1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
b'SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
2XMEA 1ZCUA 1NMMB 3DK5A 1GWVA 1G1LA 3IEQA 1H7EA 2W0VA 2Y4LA 5EIYA 5C4EA 5C48A 2FY7A 4C8EA 3FOQA 2PA4A 5FU0A 2RJ8A 3R2WA 1NF5B 2UZHA 4KT7A 5CQNX 4CJCA 2D7RA 2GZLA 4C81A 2RIZA 2Y7AA 2VSHA 2Z87A 5C1HA 3FWWA 5AJNA 2RIXA 5C8RA 3ZF8A 4Y7GA 2V0LA 1G97A 3F0GA 2RIYA 4FCUA 2PX7A 2X5ZA 4G3PA 2WE9A 2WVLA 4B2XA 2JCLA 3JUJA 3ZGGA 1VH8A 2RJ4A 5CMGX 4B42A 1U40A 3ESJA 3D8VA 1LZ0A 2RJ1A 3OKRA 3OH0A 5AJOA 2CU2A 3SXAA 1FR9A 1HM8A 3SXGA 1YQNA 2P72A 1FGGA 5IDSA 3ST8A 1PZTA 4LW6A 3F1YA 3IKFA 2AMTA 1G0RA 2JCJA 5FU8A 3I0FA 1HM0A 1V83A 1FG5N 1O0RA 1LL0A 3POLA 3DUVA 4KC1A 1H3MA 1VGUA 5C1GA 3U2TA 1ZCYA 4K6RA 3CKQA 3Q80A 1IV1A 1ZJ1A 2AM4A 3OH1A 3SX7A 2QKXA 3TZTA 3I0EA 4Y7FA 2AM5A 1ZI4A 1VH3A 3E26A 4HO3A 1H5SD 2A8UA 2I7BA 3F0FA 1R7YA 5BXCA 4EEAA 4IRQA 3I0CA 5C4CA 2Y6PA 2YQJA 2JCKA 4Y63A 3FBAA 4KPXA 1HJLA 4C8GA 1MC3A 4B4MA 2AESA 1H4CA 1NQIB 1H5RA 1QG8A 2AH9A 2OEGA 2V0KA 1WT3A 3OH2A 1PZYB 3ELCA 1H5TA 4Y6UA 1FRWA 1G8OA 1R81A 5C47A 1JYKA 2P6WA 2FYBA 2PGYA 1WVCA 3QVBA 3IOIA 1H4DA 2ICXA 2X65A 5C3AA 1INIA 4D11C 3SXCA 1JN1A 4DDZA 1NHEB 1JVGA 3ERNA 3EE5A 4CJBA 3V0MA 3F0DA 4ARWA 2YQSA 1H5RB 3V0PA 2A8WA 1YP3A 1H5SC 3IOHA 5DDTA 3P10A 3SX3A 1W57A 4Y9XA 2I5KA 1H5TB 1OMXA 4HO0A 4D48A 5CMJA 5C3BA 1YP4A 3PKPA 1ZCVA 1GWWA 5CQPA 5JQQA 2YQCA 1VM8A 5CMIA 1HM9A 2QGIA 4ASYA 3SXEA 4LW3A 3KE1A 1VHAA 4Y6NA 3E25A 5C4FA 1WT2A 1ZJ0A 1ZDGA 4FRMA 4J18A 2ZU9A 4E1KA 1Z90A 3N9WA 1ZJPA 4HCQA 4B4BA 4FRDA 1GQ9A 3RE3A 2X5SA 4Y7UA 2WEEA 2WVMA 1LZJA 1O7QA 1O23B 3OH4A 4FRLA 3F0EA 2BO6A 4ECMA 4D11A 4M4KA 1TVYA 3D5NA 1IIMA 2WGZA 1H7LA 3T7MA 4KPZA 3CKNA 3NGWA 4GBPA 4FCEA 1MP5A 3MBMA 3O3PA 2O1FA 3JUKA 1H5SA 4Y7TA 2E8BA 5B8FA 3PNNA 2JCOA 4IRPA 1XHBA 3V90A 1VH1A 3U2WA 4HO2A 4G87A 1YP2A 4B4GA 2XMHA 2FFUA 1KNKA 5C4DA 3DJ4A 3SXBA 4AYJA 1R7VA 5DDVA 4KNXA 1WT0A 2WAWA 2P73A 4G3QA 1YROB 1LL3A 1ZI5A 1S4PA 2Q4JA 3I0KA 3OH3A 3V0NA 4FRAA 2ICYA 2OI6A 4B2WA 5AJPA 1H5SB 4CVHA 1MP4A 4FRBA 4NALA 1GX0A 4KQLA 3TQDA 1ZDFA 3U2UA 2RJ6A 3T7OA 3V8YA 3F6MA 2OI5A 5IDTA 4EE4A 4FQWA 3I0DA 4FRQA 2VSIA 3CKJA 1ZJ2A 5IFYA 2Y4MA 3SXDA 2ZU8A 2VXMA 4YS8A 2YC5A 1VGTA 2Y4KA 4EEOA 1FXJA 3D98A 1K4VA 4Y7VA 4HO6A 5CMFX 2FYAA 5CQOA 3PKQA 1GQCA 3ZLLA 5HS2A 2XWMA 5C36A 3RSBA 2VD4A 1JVDA 3IOJA 3V0QA 2FFVA 1E5KA 3RMWA 1VZTA 1O7OA 3FPIA 1G23A 2UX8A 1QGSA 1FR8A 1VGWA 1W77A 3OC9A 1FO9A 2O1GA 1U43A 4Y64A 1VICA 2BO7A 4HO5A 3P0ZA 4EE5A 2O1HA 4CJ8A 2V0IA 1JYLA 2Y4JA 4KXOA 3V8ZA 1FGXA 2YQHA 1WT1A 5I1FA 2Z86A 2QH5A 4KRVA 3T80A 4NANA 2OI7A 1FZWA 3SX5A 3V0LA 3USQA 1LVWA 5FYEA 1G93A 1VZUA 3SPTA 3RMVA 1KWSA 1TW5A 4ASJA 1ZI1A 5FUHA 4HO4A 4Y62A 2WVKA 2D0JA 3I0IX 2VFZA 3LW6A 4KC2A 2MZBA 5C38A 3BCVA 4AC3A 4B5BA 1S4NA 3CKVA 2VS4A 4MNDA 4BQHA 4FRPA 1OMZA 1FOAA 3BRKX 3CGXA 1EZIA 1H48A 3T7NA 2APCA 5L6VA 4FROA 1H7FA 4B3UA 4EEMA 4C2SA 2DPWA 3V0OA 2W0WA 5CQLX 2VS5A 1HV9A 4BMAA 2BO8A 1SS9A 5FTSA 3K2XA 3F1CA 2FYCB 5J49A 1VGZA 5L6SA 4HG6A 1R82A 1H7TA 3JTJA 1JV3A 1OQMB 4R7PA 5EJZA 1LZIA 3R3IA 4MYBA 2XWNA 4P02A 4NAIA 4KC4A 2VS3A 5CMHA 4HOCA 4JD0A 2PMPA 3Q8HA 1VZXA 2V0JA 1GX1A 3GUEA 4ZDQA 4DE7A 1EYRA 5FTVA 1R7TA 2GGOA 2FYDB 4M2BA 1U3PA 1H47A 4HO9A 2AECA 2OEFA 4UEGA 2D7IA 3USRA 2ZU7A 5C4BA 1W55A 5C49A 3K8EA 5FV9A 3I0GA 4P00A 3U2VA 3U0XA 2YESA 3K14A 4C82A 1QWJA 3U2XA 3JVHA 4FREA 3K8DA 1G95A 2I5EA 4EEGA 3I0LA 3Q4SA 3IEWA 2RJ9A 1R80A 1JY8A 2NXVA 1FXOA 1V84A 2YC3A 2XWLA 1ZIZA 1XZ6A 2AGDA 1HJJA 1INJA 3Q7UA 3V91A 2RJ5A 1ON8A 2RJ7A 4C8IA 1R7XA 1H7GA 4XWIA 5CQMX 4M28A 1U3LA 1H4EA 1MP3A 3EORA 1H7QA 3GHZA 1IINA 1IV4A 1I52A 2GGQA 1IV3A 3I0HA 4JISA 2RJ0A 1ZCTA 5C3DA 4HO8A 3KIAA 3I0JA 3CKOA 2YCMA 3B6NA 4G3SA 3U0YA 4EE3A 2RITA 2BO4A 3IKEA 1NWGB 1LZ7A 1TW1A 2PGVA 3SX8A 3OAMA 1TZFA 3CU0A 1IV2A 1ZJ3A 2X60A 1FO8A 4EVWA 4NAKA 1ZHJA 1T0AA 1V82A 1ZJOA 3QHDA 1GX4A 1G2VA 1VPAA 4D0TA 3ZGFA 1G3LA 1FWYA 4M2AA 1ZI3A 1NKHB 2AE7A 4DECA 2AM3A 2VXLA 1GA8A 3HL3A 4AAWA 1LL2A 1WSZA 3OGZA 1R7UA 1KNJA 4FRHA 5C1LA 2V0HA 4D0ZA 1H7HA 4L41C 3ZLKA 1S4OA 4AYLA 1ON6A 1QGQA 4KNRA 2E3DA 1G9RA 5EJ1A 1JV1A
