A 1ZCTA 4WBNB 5LP6C 5FU8A 1H7EA 4M28A 4D0TA 2Q1YA 3QUWA 5CA0A 1JFFB 5LOVB 1H5RA 4HO8A 1ODEA 3V8YA 1JN1A 4DE7A 1PF5A 5JQQA 1V82A 3WGNA 4FRQA 3HTNA 3D8VA 5D91A 3NK6A 5HY0A 4ZHWA 5CMIA 3M84A 5L6VA 2O1GA 1S72F 1LZ0A 3ZP7A 5JCOC 2XMEA 5IJ0A 3G6EF 3I0CA 3U2UA 3CC2F 3ZLLA 2DT4A 3F0FA 2Y4KA 1ZJPA 3V3TA 2VSHA 2MZBA 4UEGA 2FYCB 3CCLF 1R81A 3UT5A 1GA8A 1OMXA 3CCQF 2RIYA 5IDSA 3CMAF 4O4IA 1VQ7F 3RYFA 4J18A 2APCA 1LVWA 3N2KA 4Y9XA 3WGKA 2FGYA 2ZU7A 4B46A 1W5AA 1W42A 1VPAA 1ZJ1A 4HO3A 2YQSA 1GO0A 4KPZA 3RMWA 5C48A 1ON6A 1RQ2A 1UI9A 4G4YA 2I7BA 1LZJA 2UYKA 2OTJF 1ZJ2A 5FUHA 3D5NA 3V0MA 2OEGA 1GZ0A 1R80A 5CA1B 3MBMA 3LWOC 4M2AA 1YROB 3RYCA 2UX8A 4B62A 3WJPA 5C1GA 4BVSA 1QGSA 3NMUC 1U43A 3V7EA 3JCMM 3T80A 3N2GA 3VMFB 5IDTA 2HS0A 1Q82H 4P02A 2LCAA 1IPAA 4BVRA 2VS4A 1TVKA 2WALA 1JYKA 1INJA 4F6RA 2VAPA 2L26A 3MDOA 3V7QA 1VICA 4EI9A 3I0IX 4I50B 2VXYA 3LWRC 2XWMA 4E1KA 4X20A 3P10A 3RA5A 3FD6A 2YQCA 2ICXA 3RSBA 4ARWA 5I1FA 1KC8H 1FFXA 1V83A 5A2QM 3GUEA 5LYJB 3K2XA 4U39A 2F9ZC 5LP6B 4X3LA 3QHDA 1ZDGA 1YHQF 2I5EA 3PLAC 1H5SD 3V4DA 2PGVA 2WVMA 2QTPA 3FOQA 3FWWA 1NWGB 2QGIA 4X1IB 4HCQA 3SXAA 3F1YA 4HO9A 4LCKA 3OONA 2V9YA 1VQOF 5HXUA 2B33A 5JQGB 1SDSA 4KXOA 1NHEB 1VQLF 3VO8A 2A8WA 5JH7B 1JD1A 5ITZA 1FNKA 3HKBB 1FXJA 3IOJA 4NAKA 3KJKA 2OZBA 4NALA 3ST8A 2D7RA 3SX5A 3V0OA 4R40B 1OQMB 4BW0B 2FYDB 3K8EA 3VI6A 5JVDB 4O4JA 3VIUA 1QWJA 5FYEA 3V90A 4AYLA 3D54A 3CPWF 2RJ8A 3L7QA 1GQ9A 2AM4A 2HS4A 1IV2A 2DYYA 2N48A 3N4ZA 5C4CA 5CQPA 3ESJA 4TV8B 1LL0A 4ZHYB 2HP0A 1Q81H 3LMEA 4X1KB 1NMUB 3CCSF 2AGDA 3BCVA 3KE1A 3BYQA 1H4DA 2OTMA 4YJ3A 5G4UC 5J2TA 1HJJA 2YYEA 5FNVA 1S4NA 2PX7A 3OBWA 4CJBA 4ZI7A 5LXTA 5CQMX 2FFVA 3S0WA 2ZOVA 2KGWA 4DRXA 1TVYA 4Q7CA 4Y7FA 3B6NA 3S02A 4E6EA 2VD4A 1MP4A 2Y4JA 4O6MA 3J80M 3ZGFA 4Y7TA 4Y7VA 1VQ9F 4G4WA 4D11A 5C8YA 1ZJ0A 2QKXA 3JATA 3JALB 3ZF8A 1M90H 3BRKX 3M1XA 4FFBB 1QGQA 5JCOA 5HY4A 3SX7A 3IEQA 2O1FA 4EB6B 5GIPC 1IIMA 3CC4F 2YXZA 5HP8A 3LYBA 1W3EX 5C36A 3OC9A 4ZHQB 4AYJA 3LWQC 4KT7A 2GGQA 2I6RA 1VQ6F 2ZAUA 4G4XA 2OI5A 1JJ2F 1G95A 4EE3A 3PNNA 4G87A 1EYRA 3OH1A 4FCEA 2VXLA 5JH7A 3E22A 3JAWB 4G4ZA 4XWIA 3GHZA 2WEEA 5CA0B 5LOVA 1H5RB 2WGZA 5EB0A 2UYNA 4I55B 2ZVYA 1H4CA 3SXCA 1QVGF 2QI2A 4O4JB 1IINA 4C8IA 1X7OA 3G4SF 3J7AR 1X7PA 2CU2A 4LW3A 5LA6A 1Z5WA 1LL3A 4P00A 2GGOA 4O2BB 1SA0A 3KIAA 2Z1UA 4ZK7A 3NGWA 4JISA 5CMHA 3U0XA 1YP4A 2LBWA 2VXMA 3D98A 1H3MA 1MP3A 2YC3A 2JCJA 3UT5B 1ZI5A 5IYZB 5HS2A 1S4OA 4B42A 1WT3A 1Q86H 5J2TB 3CYQA 3JASB 1VH1A 2IG8A 2PGYA 3KHNA 5CB4A 3CKNA 3DK5A 1VH8A 2Z1TA 3T7MA 3TQDA 4EEGA 5IFYA 4BT3A 1H7LA 4BT7A 4U3JA 1O7OA 2D7IA 3K8DA 3I0LA 3U2TA 5FU0A 4DDZA 4G3PA 4L41C 3SPTA 2UYPA 2XWNA 2OTLF 1LZ7A 2HS3A 1XHOA 3NVIB 1FOAA 4FIYA 4M4KA 1KQSF 2HVYD 4FRDA 3AGKA 3VOBA 4Y6NA 4M8IA 3S06A 3JARA 3QVBA 3HJWC 2WE9A 2P6WA 4EE4A 1WT0A 2Q4JA 4C4WC 3RA6A 2A8UA 3V8ZA 1VZXA 1G23A 3IOHA 1ONIA 2VAMA 3GYQA 3HKCA 1RLGA 3I55F 1EZIA 3I0HA 3CC7F 4IRQA 4WBNA 2RITA 4YJ2B 3VCZA 4Y62A 3ZGGA 2YESA 1KNKA 1KWSA 3MQWA 4G4VA 2NXVA 2ZF8A 4PWTA 4NQ3A 2ICYA 2VFZA 1ZCYA 1CK2A 3ZLKA 1TUBA 4BT4A 1SS9A 2J0AA 3OKRA 3Q7UA 1INIA 5FTSA 4ASYA 2JCKA 3JTJA 4KRVA 1PXWA 3J81M 1G2VA 4BMAA 5C8RA 4X1IA 1HM0A 1IV3A 3K12A 3WPWA 1YJNF 4ECMA 2AIFA 3WGLA 2AESA 1VQNF 2RB9A 4BVTA 1NF5B 4LNUB 5CMJA 4IIJA 3SX3A 2VGMA 1W5EA 2DPWA 3RYFB 3C9SA 4XCQA 1H7TA 4Y63A 5CQNX 1X25A 4ZDQA 3IKEA 3TD3A 4MIXA 3CKOA 1W5BA 1H4EA 1VM8A 3EE5A 4B2WA 2RJ6A 3RYIA 1G97A 3F0GA 5J2UA 1VGUA 2ZVZA 1K9MH 2OI6A 3S0HA 5CMGX 1E5KA 5C4FA 5EO3A 4EEOA 4Y6UA 4BT6A 5HP7A 1Q7YH 3IMPA 2IQQA 5GONB 5CA1A 5KX5B 4TZZA 1T0KB 1O7QA 1ZI4A 3LWPC 1NMMB 3PKQA 3SXGA 3S03A 1JVDA 3CKVA 5C1LA 4RHAA 2RIXA 5EIBD 1ZCUA 4Y7GA 5HY1A 3JUJA 4O4LB 1TVKB 5GAPK 4O4HB 1I52A 3CKJA 3I0JA 1ZIZA 1OAPA 5KMGB 2RHLA 1FZWA 4ERHA 3PAFA 2Z1EA 3HKCB 3VOAA 1VGZA 2RHOA 1TW5A 3I0DA 3CGXA 4MYBA 4HNAB 3WXMB 2BTOA 3CCVF 3P0ZA 2UZHA 1H5SB 2D0JA 2J0BA 2OHWA 1COMA 3HKEB 1GX4A 3POLA 3OH3A 3I0GA 4CVHA 2Z1FA 1VHAA 1GQCA 4CJCA 4NANA 2X65A 3IKFA 5C8YB 2QEXF 3SIUA 1FGXA 5HY2A 3I3FA 5BMVB 4X3MA 5B8FA 1W57A 4R7PA 3RYHB 4FRPA 5C4DA 3VYTC 1PZYB 3QTYA 2V0KA 2ALEA 1LL2A 2OEFA 1VQ8F 3C8LA 2P72A 1V84A 3N4YA 4LNUA 1QAHA 4M2BA 2P6YA 5MN4A 2GZLA 1KNJA 1GWWA 1HM8A 2AECA 1H5TA 3V0LA 5EAZA 2Z87A 4FQWA 3HKDB 4BT2A 2V0LA 3N9WA 2ZODA 2QH5A 3CCRF 3P4EA 5J2UB 5EZYA 1YIJF 2H8CA 1QG8A 3PKPA 5FV9A 2GVIA 2UYNB 4I55A 2FC3A 3NK7A 5MN5A 4C8GA 1WVCA 2LBXA 2FY7A 