chains in the Genus database with same CATH superfamily
1ZCUA 3DK5A 3IEQA 2Y4LA 5EIYA 3V3TA 2RJ8A 3LWPC 3OONA 4NUTA 2D7RA 3PLAC 2VSHA 5KMGA 1VQ4F 4O4HA 2V0LA 1G97A 3JARB 4FCUA 2ZOVA 2WE9A 1PF5A 3ZGGA 5GINC 3RYIB 2RJ4A 3WXMB 1COMA 3IR9A 5AJOA 2CU2A 3SXAA 2FC3A 1W41A 3R0PA 3I0FA 1HM0A 1SA0B 4BT6A 1H3MA 5J2TB 3U2TA 1W5BA 4K6RA 4G88A 1IV1A 3TZTA 3I0EA 4Y7FA 1IPAA 4FIXA 4HO3A 5EZYA 1JD1A 3CC2F 2I7BA 3HKCB 3F0FA 2Y6PA 3NVIB 3HJWC 2JCKA 2YQJA 5LP6A 2PHNA 1HJLA 2LCAA 1MC3A 1H5RA 2AH9A 2V0KA 3VO8A 3CCEF 3M1XA 4IIJA 2V9YA 3HTNA 1QAHA 4Y6UA 1FRWA 2FYBA 3QVBA 2RHLA 1INIA 3CCUF 4DXDA 5LOVA 3F0DA 4ARWA 3SX3A 2I5KA 1XV2A 1FNJA 4I50A 1JFFB 3LWQC 1OMXA 4D48A 1ZCVA 5CQPA 5CA1A 2QGIA 2AIZP 5LXTA 3CCLF 5C4FA 1WT2A 1ZDGA 4O4JB 4J18A 4HCQA 3RE3A 2X5SA 4Y7UA 2WEEA 4ERHA 5GIOC 2WVMA 1LZJA 2RHJA 5G4VC 1O23B 4FRLA 2Z1FA 4D11A 1TVYA 3J7AR 1H7LA 4B46A 4KPZA 3CKNA 3NGWA 3CCSF 3MBMA 2HVYD 2O1FA 3S06A 1H5SA 4Y7TA 5B8FA 3PNNA 4BVSA 2XMHA 2FFUA 1KNKA 5C4DA 5JCOC 3SXBA 3CD6F 2WAWA 5AVMA 2P73A 4G3QA 3S03A 4TV8A 5HY4A 3CCMF 3T7OA 3VCZA 4IHJB 3CKJA 2AIFA 5FNVA 1TVKB 1FXJA 1VQ9F 4O4IA 4O2AB 2Z01A 5IJ9A 3RSBA 1VZTA 4BW0B 1FR8A 4O4LB 4HNAB 3SIVA 1U43A 1VICA 4WBNA 2BTUA 1JYLA 1TUBA 4I55A 3S0WA 2HS3A 2KGWA 2QH5A 3D00A 3SX5A 4ZI7A 3USQA 1LVWA 1VZUA 3SPTA 1GO0A 1KWSA 5FUHA 1W581 3LW6A 5MN6A 1KD1H 4AC3A 3J80M 1OMZA 3MDOA 3U0OA 4X3MA 5L6VA 4FROA 3BYQA 2UYPA 3RA6A 4EB6A 4C4WC 1E7KA 4BMAA 2BO8A 5FTSA 3K2XA 3F1CA 3WGKA 1FSZA 5J49A 5L6SA 3C9SA 5HY0A 1JV3A 2PMPA 1EYRA 2GGOA 5HXZA 5IYZA 4M2BA 2AECA 4UEGA 2HS4A 2D7IA 4X1KB 3I0GA 3U0XA 3K14A 2QTPA 3JVHA 2I5EA 4EEGA 3I0LA 3IEWA 1R80A 2H8EA 3JATB 5ITZB 3C9RA 3CYQA 1HJJA 1YHQF 2RJ5A 1VQ7F 1U3LA 1YJWF 1IV4A 4TV9A 5CA0A 2YCMA 2RHHA 3FD6A 3B6NA 4G3SA 1SDSA 1LZ7A 5LA6A 3VTIC 3CU0A 3JASA 1T0AA 3OBWA 4FFBB 4DECA 2AE7A 3OGZA 1R7UA 1KNJA 4FRHA 4D0ZA 4B45A 4AYLA 1ON6A 2C0NA 1G9RA 5EJ1A 2XMEA 1NMMB 4G4YA 1YJNF 4DRXB 5GONA 4ZHQB 3JAWA 2VAMA 3WGMA 3RYCB 4CJCA 4RHAA 1T0KB 2GZLA 5C8YB 2Z87A 1FFXA 5C1HA 1XBIA 2UYJA 4Y7GA 1Q86H 1XHOA 3F0GA 4G3PA 4BY9D 1Q7YH 3LWRC 1VH8A 5CMGX 3LMEA 1LZ0A 4G4WA 2CZWA 1W40A 5KMGB 3SXGA 1N8RH 1K9MH 3ST8A 1PZTA 4LW6A 1X52A 4O4HB 1G0RA 5FU8A 1RQ2A 3FFMA 1Q81H 1M90H 3CPWF 4KC1A 3CCRF 3N2KA 5FJ4C 5C1GA 3G6EF 3MQWA 5EIBC 1RA4A 2AM5A 5JH7A 1ZI4A 1H5SD 2LBWA 3WGLA 3M84A 5BXCA 4IRQA 2KTUA 3I0CA 5GANK 3FBAA 4KPXA 3CCQF 3CPQA 1H4CA 1QG8A 1NJIH 2RB9A 5LYJA 3ELCA 2DT4A 1RLGA 1X7OA 1H5TA 4X1YA 3O85A 1VQ5F 1ZWZA 3QUWA 5EZYB 4XCQA 5LP6B 1JVGA 3ERNA 5BMVA 4CJBA 1QVFF 1H5RB 4PWTA 2A8WA 5DDTA 3IOHA 4Y9XA 5EAZA 3D54A 5C3BA 1YP4A 1GWWA 5JQQA 1VM8A 2I6DA 1VHAA 5LOVB 1ZJ0A 1QU9A 2ZU9A 3N9WA 1ZJPA 4B4BA 4FRDA 1GQ9A 4I50B 2MQEA 3I55F 3F0EA 4ECMA 5CA1B 4M4KA 3D5NA 1IIMA 2WGZA 5JVDA 5LXTB 4GBPA 3O3PA 2CW4A 2E8BA 3HKDA 3L7QA 1XHBA 3V90A 1VH1A 4HO2A 2BO1A 3S02A 1GO1A 4X1IA 5CB4A 1S4PA 3OH3A 2OI6A 1H5SB 4CVHA 1VQMF 1GX0A 3TD5A 3V4DA 2RJ6A 3F6MA 2OI5A 1H7MA 4EE4A 4FQWA 3HKBA 1ODEA 2WALA 2VSIA 1ZJ2A 5IFYA 2Y4MA 2VXMA 2YC5A 1VGTA 4EEOA 4Y7VA 2IQQA 4TV8B 3JALA 5HS2A 2XWMA 5HY1A 5IJ0A 3IOJA 1S72F 3RMWA 1VGWA 5JCOA 4Y64A 1VQKF 4HO5A 3P0ZA 5FNVB 4M8IA 4ZHVA 2Y4JA 4LNUA 2IAFA 4O4IB 1YI2F 5IJ9B 3RYHA 1JJ2F 3T80A 3ZOPA 5FYEA 3NMUC 4Y62A 3HAXD 3ZP4A 4KC2A 5C38A 4WBNB 3BCVA 3CKVA 2VGMA 3M4SA 1TUBB 4I55B 2B33A 1FOAA 1Z5VA 2W8BC 1H48A 3JARA 4ZI7B 2APCA 4B3UA 3LWVC 4C2SA 3RA5A 5EB0A 2VXYA 1GZ0A 2VS5A 3K12A 5D91A 2FYCB 3CMAF 1H7TA 3JTJA 5EJZA 4ZHWA 4NAIA 3VIUA 2VS3A 4ZOLB 2OTMA 3PAFA 1GX1A 3GUEA 4DE7A 3WGJA 4EB6B 1U3PA 3USRA 4HO9A 