1FR8A 2V0JA 4C2SA 4DXDA 3ZO8A 4X1KA 3O85A 3LFOA 1QVFF 1RLUA 1G0RA 1R7XA 2RJ7A 1H7MA 2W0WA 4FRBA 3U2XA 3R2WA 3I56F 5G4VC 3TD4A 1FGGA 4FCUA 4ZI7B 3O3PA 1K8AH 3KJJA 2BO1A 3CPQA 1YQNA 1IV1A 4O2AA 2KTUA 4C8EA 1YI2F 2BO6A 2JCLA 1FR9A 2VS5A 1HJLA 4FRHA 1G9RA 2HQSC 2EWCA 4X1YA 4KWEA 5IT9M 4ZOLB 1W77A 2VGNA 4NAIA 3FPIA 2Q1XA 4I50A 3RYCB 2FYBA 4X20B 1T0AA 3JAKB 3OH4A 1FWYA 4HG6A 5AJOA 4BQHA 3VYUC 5GANK 3C9RA 4HO2A 4CJ8A 2Z01A 5HXZA 4EB6A 3CYPB 5LP6A 2HRYA 5J49A 3R0PA 2QA4F 1VQKF 2X5ZA 1H7QA 2FFUA 3CXCF 4B5CA 2VSIA 5FJ4C 3WGMA 1FO9A 5L6SA 4NWOB 4O6NA 5DCVA 2YQJA 3C9TA 3HAXD 1XHBA 5BXCA 3JAMM 4KPXA 3HKDA 4RQOA 1ZI1A 2E3DA 3MCAB 3EORA 3D00A 4FREA 4KC4A 4KC2A 1VQMF 1TUBB 2G9IA 1ZHJA 3DJ4A 3ELCA 2CHTA 1G8OA 4O2BA 3OH2A 1ON8A 3Q80A 1Z90A 2BTQB 3U2VA 4B4GA 5JQGA 4LW6A 2IAFA 3CD6F 3U0YA 5C4BA 5IYZA 1FRWA 5CQLX 4KNRA 2RJ9A 2FYAA 5FLXM 3CG6A 4G88A 4FRAA 4KC1A 3HKBA 2HRUA 3GTZA 3SXDA 2K1SA 4TUYA 1YJ9F 2RIZA 3K14A 4TV9B 2BTUA 2BO8A 1W2BF 1MP5A 1W55A 2W0VA 4YJ3B 4ASJA 3IR9A 4O4IB 1E7KA 4D0ZA 1G1LA 2YC5A 3SXBA 3CB2A 2LBTA 4X1YB 3DDNA 3N2KB 3E1YA 2PHNA 4G3QA 4ZOLA 1QD9A 1WT2A 3RMVA 1ZWZA 3K0TA 5EB1B 2R6R1 2Y4LA 1WSZA 3F0DA 5EYPB 4K6RA 1X52A 1RA4A 3JARB 5DDVA 3WGJA 4BY9D 1VGTA 2AM5A 2X60A 4B4BA 2I6DA 1OMZA 2HP3A 5GINC 1NQ3A 3G71F 4IHJB 1CN7A 5LXTB 1MC3A 2Y7AA 1JY8A 3JALA 5GIOC 2H6LA 4ZHVA 3MCQA 4O4HA 1H7FA 1N8RH 3SX8A 3USQA 4B5BA 1R1MA 3TD5A 2Y4MA 2AMTA 4B3UA 5C3DA 2AM3A 3DC2A 3E20B 4C81A 1VQVA 3RE3A 4EI7A 1RQ7A 2H8EA 1VQPF 3OW2F 1R7UA 1ZJ3A 2UYJA 3E26A 2P73A 1JFFA 3LDTA 4EE5A 1FG5N 3ON1A 1FFXB 1VK3A 3JAWA 3OGZA 4D11C 5C1HA 1GWVA 1NQIB 1H47A 3CMEF 4D48A 4EEAA 1UFYA 4B45A 3CCUF 3U0OA 1VQ5F 2E8BA 1M1KH 3S0YA 3ERNA 4IRPA 1SZQA 4B2XA 1GO1A 1TZFA 1S4PA 4AC3A 3DUVA 4G3SA 5C49A 2CW4A 3E25A 2O1HA 3LW6A 5C3BA 1YJWF 1ZI3A 2CWJA 1R7VA 3TZTA 5D92A 3E22B 2Z86A 5CMFX 3USRA 2WVKA 5DDTA 1G93A 4I4TB 1W5FA 2CSLA 1H5TB 1CLIA 2CVLA 1Z5VA 4HO4A 2VS3A 4MNDA 3LWVC 4FRLA 2WAWA 2PMPA 3ZOPA 5C38A 3SIVA 3I0FA 2MQEA 3OBYA 5EWRA 4KQLA 1ZDFA 3CU0A 1FO8A 1U40A 1JV3A 5JVDA 1SA0B 1DBFA 4BT5A 3F0EA 3KIZA 5AJPA 4NUTA 3FBAA 1NJIH 1J7HA 5EIYA 1R7YA 2I5KA 1XBIA 3JASA 3V91A 4IHJA 2X5SA 5C4EA 2YQHA 1U3LA 3I7TA 2XMHA 2KG4A 3VTIC 3C9UA 4U3JB 2VK9A 4O2AB 4HNAA 3JVHA 1G3LA 3CCEF 3D01A 1GX0A 1VH3A 3CKQA 4GBPA 1U3PA 4HO6A 5EJZA 3WJQA 1DT9A 2JCOA 3OH0A 3U2WA 3V0QA 4YJ2A 5LYJA 2C0NA 1H48A 3VYSC 4AAWA 2R751 5CQOA 1YP2A 4Y64A 2RJ5A 1VZTA 2JNBA 1NKHB 2AE7A 3WPXA 1K4VA 4FIXA 4DECA 1JYLA 2RJ4A 1QU9A 3JATB 4KNXA 5C47A 5IJ9A 1VQ4F 1JVGA 1JV1A 1VGWA 3SXEA 3I0KA 2BO4A 1IV4A 1XRGA 2WVLA 3V0PA 1W41A 3F6MA 1FXOA 2V0HA 5ITZB 4IIJB 5EZYB
chains in the Genus database with same CATH topology
3T7NA 4FRMA 3V0NA 4EVWA 3OAMA 1ZCVA 1H5SC 3R3IA 4C82A 1H7GA 4YS8A 3IEWA 1PZTA 1ZJOA 3F1CA 3I0EA 4FROA 2OI7A 1HM9A 1R7TA 1XZ6A 1YP3A 5EJ1A 3HL3A 1LZIA 2XWLA 2YCMA 4KC1A 2PA4A 5AJNA 3IOIA 3T7OA 4EEMA 4HO0A 3Q4SA 2RJ1A 1O23B 1TW1A 1R82A 4Y7UA 4HOCA 5C3AA 1VZUA 2Y6PA 5FTVA 2V0IA 2BO7A 2ZU8A 1HV9A 1GX1A 2AH9A 3Q8HA 4JD0A 4HO5A 1H5SA 4B4MA 3JUKA 2ZU9A 1H7HA 1O0RA 2RJ0A 1WT1A 1ZCTA 5FU8A 1H7EA 4M28A 4D0TA 4DE7A 1H5RA 4HO8A 3V8YA 1JN1A 5JQQA 1V82A 4FRQA 3D8VA 5D91A 5CMIA 5L6VA 2O1GA 3U2UA 1LZ0A 2XMEA 3I0CA 3ZLLA 3F0FA 2Y4KA 1ZJPA 2VSHA 2MZBA 4UEGA 2FYCB 1R81A 1GA8A 1OMXA 2RIYA 5IDSA 4J18A 2APCA 1LVWA 4Y9XA 2ZU7A 1ZJ1A 5C48A 3RMWA 1VPAA 4HO3A 2YQSA 4KPZA 1ON6A 2I7BA 5FUHA 3V0MA 1LZJA 1ZJ2A 3D5NA 2OEGA 1R80A 3MBMA 4M2AA 1YROB 2UX8A 5C1GA 1QGSA 1U43A 3T80A 5IDTA 4P02A 2VS4A 1JYKA 1INJA 3I0IX 1VICA 4E1KA 2XWMA 3RSBA 3P10A 4ARWA 2YQCA 2ICXA 5I1FA 1V83A 3GUEA 3K2XA 2YC5A 2WVMA 3QHDA 1ZDGA 2I5EA 2PGVA 1H5SD 3JUJA 3FOQA 3FWWA 1NWGB 2QGIA 4HCQA 3SXAA 3F1YA 4HO9A 4KXOA 1NHEB 2A8WA 4B4BA 3IOJA 1FXJA 3U2VA 4NAKA 3ST8A 4NALA 3SX5A 3V0OA 2D7RA 1OQMB 3K8EA 2FYDB 3V90A 5FYEA 1QWJA 4AYLA 2RJ8A 1GQ9A 2AM4A 1IV2A 5CQPA 3ESJA 1LL0A 3BCVA 3KE1A 1H4DA 1HJJA 1S4NA 2PX7A 4CJBA 5CQMX 2FFVA 1TVYA 4Q7CA 4Y7FA 3B6NA 2VD4A 1MP4A 2Y4JA 4O6MA 3ZGFA 4Y7TA 4Y7VA 4D11A 1ZJ0A 2QKXA 3ZF8A 3BRKX 1QGQA 3SX7A 3IEQA 2O1FA 1IIMA 5C36A 3OC9A 4AYJA 4KT7A 2GGQA 2OI5A 1G95A 4EE3A 3PNNA 4G87A 1EYRA 3OH1A 4FCEA 2VXLA 4XWIA 3GHZA 2WEEA 1H5RB 2WGZA 1H4CA 3SXCA 1IINA 4C8IA 2CU2A 4LW3A 1LL3A 4P00A 2GGOA 3KIAA 3NGWA 5CMHA 4JISA 3U0XA 1YP4A 3D98A 2VXMA 1H3MA 1MP3A 2YC3A 2JCJA 1ZI5A 5HS2A 1S4OA 4B42A 1WT3A 1VH1A 2PGYA 3T7MA 3TQDA 3CKNA 3DK5A 1VH8A 4EEGA 