1VQNF 2QEXF 5C49A 3CXCF 1QWJA 3HKCA 3K8DA 2KTVA 2VAWA 1YGYA 1G95A 2LBTA 2NXVA 2XWLA 5IYZB 1XZ6A 1ZIZA 1VQVA 2K1SA 5DCVA 1ON8A 2OTLF 5CQMX 4M28A 3EORA 4YJ3A 1YIJF 3GHZA 4X20A 1IINA 1H7QA 1IV3A 4JISA 3KIAA 1YJ9F 2KG4A 4EE3A 2RITA 3KJJA 3VYTC 4MIXA 3OAMA 2CWJA 3VI6A 1IV2A 1ZJ3A 4NWOB 2GVIA 1V82A 3FD5A 3QHDA 5HP7A 1GX4A 1VPAA 4D0TA 4I4TA 4TV9B 1ZI3A 5CA0B 2AM3A 2VXLA 1GA8A 4EI8A 2OTJF 1WSZA 3VYSC 5LA6B 4B5CA 3GTZA 4L41C 3JASB 1S4OA 4KNRA 2Z1UA 1JV1A 1G1LA 2FGYA 5C4EA 5C48A 3I7TA 2FY7A 4C8EA 3FOQA 3IMPA 5G4UC 1NF5B 3ZP7A 5CQNX 2HP3A 1VK3A 4C81A 3WJRA 3OBYA 5EWRA 3FWWA 3MCQA 2RIXA 3ZF8A 4U39A 3S0YA 2WVLA 4B2XA 3JAWB 4B42A 3OW2F 3ESJA 4TZZA 3D8VA 1W5EA 5GAPK 3OKRA 5FLXM 3OH0A 1FFXB 1HM8A 1FGGA 5IDSA 2ALEA 4U3JA 1V83A 1FG5N 4BT5A 1O0RA 1VGUA 4G4VA 3I3FA 3Q80A 4BVQA 1ZJ1A 3I56F 2AM4A 2QKXA 3SX7A 2YXZA 3UT5A 2A8UA 4G4ZA 4EEAA 1W2BF 2P6YA 4F6RA 1ONIA 3N2KB 3VOBA 2AESA 2BTOA 3N2GA 1WT3A 3OH2A 3HKEA 3CCVF 5JH7B 1R81A 5C47A 3WJPA 3WPXA 5KX5A 2P6WA 5HY2A 1H4DA 2UYNA 2X65A 5C3AA 3SXCA 4DDZA 1NHEB 4O6MA 3EE5A 2H6LA 3V0MA 3NK7A 3V0PA 5EYPA 3P10A 1W57A 1H5TB 4X1YB 5CMJA 2GLZA 4RQOA 5CMIA 2HS0A 4TUYB 3SXEA 4ZK7A 3RYFB 5BMVB 4FRMA 2Q1YA 1Z90A 2ZVZA 3AGKA 3S0HA 1VQPF 3OH4A 1VQ6F 3E20B 1W5AA 4EI7A 1MP5A 1Q8RA 3WGNA 5JQGA 3JUKA 3E22A 2JCOA 3KJKA 4IRPA 3SIUA 1NQ3A 3D01A 3GYQA 1YP2A 4B4GA 1PXWA 3DJ4A 1R7VA 5DDVA 4O2BA 4KNXA 5JVDB 1LL3A 4FRAA 2ICYA 4B2WA 5AJPA 3HKDB 4NALA 3TQDA 3U2UA 3V8YA 2J0BA 3I0DA 5J2UA 2Y4KA 3D98A 4X1IB 1K4VA 5CB4B 4HO6A 5CMFX 3G4SF 3PKQA 3DC2A 3ZLLA 4FFBA 1W5FA 1SZQA 3FPIA 4BT4A 1G23A 2UX8A 2O1GA 1X25A 1K73H 3HKBB 1DT9A 3VYUC 4X3LA 4CJ8A 2V0IA 4KXOA 2YYEA 3TD4A 1WT1A 5I1FA 2Z86A 3JALB 4IIJB 3QTYA 4NANA 1FZWA 5IJ0B 3KHNA 5MN4A 4NQ3A 3RMVA 3WJQA 1M1KH 2Q1XA 2VFZA 2ZVYA 2R6R1 1S4NA 2VS4A 4ZHYB 4BQHA 4LNUB 4FRPA 3BRKX 3RYHB 3NVKE 2ZAUA 3VOAA 4EEMA 1H7FA 1W42A 2DPWA 3V0OA 5CQLX 1HV9A 1SS9A 2OZBA 3P4EA 1R82A 1CK2A 4R7PA 4LCKA 4MYBA 2XWNA 5CMHA 4HOCA 1VZXA 2V0JA 4ZDQA 5FTVA 2HQSC 2OEFA 1Z5WA 3K8EA 3NK6A 4P00A 1OAPA 4C82A 3K0TA 3U2XA 1KQSF 4FREA 4YJ2A 1W3EX 5HP8A 3Q4SA 2RJ9A 1Q82H 1JY8A 2N48A 3ON1A 1V84A 3CB2A 2AGDA 1INJA 2RJ7A 2ZF8A 4C8IA 1R7XA 2HX0A 4XWIA 3CMEF 2GGQA 1I52A 2RJ0A 1ZCTA 4HO8A 3I0JA 3JAKA 2HRYA 1J7HA 3IKEA 1TW1A 2H8CA 2VAPA 2HP0A 4EVWA 4NAKA 2VGNA 1ZHJA 4YJ3B 4X20B 1G2VA 4BVRA 2L26A 1FWYA 1YITF 4EI9A 4AAWA 1LL2A 1K8AH 1VQ8F 3ZLKA 1QGQA 3CYPB 1GWVA 1H7EA 2W0VA 5HWEA 4I4TB 2OHWA 2PA4A 3G71F 3RYIA 5FU0A 3R2WA 2UZHA 4KT7A 2RIZA 2Y7AA 5EIBD 1QD9A 5AJNA 2I6RA 5C8RA 2RIYA 2PX7A 2X5ZA 1SA0A 2RHOA 2JCLA 5LP6C 3JUJA 5J2TA 3LWOC 4R40B 1U40A 2RJ1A 1FR9A 1KC8H 1YQNA 2P72A 3F1YA 3IKFA 2AMTA 2JCJA 2VK9A 1LL0A 3POLA 3DUVA 1CLIA 3CC7F 1ZCYA 3CKQA 3OH1A 4BT3A 4Q7CA 1VH3A 3E26A 2UYKA 2LBXA 1R7YA 4U3JB 5C4CA 1QVGF 4Y63A 4C8GA 1W59A 1UFYA 1XRGA 4B4MA 1NQIB 2OEGA 1PZYB 1JFFA 2DYYA 1G8OA 1JYKA 3UT5B 2PGYA 1WVCA 3IOIA 2ICXA 4D11C 1JN1A 4F6RB 3DDNA 4O4JA 2YQSA 3N4ZA 3N2GB 1YP3A 1H5SC 3HKEB 5IT9M 2F9ZC 4HO0A 5KX5B 3PKPA 2YQCA 2UYNB 1HM9A 4ASYA 4LW3A 5HXUA 3KE1A 4Y6NA 2Z1TA 3E25A 2CHSA 2EWCA 4BT7A 1UI9A 5EYPB 4BVTA 4E1KA 2QI2A 3LYBA 2J0AA 4ZOLA 3CCJF 3LDTA 1O7QA 2BO6A 5GONB 3T7MA 4FCEA 3U2WA 4G87A 4IHJA 2R751 3V7QA 4AYJA 3C9UA 1WT0A 1TVKA 1YROB 1ZI5A 2Q4JA 3I0KA 3V0NA 4O2AA 5JQGB 3E22B 1MP4A 4FRBA 3CC4F 4KQLA 1ZDFA 3LFOA 2JNBA 3KIZA 4FIYA 5IDTA 4O4LA 4HNAA 4FRQA 1OFUA 4O6NA 3SXDA 4O2BB 2ZU8A 4YS8A 3J81M 1CN7A 2FYAA 5CQOA 3ZO8A 1GQCA 5EB1B 5C36A 2VD4A 5A2QM 1JVDA 3V0QA 2FFVA 1E5KA 1O7OA 1QGSA 1W77A 3OC9A 1FO9A 2CVLA 2BO7A 5J2UB 3C8LA 4EE5A 2O1HA 4G4XA 1DBFA 5LYJB 3V8ZA 1FGXA 2YQHA 4KRVA 2OI7A 3V0LA 3N4YA 1G93A 2NMUA 1TW5A 4ASJA 1ZI1A 4HO4A 2WVKA 2D0JA 3I0IX 2MZBA 4B5BA 4B62A 4MNDA 3CGXA 1EZIA 5EO3A 3T7NA 3CG6A 2QA4F 2W0WA 4X1KA 3WPWA 1VGZA 4HG6A 1OQMB 1VQLF 1LZIA 3R3IA 4P02A 4KC4A 4JD0A 3Q8HA 3E1YA 3JATA 1R7TA 2FYDB 5ITZA 4E6EA 1H47A 2HRUA 1RQ7A 2ZU7A 5C4BA 1W55A 1RLUA 5MN5A 5FV9A 3U2VA 2YESA 3C9TA 3TD3A 2Z1EA 3VMFB 3V7EA 1FXOA 2YC3A 3Q7UA 3JCMM 3V91A 1H7GA 1VQOF 1H4EA 1MP3A 3I0HA 5C3DA 4YJ2B 3CKOA 1X7PA 3U0YA 3HWUA 5D92A 2BO4A 3MCAB 5GIPC 1NWGB 2PGVA 3SX8A 2ZODA 1TZFA 1FNKA 2X60A 1FO8A 3JAMM 1ZJOA 2CSLA 2G9IA 3ZGFA 1G3LA 4M2AA 1NKHB 4DRXA 4ZHQA 3HL3A 4BT2A 4TUYA 1NMUB 3JAKB 2BTQB 3RYFA 3RYCA 2IG8A 5C1LA 1R1MA 4KWEA 2V0HA 1H7HA 5C8YA 2CHTA 2HP0B 2E3DA
chains in the Genus database with same CATH topology
2XMEA 1ZCUA 1NMMB 3DK5A 1GWVA 1G1LA 3IEQA 1H7EA 2W0VA 2Y4LA 5EIYA 5C4EA 5C48A 2FY7A 4C8EA 3FOQA 2PA4A 5FU0A 2RJ8A 3R2WA 1NF5B 2UZHA 4KT7A 5CQNX 4CJCA 2D7RA 2GZLA 4C81A 2RIZA 2Y7AA 2VSHA 2Z87A 5C1HA 3FWWA 5AJNA 2RIXA 5C8RA 3ZF8A 4Y7GA 2V0LA 1G97A 3F0GA 2RIYA 4FCUA 2PX7A 2X5ZA 4G3PA 2WE9A 2WVLA 4B2XA 2JCLA 3JUJA 3ZGGA 1VH8A 2RJ4A 5CMGX 4B42A 1U40A 3ESJA 3D8VA 1LZ0A 2RJ1A 3OKRA 3OH0A 5AJOA 2CU2A 3SXAA 1FR9A 1HM8A 3SXGA 1YQNA 2P72A 1FGGA 5IDSA 3ST8A 1PZTA 4LW6A 3F1YA 3IKFA 2AMTA 1G0RA 2JCJA 5FU8A 3I0FA 1HM0A 1V83A 1FG5N 1O0RA 2VK9A 1LL0A 3POLA 3DUVA 4KC1A 1H3MA 1VGUA 5C1GA 3U2TA 1ZCYA 4K6RA 3CKQA 3Q80A 1IV1A 1ZJ1A 2AM4A 3OH1A 3SX7A 2QKXA 3TZTA 3I0EA 4Y7FA 2AM5A 1ZI4A 4FIXA 4Q7CA 1VH3A 3E26A 4HO3A 1H5SD 2A8UA 2I7BA 3F0FA 1R7YA 5BXCA 4EEAA 4IRQA 3I0CA 5C4CA 2Y6PA 2YQJA 2JCKA 4Y63A 3FBAA 4KPXA 1HJLA 4C8GA 1MC3A 4B4MA 2AESA 1H4CA 1NQIB 1H5RA 1QG8A 2AH9A 2OEGA 2V0KA 1WT3A 3OH2A 1PZYB 3ELCA 1H5TA 4Y6UA 1FRWA 1G8OA 1R81A 5C47A 1JYKA 2P6WA 2FYBA 2PGYA 1WVCA 3QVBA 3IOIA 1H4DA 2ICXA 2X65A 5C3AA 1INIA 4D11C 3SXCA 1JN1A 4DDZA 1NHEB 1JVGA 4O6MA 3ERNA 3EE5A 4CJBA 3V0MA 3F0DA 4ARWA 2YQSA 1H5RB 3V0PA 2A8WA 1YP3A 1H5SC 3IOHA 5DDTA 3P10A 3SX3A 1W57A 4Y9XA 2I5KA 1H5TB 1OMXA 4HO0A 4D48A 5CMJA 5C3BA 1YP4A 3PKPA 1ZCVA 1GWWA 5CQPA 5JQQA 2YQCA 1VM8A 5CMIA 1HM9A 2QGIA 4ASYA 3SXEA 4LW3A 3KE1A 1VHAA 4Y6NA 3E25A 5C4FA 1WT2A 1ZJ0A 1ZDGA 4FRMA 4J18A 2ZU9A 4E1KA 1Z90A 3N9WA 1ZJPA 4HCQA 4B4BA 4FRDA 1GQ9A 3RE3A 2X5SA 2J0AA 4Y7UA 2WEEA 2WVMA 1LZJA 1O7QA 1O23B 3OH4A 4FRLA 3F0EA 2BO6A 4ECMA 4D11A 4M4KA 1TVYA 3D5NA 1IIMA 2WGZA 1H7LA 3T7MA 4KPZA 3CKNA 3NGWA 4GBPA 4FCEA 1MP5A 3MBMA 3O3PA 2O1FA 3JUKA 1H5SA 4Y7TA 2E8BA 5B8FA 3PNNA 2JCOA 4IRPA 1XHBA 3V90A 1VH1A 3U2WA 4HO2A 4G87A 1YP2A 4B4GA 2XMHA 2FFUA 1KNKA 5C4DA 3DJ4A 3SXBA 4AYJA 1R7VA 5DDVA 4KNXA 1WT0A 2WAWA 2P73A 4G3QA 1YROB 1LL3A 1ZI5A 1S4PA 2Q4JA 3I0KA 3OH3A 3V0NA 4FRAA 2ICYA 2OI6A 4B2WA 5AJPA 1H5SB 4CVHA 1MP4A 4FRBA 4NALA 1GX0A 4KQLA 3TQDA 1ZDFA 3U2UA 2RJ6A 3T7OA 3V8YA 3F6MA 2OI5A 4FIYA 5IDTA 4EE4A 4FQWA 2J0BA 3I0DA 4FRQA 2VSIA 3CKJA 1ZJ2A 4O6NA 5IFYA 2Y4MA 3SXDA 2ZU8A 2VXMA 4YS8A 2YC5A 1VGTA 2Y4KA 4EEOA 1FXJA 3D98A 1K4VA 4Y7VA 4HO6A 5CMFX 2FYAA 5CQOA 3PKQA 1GQCA 3ZLLA 5HS2A 2XWMA 5C36A 3RSBA 2VD4A 1JVDA 3IOJA 3V0QA 2FFVA 1E5KA 3RMWA 1VZTA 1O7OA 3FPIA 1G23A 2UX8A 1QGSA 1FR8A 1VGWA 1W77A 3OC9A 1FO9A 2O1GA 1U43A 4Y64A 1VICA 2BO7A 4HO5A 3P0ZA 4EE5A 2O1HA 4CJ8A 2V0IA 1JYLA 2Y4JA 4KXOA 3V8ZA 1FGXA 2YQHA 1WT1A 5I1FA 2Z86A 2QH5A 4KRVA 3T80A 4NANA 2OI7A 1FZWA 3SX5A 3V0LA 3USQA 1LVWA 5FYEA 1G93A 1VZUA 3SPTA 3RMVA 1KWSA 1TW5A 4ASJA 1ZI1A 5FUHA 4HO4A 4Y62A 2WVKA 2D0JA 3I0IX 2VFZA 3LW6A 4KC2A 2MZBA 5C38A 3BCVA 4AC3A 4B5BA 1S4NA 3CKVA 2VS4A 4MNDA 4BQHA 4FRPA 1OMZA 1FOAA 3BRKX 3CGXA 1EZIA 1H48A 3T7NA 2APCA 5L6VA 4FROA 1H7FA 4B3UA 4EEMA 4C2SA 2DPWA 3V0OA 2W0WA 5CQLX 2VS5A 1HV9A 4BMAA 2BO8A 1SS9A 5D91A 5FTSA 3K2XA 3F1CA 2FYCB 5J49A 1VGZA 5L6SA 4HG6A 1R82A 1H7TA 3JTJA 1JV3A 1OQMB 4R7PA 5EJZA 1LZIA 3R3IA 4MYBA 2XWNA 4P02A 4NAIA 4KC4A 2VS3A 5CMHA 4HOCA 4JD0A 2PMPA 3Q8HA 1VZXA 2V0JA 1GX1A 3GUEA 4ZDQA 4DE7A 1EYRA 5FTVA 1R7TA 2GGOA 2FYDB 4M2BA 1U3PA 1H47A 4HO9A 2AECA 2OEFA 4UEGA 2D7IA 3USRA 2ZU7A 5C4BA 1W55A 5C49A 3K8EA 5FV9A 3I0GA 4P00A 3U2VA 