5IFYA 1O7OA 1H7LA 2D7IA 3K8DA 3I0LA 3U2TA 5FU0A 4DDZA 4G3PA 4L41C 3SPTA 4M4KA 2XWNA 1LZ7A 1FOAA 4FIYA 4FRDA 4Y6NA 3QVBA 2WE9A 2P6WA 4EE4A 1WT0A 2Q4JA 2A8UA 3V8ZA 1VZXA 1G23A 3IOHA 4IRQA 1EZIA 3I0HA 2RITA 4Y62A 3ZGGA 2YESA 1KNKA 1KWSA 2NXVA 2ICYA 2VFZA 1ZCYA 3ZLKA 1SS9A 2J0AA 3OKRA 3Q7UA 1INIA 5FTSA 4ASYA 2JCKA 3JTJA 4KRVA 4BMAA 5C8RA 1G2VA 1HM0A 1IV3A 4ECMA 2AESA 1NF5B 5CMJA 3SX3A 2DPWA 1H7TA 4Y63A 5CQNX 4ZDQA 3IKEA 4MIXA 3CKOA 1H4EA 1VM8A 3EE5A 4B2WA 2RJ6A 1G97A 3F0GA 5CMGX 1VGUA 2OI6A 1E5KA 5C4FA 4EEOA 4Y6UA 2AGDA 1O7QA 1ZI4A 1NMMB 3PKQA 3SXGA 1JVDA 3CKVA 5C1LA 2RIXA 1ZCUA 4Y7GA 3I0JA 1I52A 3CKJA 1ZIZA 1FZWA 1VGZA 1TW5A 3I0DA 3CGXA 4MYBA 1H5SB 2J0BA 3P0ZA 2UZHA 2D0JA 3POLA 1GX4A 3OH3A 3I0GA 4CVHA 1VHAA 1GQCA 4CJCA 4NANA 2X65A 3IKFA 1FGXA 5B8FA 1W57A 4R7PA 4FRPA 5C4DA 1PZYB 2V0KA 1LL2A 2OEFA 2P72A 1V84A 4M2BA 1HM8A 2GZLA 1KNJA 1GWWA 2AECA 3V0LA 1H5TA 2Z87A 4FQWA 2V0LA 3N9WA 2QH5A 3PKPA 1QG8A 5FV9A 4C2SA 4C8GA 1WVCA 2FY7A 1FR8A 2V0JA 1G0RA 2RJ7A 1R7XA 2W0WA 4FRBA 3U2XA 3R2WA 1FGGA 4FCUA 3O3PA 1YQNA 1IV1A 2BO6A 2JCLA 4C8EA 2VS5A 1FR9A 1HJLA 4FRHA 1G9RA 1W77A 4NAIA 3FPIA 2FYBA 3OH4A 1T0AA 4HG6A 5AJOA 1FWYA 4BQHA 4HO2A 4CJ8A 5J49A 2X5ZA 1H7QA 2FFUA 2VSIA 1FO9A 5L6SA 4O6NA 2YQJA 1XHBA 5BXCA 4KPXA 1ZI1A 2E3DA 3EORA 4FREA 4KC4A 4KC2A 1ZHJA 3DJ4A 3ELCA 1G8OA 3Q80A 3OH2A 1ON8A 1Z90A 4B4GA 4LW6A 3U0YA 5C4BA 1FRWA 5CQLX 4KNRA 2RJ9A 2FYAA 4FRAA 3SXDA 2RIZA 3K14A 2BO8A 1MP5A 2W0VA 1W55A 4ASJA 4D0ZA 1G1LA 3SXBA 4GBPA 4G3QA 1WT2A 3RMVA 2Y4LA 1WSZA 3F0DA 4K6RA 5DDVA 2AM5A 1VGTA 2X60A 1OMZA 1MC3A 2Y7AA 1JY8A 1H7FA 3SX8A 3USQA 4B5BA 2Y4MA 2AMTA 4B3UA 5C3DA 2AM3A 4C81A 3RE3A 1ZJ3A 1R7UA 3E26A 5C4CA 4EE5A 2P73A 1FG5N 4D11C 4EEAA 3OGZA 5C1HA 1GWVA 1NQIB 1H47A 4D48A 2E8BA 3ERNA 4IRPA 4B2XA 1TZFA 1S4PA 4AC3A 3DUVA 4G3SA 5C49A 3E25A 2O1HA 3LW6A 5C3BA 1ZI3A 3TZTA 1R7VA 5D92A 2Z86A 5CMFX 3USRA 2WVKA 5DDTA 1G93A 1H5TB 4HO4A 2VS3A 4MNDA 4FRLA 2WAWA 2PMPA 5C38A 3I0FA 4KQLA 1ZDFA 3CU0A 1FO8A 1U40A 1JV3A 3F0EA 5AJPA 3FBAA 5EIYA 1R7YA 2I5KA 3V91A 2X5SA 5C4EA 2YQHA 1U3LA 2XMHA 2VK9A 3JVHA 1G3LA 1GX0A 1VH3A 3CKQA 1U3PA 4HO6A 5EJZA 3OH0A 2JCOA 3V0QA 3U2WA 2C0NA 1H48A 4AAWA 5CQOA 1YP2A 4Y64A 2RJ5A 1VZTA 1NKHB 2AE7A 4FIXA 1K4VA 4DECA 2RJ4A 1JYLA 4KNXA 5C47A 1JVGA 1JV1A 1VGWA 3SXEA 3I0KA 2BO4A 1IV4A 2WVLA 3V0PA 3F6MA 1FXOA 2V0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T7N A;  4FRM A;  3V0N A;  4EVW A;  3OAM A;  1ZCV A;  1H5S C;  3R3I A;  4C82 A;  1H7G A;  4YS8 A;  3IEW A;  1PZT A;  1ZJO A;  3F1C A;  3I0E A;  4FRO A;  2OI7 A;  1HM9 A;  1R7T A;  1XZ6 A;  1YP3 A;  5EJ1 A;  3HL3 A;  1LZI A;  2XWL A;  2YCM A;  4KC1 A;  2PA4 A;  5AJN A;  3IOI A;  3T7O A;  4EEM A;  4HO0 A;  3Q4S A;  2RJ1 A;  1O23 B;  1TW1 A;  1R82 A;  4Y7U A;  4HOC A;  5C3A A;  1VZU A;  2Y6P A;  5FTV A;  2V0I A;  2BO7 A;  2ZU8 A;  1HV9 A;  1GX1 A;  2AH9 A;  3Q8H A;  4JD0 A;  4HO5 A;  1H5S A;  4B4M A;  3JUK A;  2ZU9 A;  1H7H A;  1O0R A;  2RJ0 A;  1WT1 A;  1ZCT A;  5FU8 A;  1H7E A;  4M28 A;  4D0T A;  4DE7 A;  1H5R A;  4HO8 A;  3V8Y A;  1JN1 A;  5JQQ A;  1V82 A;  4FRQ A;  3D8V A;  5CMI A;  5L6V A;  2O1G A;  3U2U A;  1LZ0 A;  2XME A;  3I0C A;  3ZLL A;  3F0F A;  2Y4K A;  1ZJP A;  2VSH A;  2MZB A;  4UEG A;  2FYC B;  1R81 A;  1GA8 A;  1OMX A;  2RIY A;  5IDS A;  4J18 A;  2APC A;  1LVW A;  4Y9X A;  2ZU7 A;  1ZJ1 A;  5C48 A;  3RMW A;  1VPA A;  4HO3 A;  2YQS A;  4KPZ A;  1ON6 A;  2I7B A;  5FUH A;  3V0M A;  1LZJ A;  1ZJ2 A;  3D5N A;  2OEG A;  1R80 A;  3MBM A;  4M2A A;  1YRO B;  2UX8 A;  5C1G A;  1QGS A;  1U43 A;  3T80 A;  5IDT A;  4P02 A;  2VS4 A;  1JYK A;  1INJ A;  3I0I X;  1VIC A;  4E1K A;  2XWM A;  3RSB A;  3P10 A;  4ARW A;  2YQC A;  2ICX A;  5I1F A;  1V83 A;  3GUE A;  3K2X A;  2YC5 A;  2WVM A;  3QHD A;  1ZDG A;  2I5E A;  2PGV A;  1H5S D;  3JUJ A;  3FOQ A;  3FWW A;  1NWG B;  2QGI A;  4HCQ A;  3SXA A;  3F1Y A;  4HO9 A;  4KXO A;  1NHE B;  2A8W A;  4B4B A;  3IOJ A;  1FXJ A;  3U2V A;  4NAK A;  3ST8 A;  4NAL A;  3SX5 A;  3V0O A;  2D7R A;  1OQM B;  3K8E A;  2FYD B;  3V90 A;  5FYE A;  1QWJ A;  4AYL A;  2RJ8 A;  1GQ9 A;  2AM4 A;  1IV2 A;  5CQP A;  3ESJ A;  1LL0 A;  3BCV A;  3KE1 A;  1H4D A;  1HJJ A;  1S4N A;  2PX7 A;  4CJB A;  5CQM X;  2FFV A;  1TVY A;  4Y7F A;  3B6N A;  2VD4 A;  1MP4 A;  2Y4J A;  3ZGF A;  4Y7T A;  4Y7V A;  4D11 A;  1ZJ0 A;  2QKX A;  3ZF8 A;  3BRK X;  