3U0XA 2YESA 3K14A 4C82A 1QWJA 3U2XA 3JVHA 4FREA 3K8DA 1G95A 2I5EA 4EEGA 3I0LA 3Q4SA 3IEWA 2RJ9A 1R80A 1JY8A 2NXVA 1FXOA 1V84A 2YC3A 2XWLA 1ZIZA 1XZ6A 2AGDA 1HJJA 1INJA 3Q7UA 3V91A 2RJ5A 1ON8A 2RJ7A 4C8IA 1R7XA 1H7GA 4XWIA 5CQMX 4M28A 1U3LA 1H4EA 1MP3A 3EORA 1H7QA 3GHZA 1IINA 1IV4A 1I52A 2GGQA 1IV3A 3I0HA 4JISA 2RJ0A 1ZCTA 5C3DA 4HO8A 3KIAA 3I0JA 3CKOA 2YCMA 3B6NA 4G3SA 3U0YA 5D92A 4EE3A 2RITA 2BO4A 3IKEA 1NWGB 1LZ7A 1TW1A 2PGVA 3SX8A 4MIXA 3OAMA 1TZFA 3CU0A 1IV2A 1ZJ3A 2X60A 1FO8A 4EVWA 4NAKA 1ZHJA 1T0AA 1V82A 1ZJOA 3QHDA 1GX4A 1G2VA 1VPAA 4D0TA 3ZGFA 1G3LA 1FWYA 4M2AA 1ZI3A 1NKHB 2AE7A 4DECA 2AM3A 2VXLA 1GA8A 3HL3A 4AAWA 1LL2A 1WSZA 3OGZA 1R7UA 1KNJA 4FRHA 5C1LA 2V0HA 4D0ZA 1H7HA 4L41C 3ZLKA 1S4OA 4AYLA 1ON6A 1QGQA 4KNRA 2E3DA 2C0NA 1G9RA 5EJ1A 1JV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XME A;  1ZCU A;  1NMM B;  3DK5 A;  1GWV A;  1G1L A;  3IEQ A;  1H7E A;  2W0V A;  2Y4L A;  5EIY A;  5C4E A;  5C48 A;  2FY7 A;  4C8E A;  3FOQ A;  2PA4 A;  5FU0 A;  2RJ8 A;  3R2W A;  1NF5 B;  2UZH A;  4KT7 A;  5CQN X;  4CJC A;  2D7R A;  2GZL A;  4C81 A;  2RIZ A;  2Y7A A;  2VSH A;  2Z87 A;  5C1H A;  3FWW A;  5AJN A;  2RIX A;  5C8R A;  3ZF8 A;  4Y7G A;  2V0L A;  1G97 A;  3F0G A;  2RIY A;  4FCU A;  2PX7 A;  2X5Z A;  4G3P A;  2WE9 A;  2WVL A;  4B2X A;  2JCL A;  3JUJ A;  3ZGG A;  1VH8 A;  2RJ4 A;  5CMG X;  4B42 A;  1U40 A;  3ESJ A;  3D8V A;  1LZ0 A;  2RJ1 A;  3OKR A;  3OH0 A;  5AJO A;  2CU2 A;  3SXA A;  1FR9 A;  1HM8 A;  3SXG A;  1YQN A;  2P72 A;  1FGG A;  5IDS A;  3ST8 A;  1PZT A;  4LW6 A;  3F1Y A;  3IKF A;  2AMT A;  1G0R A;  2JCJ A;  5FU8 A;  3I0F A;  1HM0 A;  1V83 A;  1FG5 N;  1O0R A;  1LL0 A;  3POL A;  3DUV A;  4KC1 A;  1H3M A;  1VGU A;  5C1G A;  3U2T A;  1ZCY A;  4K6R A;  3CKQ A;  3Q80 A;  1IV1 A;  1ZJ1 A;  2AM4 A;  3OH1 A;  3SX7 A;  2QKX A;  3TZT A;  3I0E A;  4Y7F A;  2AM5 A;  1ZI4 A;  1VH3 A;  3E26 A;  4HO3 A;  1H5S D;  2A8U A;  2I7B A;  3F0F A;  1R7Y A;  5BXC A;  4EEA A;  4IRQ A;  3I0C A;  5C4C A;  2Y6P A;  2YQJ A;  2JCK A;  4Y63 A;  3FBA A;  4KPX A;  1HJL A;  4C8G A;  1MC3 A;  4B4M A;  2AES A;  1H4C A;  1NQI B;  1H5R A;  1QG8 A;  2AH9 A;  2OEG A;  2V0K A;  1WT3 A;  3OH2 A;  1PZY B;  3ELC A;  1H5T A;  4Y6U A;  1FRW A;  1G8O A;  1R81 A;  5C47 A;  1JYK A;  2P6W A;  2FYB A;  2PGY A;  1WVC A;  3QVB A;  3IOI A;  1H4D A;  2ICX A;  2X65 A;  5C3A A;  1INI A;  4D11 C;  3SXC A;  1JN1 A;  4DDZ A;  1NHE B;  1JVG A;  3ERN A;  3EE5 A;  4CJB A;  3V0M A;  3F0D A;  4ARW A;  2YQS A;  1H5R B;  3V0P A;  2A8W A;  1YP3 A;  1H5S C;  3IOH A;  5DDT A;  3P10 A;  3SX3 A;  1W57 A;  4Y9X A;  2I5K A;  1H5T B;  1OMX A;  4HO0 A;  4D48 A;  5CMJ A;  5C3B A;  1YP4 A;  3PKP A;  1ZCV A;  1GWW A;  5CQP A;  5JQQ A;  2YQC A;  1VM8 A;  5CMI A;  1HM9 A;  2QGI A;  4ASY A;  3SXE A;  4LW3 A;  3KE1 A;  1VHA A;  4Y6N A;  3E25 A;  5C4F A;  1WT2 A;  1ZJ0 A;  1ZDG A;  4FRM A;  4J18 A;  2ZU9 A;  4E1K A;  1Z90 A;  3N9W A;  1ZJP A;  4HCQ A;  4B4B A;  4FRD A;  1GQ9 A;  3RE3 A;  2X5S A;  4Y7U A;  2WEE A;  2WVM A;  1LZJ A;  1O7Q A;  1O23 B;  3OH4 A;  4FRL A;  3F0E A;  2BO6 A;  4ECM A;  4D11 A;  4M4K A;  1TVY A;  3D5N A;  1IIM A;  2WGZ A;  1H7L A;  3T7M A;  4KPZ A;  3CKN A;  3NGW A;  4GBP A;  4FCE A;  1MP5 A;  3MBM A;  3O3P A;  2O1F A;  3JUK A;  1H5S A;  4Y7T A;  2E8B A;  5B8F A;  3PNN A;  2JCO A;  4IRP A;  1XHB A;  3V90 A;  1VH1 A;  3U2W A;  4HO2 A;  4G87 A;  1YP2 A;  4B4G A;  2XMH A;  2FFU A;  1KNK A;  5C4D A;  3DJ4 A;  3SXB A;  4AYJ A;  1R7V A;  5DDV A;  4KNX A;  1WT0 A;  2WAW A;  2P73 A;  4G3Q A;  1YRO B;  1LL3 A;  1ZI5 A;  1S4P A;  2Q4J A;  3I0K A;  3OH3 A;  3V0N A;  4FRA A;  2ICY A;  2OI6 A;  4B2W A;  5AJP A;  1H5S B;  4CVH A;  1MP4 A;  4FRB A;  4NAL A;  1GX0 A;  4KQL A;  3TQD A;  1ZDF A;  3U2U A;  2RJ6 A;  3T7O A;  3V8Y A;  3F6M A;  2OI5 A;  5IDT A;  4EE4 A;  4FQW A;  3I0D A;  4FRQ A;  2VSI A;  3CKJ A;  1ZJ2 A;  5IFY A;  2Y4M A;  3SXD A;  2ZU8 A;  2VXM A;  4YS8 A;  2YC5 A;  1VGT A;  2Y4K A;  4EEO A;  1FXJ A;  3D98 A;  1K4V A;  4Y7V A;  4HO6 A;  5CMF X;  2FYA A;  5CQO A;  3PKQ A;  1GQC A;  3ZLL A;  5HS2 A;  2XWM A;  5C36 A;  3RSB A;  2VD4 A;  1JVD A;  3IOJ A;  3V0Q A;  2FFV A;  1E5K A;  3RMW A;  1VZT A;  1O7O A;  3FPI A;  1G23 A;  2UX8 A;  1QGS A;  1FR8 A;  1VGW A;  1W77 A;  3OC9 A;  1FO9 A;  2O1G A;  1U43 A;  4Y64 A;  1VIC A;  2BO7 A;  4HO5 A;  3P0Z A;  4EE5 A;  2O1H A;  4CJ8 A;  2V0I A;  1JYL A;  2Y4J A;  4KXO A;  3V8Z A;  1FGX A;  2YQH A;  1WT1 A;  5I1F A;  2Z86 A;  2QH5 A;  4KRV A;  3T80 A;  4NAN A;  2OI7 A;  1FZW A;  3SX5 A;  3V0L A;  3USQ A;  1LVW A;  5FYE A;  1G93 A;  1VZU A;  3SPT A;  3RMV A;  1KWS A;  1TW5 A;  4ASJ A;  1ZI1 A;  5FUH A;  4HO4 A;  4Y62 A;  2WVK A;  2D0J A;  3I0I X;  2VFZ A;  3LW6 A;  4KC2 A;  2MZB A;  5C38 A;  3BCV A;  4AC3 A;  4B5B A;  1S4N A;  3CKV A;  2VS4 A;  4MND A;  4BQH A;  4FRP A;  1OMZ A;  1FOA A;  3BRK X;  3CGX A;  1EZI A;  1H48 A;  3T7N A;  2APC A;  5L6V A;  4FRO A;  1H7F A;  4B3U A;  4EEM A;  4C2S A;  2DPW A;  3V0O A;  2W0W A;  5CQL X;  2VS5 A;  1HV9 A;  4BMA A;  2BO8 A;  1SS9 A;  5FTS A;  3K2X A;  3F1C A;  2FYC B;  5J49 A;  1VGZ A;  5L6S A;  4HG6 A;  1R82 A;  1H7T A;  3JTJ A;  1JV3 A;  1OQM B;  4R7P A;  5EJZ A;  1LZI A;  3R3I A;  4MYB A;  2XWN A;  4P02 A;  4NAI A;  4KC4 A;  2VS3 A;  5CMH A;  4HOC A;  4JD0 A;  2PMP A;  3Q8H A;  1VZX A;  2V0J A;  1GX1 A;  3GUE A;  4ZDQ A;  4DE7 A;  1EYR A;  5FTV A;  1R7T A;  2GGO A;  2FYD B;  4M2B A;  1U3P A;  1H47 A;  4HO9 A;  2AEC A;  2OEF A;  4UEG A;  2D7I A;  3USR A;  2ZU7 A;  5C4B A;  1W55 A;  5C49 A;  3K8E A;  5FV9 A;  3I0G A;  4P00 A;  3U2V A;  3U0X A;  2YES A;  3K14 A;  4C82 A;  1QWJ A;  3U2X A;  3JVH A;  4FRE A;  3K8D A;  1G95 A;  2I5E A;  4EEG A;  3I0L A;  3Q4S A;  3IEW A;  2RJ9 A;  1R80 A;  1JY8 A;  2NXV A;  1FXO A;  1V84 A;  2YC3 A;  2XWL A;  1ZIZ A;  1XZ6 A;  2AGD A;  1HJJ A;  1INJ A;  3Q7U A;  3V91 A;  2RJ5 A;  1ON8 A;  2RJ7 A;  4C8I A;  1R7X A;  1H7G A;  4XWI A;  5CQM X;  4M28 A;  1U3L A;  1H4E A;  1MP3 A;  3EOR A;  1H7Q A;  3GHZ A;  1IIN A;  1IV4 A;  1I52 A;  2GGQ A;  1IV3 A;  3I0H A;  4JIS A;  2RJ0 A;  1ZCT A;  5C3D A;  4HO8 A;  3KIA A;  3I0J A;  3CKO A;  2YCM A;  3B6N A;  4G3S A;  3U0Y A;  4EE3 A;  2RIT A;  2BO4 A;  3IKE A;  1NWG B;  1LZ7 A;  1TW1 A;  2PGV A;  3SX8 A;  3OAM A;  1TZF A;  3CU0 A;  1IV2 A;  1ZJ3 A;  2X60 A;  1FO8 A;  4EVW A;  4NAK A;  1ZHJ A;  1T0A A;  1V82 A;  1ZJO A;  3QHD A;  1GX4 A;  1G2V A;  1VPA A;  4D0T A;  3ZGF A;  1G3L A;  1FWY A;  4M2A A;  1ZI3 A;  1NKH B;  2AE7 A;  4DEC A;  2AM3 A;  2VXL A;  1GA8 A;  3HL3 A;  4AAW A;  1LL2 A;  1WSZ A;  3OGZ A;  1R7U A;  1KNJ A;  4FRH A;  5C1L A;  2V0H A;  4D0Z A;  1H7H A;  4L41 C;  3ZLK A;  1S4O A;  4AYL A;  1ON6 A;  1QGQ A;  4KNR A;  2E3D A;  1G9R A;  5EJ1 A;  1JV1 A; 
#chains in the Genus database with same CATH topology
 1ZCU A;  3DK5 A;  3IEQ A;  2Y4L A;  5EIY A;  3V3T A;  2RJ8 A;  3LWP C;  3OON A;  4NUT A;  2D7R A;  3PLA C;  2VSH A;  5KMG A;  1VQ4 F;  4O4H A;  2V0L A;  1G97 A;  3JAR B;  4FCU A;  2ZOV A;  2WE9 A;  1PF5 A;  3ZGG A;  5GIN C;  3RYI B;  2RJ4 A;  3WXM B;  1COM A;  3IR9 A;  5AJO A;  2CU2 A;  3SXA A;  2FC3 A;  1W41 A;  3R0P A;  3I0F A;  1HM0 A;  1SA0 B;  4BT6 A;  1H3M A;  5J2T B;  3U2T A;  1W5B A;  4K6R A;  4G88 A;  1IV1 A;  3TZT A;  3I0E A;  4Y7F A;  1IPA A;  4FIX A;  4HO3 A;  5EZY A;  1JD1 A;  3CC2 F;  2I7B A;  3HKC B;  3F0F A;  2Y6P A;  3NVI B;  3HJW C;  2JCK A;  2YQJ A;  5LP6 A;  2PHN A;  1HJL A;  2LCA A;  1MC3 A;  1H5R A;  2AH9 A;  2V0K A;  3VO8 A;  3CCE F;  3M1X A;  4IIJ A;  2V9Y A;  3HTN A;  1QAH A;  