1QGQ A;  3SX7 A;  3IEQ A;  2O1F A;  1IIM A;  5C36 A;  3OC9 A;  4AYJ A;  4KT7 A;  2GGQ A;  2OI5 A;  1G95 A;  4EE3 A;  3PNN A;  4G87 A;  1EYR A;  3OH1 A;  4FCE A;  2VXL A;  4XWI A;  3GHZ A;  2WEE A;  1H5R B;  2WGZ A;  1H4C A;  3SXC A;  1IIN A;  4C8I A;  2CU2 A;  4LW3 A;  1LL3 A;  4P00 A;  2GGO A;  3KIA A;  3NGW A;  5CMH A;  4JIS A;  3U0X A;  1YP4 A;  3D98 A;  2VXM A;  1H3M A;  1MP3 A;  2YC3 A;  2JCJ A;  1ZI5 A;  5HS2 A;  1S4O A;  4B42 A;  1WT3 A;  1VH1 A;  2PGY A;  3T7M A;  3TQD A;  3CKN A;  3DK5 A;  1VH8 A;  4EEG A;  5IFY A;  1O7O A;  1H7L A;  2D7I A;  3K8D A;  3I0L A;  3U2T A;  5FU0 A;  4DDZ A;  4G3P A;  4L41 C;  3SPT A;  4M4K A;  2XWN A;  1LZ7 A;  1FOA A;  4FRD A;  4Y6N A;  3QVB A;  2WE9 A;  2P6W A;  4EE4 A;  1WT0 A;  2Q4J A;  2A8U A;  3V8Z A;  1VZX A;  1G23 A;  3IOH A;  4IRQ A;  1EZI A;  3I0H A;  2RIT A;  4Y62 A;  3ZGG A;  2YES A;  1KNK A;  1KWS A;  2NXV A;  2ICY A;  2VFZ A;  1ZCY A;  3ZLK A;  1SS9 A;  3OKR A;  3Q7U A;  1INI A;  5FTS A;  4ASY A;  2JCK A;  3JTJ A;  4KRV A;  4BMA A;  5C8R A;  1G2V A;  1HM0 A;  1IV3 A;  4ECM A;  2AES A;  1NF5 B;  5CMJ A;  3SX3 A;  2DPW A;  1H7T A;  4Y63 A;  5CQN X;  4ZDQ A;  3IKE A;  3CKO A;  1H4E A;  1VM8 A;  3EE5 A;  4B2W A;  2RJ6 A;  1G97 A;  3F0G A;  5CMG X;  1VGU A;  2OI6 A;  1E5K A;  5C4F A;  4EEO A;  4Y6U A;  2AGD A;  1O7Q A;  1ZI4 A;  1NMM B;  3PKQ A;  3SXG A;  1JVD A;  3CKV A;  5C1L A;  2RIX A;  1ZCU A;  4Y7G A;  3I0J A;  1I52 A;  3CKJ A;  1ZIZ A;  1FZW A;  1VGZ A;  1TW5 A;  3I0D A;  3CGX A;  4MYB A;  1H5S B;  3P0Z A;  2UZH A;  2D0J A;  3POL A;  1GX4 A;  3OH3 A;  3I0G A;  4CVH A;  1VHA A;  1GQC A;  4CJC A;  4NAN A;  2X65 A;  3IKF A;  1FGX A;  5B8F A;  1W57 A;  4R7P A;  4FRP A;  5C4D A;  1PZY B;  2V0K A;  1LL2 A;  2OEF A;  2P72 A;  1V84 A;  4M2B A;  1HM8 A;  2GZL A;  1KNJ A;  1GWW A;  2AEC A;  3V0L A;  1H5T A;  2Z87 A;  4FQW A;  2V0L A;  3N9W A;  2QH5 A;  3PKP A;  1QG8 A;  5FV9 A;  4C2S A;  4C8G A;  1WVC A;  2FY7 A;  1FR8 A;  2V0J A;  1G0R A;  2RJ7 A;  1R7X A;  2W0W A;  4FRB A;  3U2X A;  3R2W A;  1FGG A;  4FCU A;  3O3P A;  1YQN A;  1IV1 A;  2BO6 A;  2JCL A;  4C8E A;  2VS5 A;  1FR9 A;  1HJL A;  4FRH A;  1G9R A;  1W77 A;  4NAI A;  3FPI A;  2FYB A;  3OH4 A;  1T0A A;  4HG6 A;  5AJO A;  1FWY A;  4BQH A;  4HO2 A;  4CJ8 A;  5J49 A;  2X5Z A;  1H7Q A;  2FFU A;  2VSI A;  1FO9 A;  5L6S A;  2YQJ A;  1XHB A;  5BXC A;  4KPX A;  1ZI1 A;  2E3D A;  3EOR A;  4FRE A;  4KC4 A;  4KC2 A;  1ZHJ A;  3DJ4 A;  3ELC A;  1G8O A;  3Q80 A;  3OH2 A;  1ON8 A;  1Z90 A;  4B4G A;  4LW6 A;  3U0Y A;  5C4B A;  1FRW A;  5CQL X;  4KNR A;  2RJ9 A;  2FYA A;  4FRA A;  3SXD A;  2RIZ A;  3K14 A;  2BO8 A;  1MP5 A;  2W0V A;  1W55 A;  4ASJ A;  4D0Z A;  1G1L A;  3SXB A;  4GBP A;  4G3Q A;  1WT2 A;  3RMV A;  2Y4L A;  1WSZ A;  3F0D A;  4K6R A;  5DDV A;  2AM5 A;  1VGT A;  2X60 A;  1OMZ A;  1MC3 A;  2Y7A A;  1JY8 A;  1H7F A;  3SX8 A;  3USQ A;  4B5B A;  2Y4M A;  2AMT A;  4B3U A;  5C3D A;  2AM3 A;  4C81 A;  3RE3 A;  1ZJ3 A;  1R7U A;  3E26 A;  5C4C A;  4EE5 A;  2P73 A;  1FG5 N;  4D11 C;  4EEA A;  3OGZ A;  5C1H A;  1GWV A;  1NQI B;  1H47 A;  4D48 A;  2E8B A;  3ERN A;  4IRP A;  4B2X A;  1TZF A;  1S4P A;  4AC3 A;  3DUV A;  4G3S A;  5C49 A;  3E25 A;  2O1H A;  3LW6 A;  5C3B A;  1ZI3 A;  3TZT A;  1R7V A;  2Z86 A;  5CMF X;  3USR A;  2WVK A;  5DDT A;  1G93 A;  1H5T B;  4HO4 A;  2VS3 A;  4MND A;  4FRL A;  2WAW A;  2PMP A;  5C38 A;  3I0F A;  4KQL A;  1ZDF A;  3CU0 A;  1FO8 A;  1U40 A;  1JV3 A;  3F0E A;  5AJP A;  3FBA A;  5EIY A;  1R7Y A;  2I5K A;  3V91 A;  2X5S A;  5C4E A;  2YQH A;  1U3L A;  2XMH A;  3JVH A;  1G3L A;  1GX0 A;  1VH3 A;  3CKQ A;  1U3P A;  4HO6 A;  5EJZ A;  3OH0 A;  2JCO A;  3V0Q A;  3U2W A;  1H48 A;  4AAW A;  5CQO A;  1YP2 A;  4Y64 A;  2RJ5 A;  1VZT A;  1NKH B;  2AE7 A;  1K4V A;  4DEC A;  2RJ4 A;  1JYL A;  4KNX A;  5C47 A;  1JVG A;  1JV1 A;  1VGW A;  3SXE A;  3I0K A;  2BO4 A;  1IV4 A;  2WVL A;  3V0P A;  3F6M A;  1FXO A;  2V0H A; 
#chains in the Genus database with same CATH topology