4Y6U A;  1FRW A;  2FYB A;  3QVB A;  2RHL A;  1INI A;  3CCU F;  4DXD A;  5LOV A;  3F0D A;  4ARW A;  3SX3 A;  2I5K A;  1XV2 A;  1FNJ A;  4I50 A;  1JFF B;  3LWQ C;  1OMX A;  4D48 A;  1ZCV A;  5CQP A;  5CA1 A;  2QGI A;  2AIZ P;  5LXT A;  3CCL F;  5C4F A;  1WT2 A;  1ZDG A;  4O4J B;  4J18 A;  4HCQ A;  3RE3 A;  2X5S A;  4Y7U A;  2WEE A;  4ERH A;  5GIO C;  2WVM A;  1LZJ A;  2RHJ A;  5G4V C;  1O23 B;  4FRL A;  2Z1F A;  4D11 A;  1TVY A;  3J7A R;  1H7L A;  4B46 A;  4KPZ A;  3CKN A;  3NGW A;  3CCS F;  3MBM A;  2HVY D;  2O1F A;  3S06 A;  1H5S A;  4Y7T A;  5B8F A;  3PNN A;  4BVS A;  2XMH A;  2FFU A;  1KNK A;  5C4D A;  5JCO C;  3SXB A;  3CD6 F;  2WAW A;  5AVM A;  2P73 A;  4G3Q A;  3S03 A;  4TV8 A;  5HY4 A;  3CCM F;  3T7O A;  3VCZ A;  4IHJ B;  3CKJ A;  2AIF A;  5FNV A;  1TVK B;  1FXJ A;  1VQ9 F;  4O4I A;  4O2A B;  2Z01 A;  5IJ9 A;  3RSB A;  1VZT A;  4BW0 B;  1FR8 A;  4O4L B;  4HNA B;  3SIV A;  1U43 A;  1VIC A;  4WBN A;  2BTU A;  1JYL A;  1TUB A;  4I55 A;  3S0W A;  2HS3 A;  2KGW A;  2QH5 A;  3D00 A;  3SX5 A;  4ZI7 A;  3USQ A;  1LVW A;  1VZU A;  3SPT A;  1GO0 A;  1KWS A;  5FUH A;  1W58 1;  3LW6 A;  5MN6 A;  1KD1 H;  4AC3 A;  3J80 M;  1OMZ A;  3MDO A;  3U0O A;  4X3M A;  5L6V A;  4FRO A;  3BYQ A;  2UYP A;  3RA6 A;  4EB6 A;  4C4W C;  1E7K A;  4BMA A;  2BO8 A;  5FTS A;  3K2X A;  3F1C A;  3WGK A;  1FSZ A;  5J49 A;  5L6S A;  3C9S A;  5HY0 A;  1JV3 A;  2PMP A;  1EYR A;  2GGO A;  5HXZ A;  5IYZ A;  4M2B A;  2AEC A;  4UEG A;  2HS4 A;  2D7I A;  4X1K B;  3I0G A;  3U0X A;  3K14 A;  2QTP A;  3JVH A;  2I5E A;  4EEG A;  3I0L A;  3IEW A;  1R80 A;  2H8E A;  3JAT B;  5ITZ B;  3C9R A;  3CYQ A;  1HJJ A;  1YHQ F;  2RJ5 A;  1VQ7 F;  1U3L A;  1YJW F;  1IV4 A;  4TV9 A;  5CA0 A;  2YCM A;  2RHH A;  3FD6 A;  3B6N A;  4G3S A;  1SDS A;  1LZ7 A;  5LA6 A;  3VTI C;  3CU0 A;  3JAS A;  1T0A A;  3OBW A;  4FFB B;  4DEC A;  2AE7 A;  3OGZ A;  1R7U A;  1KNJ A;  4FRH A;  4D0Z A;  4B45 A;  4AYL A;  1ON6 A;  2C0N A;  1G9R A;  5EJ1 A;  2XME A;  1NMM B;  4G4Y A;  1YJN F;  4DRX B;  5GON A;  4ZHQ B;  3JAW A;  2VAM A;  3WGM A;  3RYC B;  4CJC A;  4RHA A;  1T0K B;  2GZL A;  5C8Y B;  2Z87 A;  1FFX A;  5C1H A;  1XBI A;  2UYJ A;  4Y7G A;  1Q86 H;  1XHO A;  3F0G A;  4G3P A;  4BY9 D;  1Q7Y H;  3LWR C;  1VH8 A;  5CMG X;  3LME A;  1LZ0 A;  4G4W A;  2CZW A;  1W40 A;  5KMG B;  3SXG A;  1N8R H;  1K9M H;  3ST8 A;  1PZT A;  4LW6 A;  1X52 A;  4O4H B;  1G0R A;  5FU8 A;  1RQ2 A;  3FFM A;  1Q81 H;  1M90 H;  3CPW F;  4KC1 A;  3CCR F;  3N2K A;  5FJ4 C;  5C1G A;  3G6E F;  3MQW A;  5EIB C;  1RA4 A;  2AM5 A;  5JH7 A;  1ZI4 A;  1H5S D;  2LBW A;  3WGL A;  3M84 A;  5BXC A;  4IRQ A;  2KTU A;  3I0C A;  5GAN K;  3FBA A;  4KPX A;  3CCQ F;  3CPQ A;  1H4C A;  1QG8 A;  1NJI H;  2RB9 A;  5LYJ A;  3ELC A;  2DT4 A;  1RLG A;  1X7O A;  1H5T A;  4X1Y A;  3O85 A;  1VQ5 F;  1ZWZ A;  3QUW A;  5EZY B;  4XCQ A;  5LP6 B;  1JVG A;  3ERN A;  5BMV A;  4CJB A;  1QVF F;  1H5R B;  4PWT A;  2A8W A;  5DDT A;  3IOH A;  4Y9X A;  5EAZ A;  3D54 A;  5C3B A;  1YP4 A;  1GWW A;  5JQQ A;  1VM8 A;  2I6D A;  1VHA A;  5LOV B;  1ZJ0 A;  1QU9 A;  2ZU9 A;  3N9W A;  1ZJP A;  4B4B A;  4FRD A;  1GQ9 A;  4I50 B;  2MQE A;  3I55 F;  3F0E A;  4ECM A;  5CA1 B;  4M4K A;  3D5N A;  1IIM A;  2WGZ A;  5JVD A;  5LXT B;  4GBP A;  3O3P A;  2CW4 A;  2E8B A;  3HKD A;  3L7Q A;  1XHB A;  3V90 A;  1VH1 A;  4HO2 A;  2BO1 A;  3S02 A;  1GO1 A;  4X1I A;  5CB4 A;  1S4P A;  3OH3 A;  2OI6 A;  1H5S B;  4CVH A;  1VQM F;  1GX0 A;  3TD5 A;  3V4D A;  2RJ6 A;  3F6M A;  2OI5 A;  1H7M A;  4EE4 A;  4FQW A;  3HKB A;  1ODE A;  2WAL A;  2VSI A;  1ZJ2 A;  5IFY A;  2Y4M A;  2VXM A;  2YC5 A;  1VGT A;  4EEO A;  4Y7V A;  2IQQ A;  4TV8 B;  3JAL A;  5HS2 A;  2XWM A;  5HY1 A;  5IJ0 A;  3IOJ A;  1S72 F;  3RMW A;  1VGW A;  5JCO A;  4Y64 A;  