 3T7N A;  4I4T A;  4FRM A;  3V0N A;  4EVW A;  3OAM A;  1ZCV A;  1H5S C;  3RYI B;  3R3I A;  4C82 A;  1H7G A;  4YS8 A;  1OFU A;  3IEW A;  4BVQ A;  5IJ0 B;  1W58 1;  1PZT A;  1ZJO A;  3F1C A;  4TV8 A;  5KX5 A;  2HP0 B;  2KTV A;  3I0E A;  2VAW A;  2W8B C;  3WJR A;  5LA6 B;  4FRO A;  3FD5 A;  3CCM F;  2OI7 A;  4EI8 A;  1HM9 A;  1R7T A;  1XZ6 A;  1YP3 A;  5EJ1 A;  2NMU A;  5FNV B;  1W59 A;  3HL3 A;  1LZI A;  2GLZ A;  5MN6 A;  2XWL A;  1W40 A;  2HX0 A;  1FNJ A;  4TUY B;  2PA4 A;  2YCM A;  5AJN A;  4DRX B;  4TV9 A;  3IOI A;  1YIT F;  3T7O A;  5GON A;  5HWE A;  5KMG A;  4EEM A;  2CHS A;  4HO0 A;  5CB4 B;  2AIZ P;  3JAK A;  3Q4S A;  2RJ1 A;  1YGY A;  1O23 B;  1TW1 A;  1R82 A;  1XV2 A;  4Y7U A;  5EYP A;  3HWU A;  1KD1 H;  3HKE A;  4O4L A;  4HOC A;  5C3A A;  1K73 H;  1VZU A;  2Y6P A;  5FTV A;  3M4S A;  4FFB A;  3ZP4 A;  2RHH A;  2V0I A;  3N2G B;  2BO7 A;  2ZU8 A;  5EIB C;  1HV9 A;  2CZW A;  1GX1 A;  4ZHQ A;  5IJ9 B;  5BMV A;  2AH9 A;  5AVM A;  4F6R B;  3CCJ F;  1FSZ A;  1Q8R A;  2RHJ A;  3Q8H A;  3RYH A;  4JD0 A;  3NVK E;  4HO5 A;  1H5S A;  4B4M A;  3FFM A;  3JUK A;  2ZU9 A;  1H7H A;  1O0R A;  2RJ0 A;  1WT1 A;  1ZCT A;  4WBN B;  5LP6 C;  5FU8 A;  1H7E A;  4M28 A;  4D0T A;  2Q1Y A;  3QUW A;  5CA0 A;  1JFF B;  5LOV B;  1H5R A;  4HO8 A;  1ODE A;  3V8Y A;  1JN1 A;  4DE7 A;  1PF5 A;  5JQQ A;  1V82 A;  3WGN A;  4FRQ A;  3HTN A;  3D8V A;  5D91 A;  3NK6 A;  5HY0 A;  4ZHW A;  5CMI A;  3M84 A;  5L6V A;  2O1G A;  1S72 F;  1LZ0 A;  3ZP7 A;  5JCO C;  2XME A;  5IJ0 A;  3G6E F;  3I0C A;  3U2U A;  3CC2 F;  3ZLL A;  2DT4 A;  3F0F A;  2Y4K A;  1ZJP A;  3V3T A;  2VSH A;  2MZB A;  4UEG A;  2FYC B;  3CCL F;  1R81 A;  3UT5 A;  1GA8 A;  1OMX A;  3CCQ F;  2RIY A;  5IDS A;  3CMA F;  4O4I A;  1VQ7 F;  3RYF A;  4J18 A;  2APC A;  1LVW A;  3N2K A;  4Y9X A;  3WGK A;  2FGY A;  2ZU7 A;  4B46 A;  1W5A A;  1W42 A;  1VPA A;  1ZJ1 A;  4HO3 A;  2YQS A;  1GO0 A;  4KPZ A;  3RMW A;  5C48 A;  1ON6 A;  1RQ2 A;  1UI9 A;  4G4Y A;  2I7B A;  1LZJ A;  2UYK A;  2OTJ F;  1ZJ2 A;  5FUH A;  3D5N A;  3V0M A;  2OEG A;  1GZ0 A;  1R80 A;  5CA1 B;  3MBM A;  3LWO C;  4M2A A;  1YRO B;  3RYC A;  2UX8 A;  4B62 A;  3WJP A;  5C1G A;  4BVS A;  1QGS A;  3NMU C;  1U43 A;  3V7E A;  3JCM M;  3T80 A;  3N2G A;  3VMF B;  5IDT A;  2HS0 A;  1Q82 H;  4P02 A;  2LCA A;  1IPA A;  4BVR A;  2VS4 A;  1TVK A;  2WAL A;  1JYK A;  1INJ A;  4F6R A;  2VAP A;  2L26 A;  3MDO A;  3V7Q A;  1VIC A;  4EI9 A;  3I0I X;  4I50 B;  2VXY A;  3LWR C;  2XWM A;  4E1K A;  4X20 A;  3P10 A;  3RA5 A;  3FD6 A;  2YQC A;  2ICX A;  3RSB A;  4ARW A;  5I1F A;  1KC8 H;  1FFX A;  1V83 A;  5A2Q M;  3GUE A;  5LYJ B;  3K2X A;  4U39 A;  2F9Z C;  5LP6 B;  4X3L A;  3QHD A;  1ZDG A;  1YHQ F;  2I5E A;  3PLA C;  1H5S D;  3V4D A;  2PGV A;  2WVM A;  2QTP A;  3FOQ A;  3FWW A;  1NWG B;  2QGI A;  4X1I B;  4HCQ A;  3SXA A;  3F1Y A;  4HO9 A;  4LCK A;  3OON A;  2V9Y A;  1VQO F;  5HXU A;  2B33 A;  5JQG B;  1SDS A;  4KXO A;  1NHE B;  1VQL F;  3VO8 A;  2A8W A;  5JH7 B;  1JD1 A;  5ITZ A;  1FNK A;  3HKB B;  1FXJ A;  3IOJ A;  4NAK A;  3KJK A;  2OZB A;  4NAL A;  3ST8 A;  2D7R A;  3SX5 A;  3V0O A;  4R40 B;  1OQM B;  4BW0 B;  2FYD B;  3K8E A;  3VI6 A;  5JVD B;  4O4J A;  3VIU A;  1QWJ A;  5FYE A;  3V90 A;  4AYL A;  3D54 A;  3CPW F;  2RJ8 A;  3L7Q A;  1GQ9 A;  2AM4 A;  2HS4 A;  1IV2 A;  2DYY A;  2N48 A;  3N4Z A;  5C4C A;  5CQP A;  3ESJ A;  4TV8 B;  1LL0 A;  4ZHY B;  2HP0 A;  1Q81 H;  3LME A;  4X1K B;  1NMU B;  3CCS F;  2AGD A;  3BCV A;  3KE1 A;  3BYQ A;  1H4D A;  2OTM A;  4YJ3 A;  5G4U C;  5J2T A;  1HJJ A;  2YYE A;  5FNV A;  1S4N A;  2PX7 A;  3OBW A;  4CJB A;  4ZI7 A;  5LXT A;  5CQM X;  2FFV A;  3S0W A;  2ZOV A;  2KGW A;  4DRX A;  1TVY A;  4Q7C A;  4Y7F A;  3B6N A;  3S02 A;  4E6E A;  2VD4 A;  1MP4 A;  2Y4J A;  4O6M A;  3J80 M;  3ZGF A;  4Y7T A;  4Y7V A;  1VQ9 F;  4G4W A;  4D11 A;  5C8Y A;  1ZJ0 A;  2QKX A;  3JAT A;  3JAL B;  3ZF8 A;  1M90 H;  3BRK X;  3M1X A;  4FFB B;  1QGQ A;  5JCO A;  5HY4 A;  3SX7 A;  3IEQ A;  2O1F A;  4EB6 B;  5GIP C;  1IIM A;  3CC4 F;  2YXZ A;  5HP8 A;  3LYB A;  1W3E X;  5C36 A;  3OC9 A;  4ZHQ B;  4AYJ A;  3LWQ C;  4KT7 A;  2GGQ A;  2I6R A;  1VQ6 F;  2ZAU A;  4G4X A;  2OI5 A;  1JJ2 F;  1G95 A;  4EE3 A;  3PNN A;  4G87 A;  1EYR A;  3OH1 A;  4FCE A;  2VXL A;  5JH7 A;  3E22 A;  3JAW B;  4G4Z A;  4XWI A;  3GHZ A;  2WEE A;  5CA0 B;  5LOV A;  1H5R B;  2WGZ A;  5EB0 A;  2UYN A;  4I55 B;  2ZVY A;  1H4C A;  3SXC A;  1QVG F;  2QI2 A;  4O4J B;  1IIN A;  4C8I A;  1X7O A;  3G4S F;  3J7A R;  1X7P A;  2CU2 A;  4LW3 A;  5LA6 A;  1Z5W A;  1LL3 A;  4P00 A;  2GGO A;  4O2B B;  1SA0 A;  3KIA A;  2Z1U A;  4ZK7 A;  3NGW A;  4JIS A;  5CMH A;  3U0X A;  1YP4 A;  2LBW A;  2VXM A;  3D98 A;  1H3M A;  1MP3 A;  2YC3 A;  2JCJ A;  3UT5 B;  1ZI5 A;  5IYZ B;  5HS2 A;  1S4O A;  4B42 A;  1WT3 A;  1Q86 H;  5J2T B;  3CYQ A;  3JAS B;  1VH1 A;  2IG8 A;  2PGY A;  3KHN A;  5CB4 A;  3CKN A;  3DK5 A;  1VH8 A;  2Z1T A;  3T7M A;  3TQD A;  4EEG A;  5IFY A;  4BT3 A;  1H7L A;  4BT7 A;  4U3J A;  1O7O A;  2D7I A;  3K8D A;  3I0L A;  3U2T A;  5FU0 A;  4DDZ A;  4G3P A;  4L41 C;  3SPT A;  2UYP A;  2XWN A;  2OTL F;  1LZ7 A;  2HS3 A;  1XHO A;  3NVI B;  1FOA A;  4FIY A;  4M4K A;  1KQS F;  2HVY D;  4FRD A;  3AGK A;  3VOB A;  4Y6N A;  4M8I A;  3S06 A;  3JAR A;  3QVB A;  3HJW C;  2WE9 A;  2P6W A;  4EE4 A;  1WT0 A;  2Q4J A;  4C4W C;  3RA6 A;  2A8U A;  3V8Z A;  1VZX A;  1G23 A;  3IOH A;  1ONI A;  2VAM A;  3GYQ A;  3HKC A;  1RLG A;  3I55 F;  1EZI A;  3I0H A;  3CC7 F;  4IRQ A;  4WBN A;  2RIT A;  4YJ2 B;  3VCZ A;  4Y62 A;  3ZGG A;  2YES A;  1KNK A;  1KWS A;  3MQW A;  4G4V A;  2NXV A;  2ZF8 A;  4PWT A;  4NQ3 A;  2ICY A;  2VFZ A;  1ZCY A;  1CK2 A;  3ZLK A;  1TUB A;  4BT4 A;  1SS9 A;  2J0A A;  3OKR A;  3Q7U A;  1INI A;  5FTS A;  4ASY A;  2JCK A;  3JTJ A;  4KRV A;  1PXW A;  3J81 M;  1G2V A;  4BMA A;  5C8R A;  4X1I A;  1HM0 A;  1IV3 A;  3K12 A;  3WPW A;  1YJN F;  4ECM A;  2AIF A;  3WGL A;  2AES A;  1VQN F;  2RB9 A;  4BVT A;  1NF5 B;  4LNU B;  5CMJ A;  4IIJ A;  3SX3 A;  2VGM A;  1W5E A;  2DPW A;  3RYF B;  3C9S A;  4XCQ A;  1H7T A;  4Y63 A;  5CQN X;  1X25 A;  4ZDQ A;  3IKE A;  3TD3 A;  4MIX A;  3CKO A;  1W5B A;  1H4E A;  1VM8 A;  3EE5 A;  4B2W A;  2RJ6 A;  3RYI A;  1G97 A;  3F0G A;  5J2U A;  1VGU A;  2ZVZ A;  1K9M H;  2OI6 A;  3S0H A;  5CMG X;  1E5K A;  5C4F A;  5EO3 A;  4EEO A;  4Y6U A;  4BT6 A;  5HP7 A;  1Q7Y H;  3IMP A;  2IQQ A;  5GON B;  5CA1 A;  5KX5 B;  4TZZ A;  1T0K B;  1O7Q A;  1ZI4 A;  3LWP C;  1NMM B;  3PKQ A;  3SXG A;  3S03 A;  1JVD A;  3CKV A;  5C1L A;  4RHA A;  2RIX A;  5EIB D;  1ZCU A;  4Y7G A;  5HY1 A;  3JUJ A;  4O4L B;  1TVK B;  5GAP K;  4O4H B;  1I52 A;  3CKJ A;  3I0J A;  1ZIZ A;  1OAP A;  5KMG B;  2RHL A;  1FZW A;  4ERH A;  3PAF A;  2Z1E A;  3HKC B;  3VOA A;  1VGZ A;  2RHO A;  1TW5 A;  3I0D A;  3CGX A;  4MYB A;  4HNA B;  3WXM B;  2BTO A;  3CCV F;  3P0Z A;  2UZH A;  1H5S B;  2D0J A;  2J0B A;  2OHW A;  1COM A;  3HKE B;  1GX4 A;  3POL A;  3OH3 A;  3I0G A;  4CVH A;  2Z1F A;  1VHA A;  1GQC A;  4CJC A;  4NAN A;  2X65 A;  3IKF A;  5C8Y B;  2QEX F;  3SIU A;  1FGX A;  5HY2 A;  3I3F A;  5BMV B;  4X3M A;  5B8F A;  1W57 A;  4R7P A;  3RYH B;  4FRP A;  5C4D A;  3VYT C;  1PZY B;  3QTY A;  2V0K A;  2ALE A;  1LL2 A;  2OEF A;  1VQ8 F;  3C8L A;  2P72 A;  1V84 A;  3N4Y A;  4LNU A;  1QAH A;  4M2B A;  2P6Y A;  5MN4 A;  2GZL A;  1KNJ A;  1GWW A;  1HM8 A;  2AEC A;  1H5T A;  3V0L A;  5EAZ A;  2Z87 A;  4FQW A;  3HKD B;  4BT2 A;  2V0L A;  3N9W A;  2ZOD A;  2QH5 A;  3CCR F;  3P4E A;  5J2U B;  5EZY A;  1YIJ F;  2H8C A;  1QG8 A;  3PKP A;  5FV9 A;  2GVI A;  2UYN B;  4I55 A;  2FC3 A;  3NK7 A;  5MN5 A;  4C8G A;  1WVC A;  2LBX A;  2FY7 A;  1FR8 A;  2V0J A;  4C2S A;  4DXD A;  3ZO8 A;  4X1K A;  3O85 A;  3LFO A;  1QVF F;  1RLU A;  1G0R A;  1R7X A;  2RJ7 A;  1H7M A;  2W0W A;  4FRB A;  3U2X A;  3R2W A;  3I56 F;  5G4V C;  3TD4 A;  1FGG A;  4FCU A;  4ZI7 B;  3O3P A;  1K8A H;  3KJJ A;  2BO1 A;  3CPQ A;  1YQN A;  1IV1 A;  4O2A A;  2KTU A;  4C8E A;  1YI2 F;  2BO6 A;  2JCL A;  1FR9 A;  2VS5 A;  1HJL A;  4FRH A;  1G9R A;  2HQS C;  2EWC A;  4X1Y A;  4KWE A;  5IT9 M;  4ZOL B;  1W77 A;  2VGN A;  4NAI A;  3FPI A;  2Q1X A;  4I50 A;  3RYC B;  2FYB A;  4X20 B;  1T0A A;  3JAK B;  3OH4 A;  1FWY A;  4HG6 A;  5AJO A;  4BQH A;  3VYU C;  5GAN K;  3C9R A;  4HO2 A;  4CJ8 A;  2Z01 A;  5HXZ A;  4EB6 A;  3CYP B;  5LP6 A;  2HRY A;  5J49 A;  3R0P A;  2QA4 F;  1VQK F;  2X5Z A;  1H7Q A;  2FFU A;  3CXC F;  4B5C A;  2VSI A;  5FJ4 C;  3WGM A;  1FO9 A;  5L6S A;  4NWO B;  4O6N A;  5DCV A;  2YQJ A;  3C9T A;  3HAX D;  1XHB A;  5BXC A;  3JAM M;  4KPX A;  3HKD A;  4RQO A;  1ZI1 A;  2E3D A;  3MCA B;  3EOR A;  3D00 A;  4FRE A;  4KC4 A;  4KC2 A;  1VQM F;  1TUB B;  2G9I A;  1ZHJ A;  3DJ4 A;  3ELC A;  2CHT A;  1G8O A;  4O2B A;  3OH2 A;  1ON8 A;  3Q80 A;  1Z90 A;  2BTQ B;  3U2V A;  4B4G A;  5JQG A;  4LW6 A;  2IAF A;  3CD6 F;  3U0Y A;  5C4B A;  5IYZ A;  1FRW A;  5CQL X;  4KNR A;  2RJ9 A;  2FYA A;  5FLX M;  3CG6 A;  4G88 A;  4FRA A;  4KC1 A;  3HKB A;  2HRU A;  3GTZ A;  3SXD A;  2K1S A;  4TUY A;  1YJ9 F;  2RIZ A;  3K14 A;  4TV9 B;  2BTU A;  2BO8 A;  1W2B F;  1MP5 A;  1W55 A;  2W0V A;  4YJ3 B;  4ASJ A;  3IR9 A;  4O4I B;  1E7K A;  4D0Z A;  1G1L A;  2YC5 A;  3SXB A;  3CB2 A;  2LBT A;  4X1Y B;  3DDN A;  3N2K B;  3E1Y A;  2PHN A;  4G3Q A;  4ZOL A;  1QD9 A;  1WT2 A;  3RMV A;  1ZWZ A;  3K0T A;  5EB1 B;  2R6R 1;  2Y4L A;  1WSZ A;  3F0D A;  5EYP B;  4K6R A;  1X52 A;  1RA4 A;  3JAR B;  5DDV A;  3WGJ A;  4BY9 D;  1VGT A;  2AM5 A;  2X60 A;  4B4B A;  2I6D A;  1OMZ A;  2HP3 A;  5GIN C;  1NQ3 A;  3G71 F;  4IHJ B;  1CN7 A;  5LXT B;  1MC3 A;  2Y7A A;  1JY8 A;  3JAL A;  5GIO C;  2H6L A;  4ZHV A;  3MCQ A;  4O4H A;  1H7F A;  1N8R H;  3SX8 A;  3USQ A;  4B5B A;  1R1M A;  3TD5 A;  2Y4M A;  2AMT A;  4B3U A;  5C3D A;  2AM3 A;  3DC2 A;  3E20 B;  4C81 A;  1VQV A;  3RE3 A;  4EI7 A;  1RQ7 A;  2H8E A;  1VQP F;  3OW2 F;  1R7U A;  1ZJ3 A;  2UYJ A;  3E26 A;  2P73 A;  1JFF A;  3LDT A;  4EE5 A;  1FG5 N;  3ON1 A;  1FFX B;  1VK3 A;  3JAW A;  3OGZ A;  4D11 C;  5C1H A;  1GWV A;  1NQI B;  1H47 A;  3CME F;  4D48 A;  4EEA A;  1UFY A;  4B45 A;  3CCU F;  3U0O A;  1VQ5 F;  2E8B A;  1M1K H;  3S0Y A;  3ERN A;  4IRP A;  1SZQ A;  4B2X A;  1GO1 A;  1TZF A;  1S4P A;  4AC3 A;  3DUV A;  4G3S A;  5C49 A;  2CW4 A;  3E25 A;  2O1H A;  3LW6 A;  5C3B A;  1YJW F;  1ZI3 A;  2CWJ A;  1R7V A;  3TZT A;  5D92 A;  3E22 B;  2Z86 A;  5CMF X;  3USR A;  2WVK A;  5DDT A;  1G93 A;  4I4T B;  1W5F A;  2CSL A;  1H5T B;  1CLI A;  2CVL A;  1Z5V A;  4HO4 A;  2VS3 A;  4MND A;  3LWV C;  4FRL A;  2WAW A;  2PMP A;  3ZOP A;  5C38 A;  3SIV A;  3I0F A;  2MQE A;  3OBY A;  5EWR A;  4KQL A;  1ZDF A;  3CU0 A;  1FO8 A;  1U40 A;  1JV3 A;  5JVD A;  1SA0 B;  1DBF A;  4BT5 A;  3F0E A;  3KIZ A;  5AJP A;  4NUT A;  3FBA A;  1NJI H;  1J7H A;  5EIY A;  1R7Y A;  2I5K A;  1XBI A;  3JAS A;  3V91 A;  4IHJ A;  2X5S A;  5C4E A;  2YQH A;  1U3L A;  3I7T A;  2XMH A;  2KG4 A;  3VTI C;  3C9U A;  4U3J B;  2VK9 A;  4O2A B;  4HNA A;  3JVH A;  1G3L A;  3CCE F;  3D01 A;  1GX0 A;  1VH3 A;  3CKQ A;  4GBP A;  1U3P A;  4HO6 A;  5EJZ A;  3WJQ A;  1DT9 A;  2JCO A;  3OH0 A;  3U2W A;  3V0Q A;  4YJ2 A;  5LYJ A;  2C0N A;  1H48 A;  3VYS C;  4AAW A;  2R75 1;  5CQO A;  1YP2 A;  4Y64 A;  2RJ5 A;  1VZT A;  2JNB A;  1NKH B;  2AE7 A;  3WPX A;  1K4V A;  4FIX A;  4DEC A;  1JYL A;  2RJ4 A;  1QU9 A;  3JAT B;  4KNX A;  5C47 A;  5IJ9 A;  1VQ4 F;  1JVG A;  1JV1 A;  1VGW A;  3SXE A;  3I0K A;  2BO4 A;  1IV4 A;  1XRG A;  2WVL A;  3V0P A;  1W41 A;  3F6M A;  1FXO A;  2V0H A;  5ITZ B;  4IIJ B;  5EZY B; 
#chains in the Genus database with same CATH homology
 3T7N A;  4FRM A;  3V0N A;  4EVW A;  3OAM A;  1ZCV A;  1H5S C;  3R3I A;  4C82 A;  1H7G A;  4YS8 A;  3IEW A;  1PZT A;  1ZJO A;  3F1C A;  3I0E A;  4FRO A;  2OI7 A;  1HM9 A;  1R7T A;  1XZ6 A;  1YP3 A;  5EJ1 A;  3HL3 A;  1LZI A;  2XWL A;  2YCM A;  4KC1 A;  2PA4 A;  5AJN A;  3IOI A;  3T7O A;  4EEM A;  4HO0 A;  3Q4S A;  2RJ1 A;  1O23 B;  1TW1 A;  1R82 A;  4Y7U A;  4HOC A;  5C3A A;  1VZU A;  2Y6P A;  5FTV A;  2V0I A;  2BO7 A;  2ZU8 A;  1HV9 A;  1GX1 A;  2AH9 A;  3Q8H A;  4JD0 A;  4HO5 A;  1H5S A;  4B4M A;  3JUK A;  2ZU9 A;  1H7H A;  1O0R A;  2RJ0 A;  1WT1 A;  1ZCT A;  5FU8 A;  1H7E A;  4M28 A;  4D0T A;  4DE7 A;  1H5R A;  4HO8 A;  3V8Y A;  1JN1 A;  5JQQ A;  1V82 A;  4FRQ A;  3D8V A;  5D91 A;  5CMI A;  5L6V A;  2O1G A;  3U2U A;  1LZ0 A;  2XME A;  3I0C A;  3ZLL A;  3F0F A;  2Y4K A;  1ZJP A;  2VSH A;  2MZB A;  4UEG A;  2FYC B;  1R81 A;  1GA8 A;  1OMX A;  2RIY A;  5IDS A;  4J18 A;  2APC A;  1LVW A;  4Y9X A;  2ZU7 A;  1ZJ1 A;  5C48 A;  3RMW A;  1VPA A;  4HO3 A;  2YQS A;  4KPZ A;  1ON6 A;  2I7B A;  5FUH A;  3V0M A;  1LZJ A;  1ZJ2 A;  3D5N A;  2OEG A;  1R80 A;  3MBM A;  4M2A A;  1YRO B;  2UX8 A;  5C1G A;  1QGS A;  1U43 A;  3T80 A;  5IDT A;  4P02 A;  2VS4 A;  1JYK A;  1INJ A;  3I0I X;  1VIC A;  4E1K A;  2XWM A;  3RSB A;  3P10 A;  4ARW A;  2YQC A;  2ICX A;  5I1F A;  1V83 A;  3GUE A;  3K2X A;  2YC5 A;  2WVM A;  3QHD A;  1ZDG A;  2I5E A;  2PGV A;  1H5S D;  3JUJ A;  3FOQ A;  3FWW A;  1NWG B;  2QGI A;  4HCQ A;  3SXA A;  3F1Y A;  4HO9 A;  4KXO A;  1NHE B;  2A8W A;  4B4B A;  3IOJ A;  1FXJ A;  3U2V A;  4NAK A;  3ST8 A;  4NAL A;  3SX5 A;  3V0O A;  2D7R A;  1OQM B;  3K8E A;  2FYD B;  3V90 A;  5FYE A;  1QWJ A;  4AYL A;  2RJ8 A;  1GQ9 A;  2AM4 A;  1IV2 A;  5CQP A;  3ESJ A;  1LL0 A;  3BCV A;  3KE1 A;  1H4D A;  1HJJ A;  1S4N A;  2PX7 A;  4CJB A;  5CQM X;  2FFV A;  1TVY A;  4Q7C A;  4Y7F A;  3B6N A;  2VD4 A;  1MP4 A;  2Y4J A;  4O6M A;  3ZGF A;  4Y7T A;  4Y7V A;  4D11 A;  1ZJ0 A;  2QKX A;  3ZF8 A;  3BRK X;  1QGQ A;  3SX7 A;  3IEQ A;  2O1F A;  1IIM A;  5C36 A;  3OC9 A;  4AYJ A;  4KT7 A;  2GGQ A;  2OI5 A;  1G95 A;  4EE3 A;  3PNN A;  4G87 A;  1EYR A;  3OH1 A;  4FCE A;  2VXL A;  4XWI A;  3GHZ A;  2WEE A;  1H5R B;  2WGZ A;  1H4C A;  3SXC A;  1IIN A;  4C8I A;  2CU2 A;  4LW3 A;  1LL3 A;  4P00 A;  2GGO A;  3KIA A;  3NGW A;  5CMH A;  4JIS A;  3U0X A;  1YP4 A;  3D98 A;  2VXM A;  1H3M A;  1MP3 A;  2YC3 A;  2JCJ A;  1ZI5 A;  5HS2 A;  1S4O A;  4B42 A;  1WT3 A;  1VH1 A;  2PGY A;  3T7M A;  3TQD A;  3CKN A;  3DK5 A;  1VH8 A;  4EEG A;  5IFY A;  1O7O A;  1H7L A;  2D7I A;  3K8D A;  3I0L A;  3U2T A;  5FU0 A;  4DDZ A;  4G3P A;  4L41 C;  3SPT A;  4M4K A;  2XWN A;  1LZ7 A;  1FOA A;  4FIY A;  4FRD A;  4Y6N A;  3QVB A;  2WE9 A;  2P6W A;  4EE4 A;  1WT0 A;  2Q4J A;  2A8U A;  3V8Z A;  1VZX A;  1G23 A;  3IOH A;  4IRQ A;  1EZI A;  3I0H A;  2RIT A;  4Y62 A;  3ZGG A;  2YES A;  1KNK A;  1KWS A;  2NXV A;  2ICY A;  2VFZ A;  1ZCY A;  3ZLK A;  1SS9 A;  2J0A A;  3OKR A;  3Q7U A;  1INI A;  5FTS A;  4ASY A;  2JCK A;  3JTJ A;  4KRV A;  4BMA A;  5C8R A;  1G2V A;  1HM0 A;  1IV3 A;  4ECM A;  2AES A;  1NF5 B;  5CMJ A;  3SX3 A;  2DPW A;  1H7T A;  4Y63 A;  5CQN X;  4ZDQ A;  3IKE A;  4MIX A;  3CKO A;  1H4E A;  1VM8 A;  3EE5 A;  4B2W A;  2RJ6 A;  1G97 A;  3F0G A;  5CMG X;  1VGU A;  2OI6 A;  1E5K A;  5C4F A;  4EEO A;  4Y6U A;  2AGD A;  1O7Q A;  1ZI4 A;  1NMM B;  3PKQ A;  3SXG A;  1JVD A;  3CKV A;  5C1L A;  2RIX A;  1ZCU A;  4Y7G A;  3I0J A;  1I52 A;  3CKJ A;  1ZIZ A;  1FZW A;  1VGZ A;  1TW5 A;  3I0D A;  3CGX A;  4MYB A;  1H5S B;  2J0B A;  3P0Z A;  2UZH A;  2D0J A;  3POL A;  1GX4 A;  3OH3 A;  3I0G A;  4CVH A;  1VHA A;  1GQC A;  4CJC A;  4NAN A;  2X65 A;  3IKF A;  1FGX A;  5B8F A;  1W57 A;  4R7P A;  4FRP A;  5C4D A;  1PZY B;  2V0K A;  1LL2 A;  2OEF A;  2P72 A;  1V84 A;  4M2B A;  1HM8 A;  2GZL A;  1KNJ A;  1GWW A;  2AEC A;  3V0L A;  1H5T A;  2Z87 A;  4FQW A;  2V0L A;  3N9W A;  2QH5 A;  3PKP A;  1QG8 A;  5FV9 A;  4C2S A;  4C8G A;  1WVC A;  2FY7 A;  1FR8 A;  2V0J A;  1G0R A;  2RJ7 A;  1R7X A;  2W0W A;  4FRB A;  3U2X A;  3R2W A;  1FGG A;  4FCU A;  3O3P A;  1YQN A;  1IV1 A;  2BO6 A;  2JCL A;  4C8E A;  2VS5 A;  1FR9 A;  1HJL A;  4FRH A;  1G9R A;  1W77 A;  4NAI A;  3FPI A;  2FYB A;  3OH4 A;  1T0A A;  4HG6 A;  5AJO A;  1FWY A;  4BQH A;  4HO2 A;  4CJ8 A;  5J49 A;  2X5Z A;  1H7Q A;  2FFU A;  2VSI A;  1FO9 A;  5L6S A;  4O6N A;  2YQJ A;  1XHB A;  5BXC A;  4KPX A;  1ZI1 A;  2E3D A;  3EOR A;  4FRE A;  4KC4 A;  4KC2 A;  1ZHJ A;  3DJ4 A;  3ELC A;  1G8O A;  3Q80 A;  3OH2 A;  1ON8 A;  1Z90 A;  4B4G A;  4LW6 A;  3U0Y A;  5C4B A;  1FRW A;  5CQL X;  4KNR A;  2RJ9 A;  2FYA A;  4FRA A;  3SXD A;  2RIZ A;  3K14 A;  2BO8 A;  1MP5 A;  2W0V A;  1W55 A;  4ASJ A;  4D0Z A;  1G1L A;  3SXB A;  4GBP A;  4G3Q A;  1WT2 A;  3RMV A;  2Y4L A;  1WSZ A;  3F0D A;  4K6R A;  5DDV A;  2AM5 A;  1VGT A;  2X60 A;  1OMZ A;  1MC3 A;  2Y7A A;  1JY8 A;  1H7F A;  3SX8 A;  3USQ A;  4B5B A;  2Y4M A;  2AMT A;  4B3U A;  5C3D A;  2AM3 A;  4C81 A;  3RE3 A;  1ZJ3 A;  1R7U A;  3E26 A;  5C4C A;  4EE5 A;  2P73 A;  1FG5 N;  4D11 C;  4EEA A;  3OGZ A;  5C1H A;  1GWV A;  1NQI B;  1H47 A;  4D48 A;  2E8B A;  3ERN A;  4IRP A;  4B2X A;  1TZF A;  1S4P A;  4AC3 A;  3DUV A;  4G3S A;  5C49 A;  3E25 A;  2O1H A;  3LW6 A;  5C3B A;  1ZI3 A;  3TZT A;  1R7V A;  5D92 A;  2Z86 A;  5CMF X;  3USR A;  2WVK A;  5DDT A;  1G93 A;  1H5T B;  4HO4 A;  2VS3 A;  4MND A;  4FRL A;  2WAW A;  2PMP A;  5C38 A;  3I0F A;  4KQL A;  1ZDF A;  3CU0 A;  1FO8 A;  1U40 A;  1JV3 A;  3F0E A;  5AJP A;  3FBA A;  5EIY A;  1R7Y A;  2I5K A;  3V91 A;  2X5S A;  5C4E A;  2YQH A;  1U3L A;  2XMH A;  2VK9 A;  3JVH A;  1G3L A;  1GX0 A;  1VH3 A;  3CKQ A;  1U3P A;  4HO6 A;  5EJZ A;  3OH0 A;  2JCO A;  3V0Q A;  3U2W A;  2C0N A;  1H48 A;  4AAW A;  5CQO A;  1YP2 A;  4Y64 A;  2RJ5 A;  1VZT A;  1NKH B;  2AE7 A;  4FIX A;  1K4V A;  4DEC A;  2RJ4 A;  1JYL A;  4KNX A;  5C47 A;  1JVG A;  1JV1 A;  1VGW A;  3SXE A;  3I0K A;  2BO4 A;  1IV4 A;  2WVL A;  3V0P A;  3F6M A;  1FXO A;  2V0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...