1VQK F;  4HO5 A;  3P0Z A;  5FNV B;  4M8I A;  4ZHV A;  2Y4J A;  4LNU A;  2IAF A;  4O4I B;  1YI2 F;  5IJ9 B;  3RYH A;  1JJ2 F;  3T80 A;  3ZOP A;  5FYE A;  3NMU C;  4Y62 A;  3HAX D;  3ZP4 A;  4KC2 A;  5C38 A;  4WBN B;  3BCV A;  3CKV A;  2VGM A;  3M4S A;  1TUB B;  4I55 B;  2B33 A;  1FOA A;  1Z5V A;  2W8B C;  1H48 A;  3JAR A;  4ZI7 B;  2APC A;  4B3U A;  3LWV C;  4C2S A;  3RA5 A;  5EB0 A;  2VXY A;  1GZ0 A;  2VS5 A;  3K12 A;  5D91 A;  2FYC B;  3CMA F;  1H7T A;  3JTJ A;  5EJZ A;  4ZHW A;  4NAI A;  3VIU A;  2VS3 A;  4ZOL B;  2OTM A;  3PAF A;  1GX1 A;  3GUE A;  4DE7 A;  3WGJ A;  4EB6 B;  1U3P A;  3USR A;  4HO9 A;  1VQN F;  2QEX F;  5C49 A;  3CXC F;  1QWJ A;  3HKC A;  3K8D A;  2KTV A;  2VAW A;  1YGY A;  1G95 A;  2LBT A;  2NXV A;  2XWL A;  5IYZ B;  1XZ6 A;  1ZIZ A;  1VQV A;  2K1S A;  5DCV A;  1ON8 A;  2OTL F;  5CQM X;  4M28 A;  3EOR A;  4YJ3 A;  1YIJ F;  3GHZ A;  4X20 A;  1IIN A;  1H7Q A;  1IV3 A;  4JIS A;  3KIA A;  1YJ9 F;  2KG4 A;  4EE3 A;  2RIT A;  3KJJ A;  3VYT C;  4MIX A;  3OAM A;  2CWJ A;  3VI6 A;  1IV2 A;  1ZJ3 A;  4NWO B;  2GVI A;  1V82 A;  3FD5 A;  3QHD A;  5HP7 A;  1GX4 A;  1VPA A;  4D0T A;  4I4T A;  4TV9 B;  1ZI3 A;  5CA0 B;  2AM3 A;  2VXL A;  1GA8 A;  4EI8 A;  2OTJ F;  1WSZ A;  3VYS C;  5LA6 B;  4B5C A;  3GTZ A;  4L41 C;  3JAS B;  1S4O A;  4KNR A;  2Z1U A;  1JV1 A;  1G1L A;  2FGY A;  5C4E A;  5C48 A;  3I7T A;  2FY7 A;  4C8E A;  3FOQ A;  3IMP A;  5G4U C;  1NF5 B;  3ZP7 A;  5CQN X;  2HP3 A;  1VK3 A;  4C81 A;  3WJR A;  3OBY A;  5EWR A;  3FWW A;  3MCQ A;  2RIX A;  3ZF8 A;  4U39 A;  3S0Y A;  2WVL A;  4B2X A;  3JAW B;  4B42 A;  3OW2 F;  3ESJ A;  4TZZ A;  3D8V A;  1W5E A;  5GAP K;  3OKR A;  5FLX M;  3OH0 A;  1FFX B;  1HM8 A;  1FGG A;  5IDS A;  2ALE A;  4U3J A;  1V83 A;  1FG5 N;  4BT5 A;  1O0R A;  1VGU A;  4G4V A;  3I3F A;  3Q80 A;  4BVQ A;  1ZJ1 A;  3I56 F;  2AM4 A;  2QKX A;  3SX7 A;  2YXZ A;  3UT5 A;  2A8U A;  4G4Z A;  4EEA A;  1W2B F;  2P6Y A;  4F6R A;  1ONI A;  3N2K B;  3VOB A;  2AES A;  2BTO A;  3N2G A;  1WT3 A;  3OH2 A;  3HKE A;  3CCV F;  5JH7 B;  1R81 A;  5C47 A;  3WJP A;  3WPX A;  5KX5 A;  2P6W A;  5HY2 A;  1H4D A;  2UYN A;  2X65 A;  5C3A A;  3SXC A;  4DDZ A;  1NHE B;  4O6M A;  3EE5 A;  2H6L A;  3V0M A;  3NK7 A;  3V0P A;  5EYP A;  3P10 A;  1W57 A;  1H5T B;  4X1Y B;  5CMJ A;  2GLZ A;  4RQO A;  5CMI A;  2HS0 A;  4TUY B;  3SXE A;  4ZK7 A;  3RYF B;  5BMV B;  4FRM A;  2Q1Y A;  1Z90 A;  2ZVZ A;  3AGK A;  3S0H A;  1VQP F;  3OH4 A;  1VQ6 F;  3E20 B;  1W5A A;  4EI7 A;  1MP5 A;  1Q8R A;  3WGN A;  5JQG A;  3JUK A;  3E22 A;  2JCO A;  3KJK A;  4IRP A;  3SIU A;  1NQ3 A;  3D01 A;  3GYQ A;  1YP2 A;  4B4G A;  1PXW A;  3DJ4 A;  1R7V A;  5DDV A;  4O2B A;  4KNX A;  5JVD B;  1LL3 A;  4FRA A;  2ICY A;  4B2W A;  5AJP A;  3HKD B;  4NAL A;  3TQD A;  3U2U A;  3V8Y A;  2J0B A;  3I0D A;  5J2U A;  2Y4K A;  3D98 A;  4X1I B;  1K4V A;  5CB4 B;  4HO6 A;  5CMF X;  3G4S F;  3PKQ A;  3DC2 A;  3ZLL A;  4FFB A;  1W5F A;  1SZQ A;  3FPI A;  4BT4 A;  1G23 A;  2UX8 A;  2O1G A;  1X25 A;  1K73 H;  3HKB B;  1DT9 A;  3VYU C;  4X3L A;  4CJ8 A;  2V0I A;  4KXO A;  2YYE A;  3TD4 A;  1WT1 A;  5I1F A;  2Z86 A;  3JAL B;  4IIJ B;  3QTY A;  4NAN A;  1FZW A;  5IJ0 B;  3KHN A;  5MN4 A;  4NQ3 A;  3RMV A;  3WJQ A;  1M1K H;  2Q1X A;  2VFZ A;  2ZVY A;  2R6R 1;  1S4N A;  2VS4 A;  4ZHY B;  4BQH A;  4LNU B;  4FRP A;  3BRK X;  3RYH B;  3NVK E;  2ZAU A;  3VOA A;  4EEM A;  1H7F A;  1W42 A;  2DPW A;  3V0O A;  5CQL X;  1HV9 A;  1SS9 A;  2OZB A;  3P4E A;  1R82 A;  1CK2 A;  4R7P A;  4LCK A;  4MYB A;  2XWN A;  5CMH A;  4HOC A;  1VZX A;  2V0J A;  4ZDQ A;  5FTV A;  2HQS C;  2OEF A;  1Z5W A;  3K8E A;  3NK6 A;  4P00 A;  1OAP A;  4C82 A;  3K0T A;  3U2X A;  1KQS F;  4FRE A;  4YJ2 A;  1W3E X;  5HP8 A;  3Q4S A;  2RJ9 A;  1Q82 H;  1JY8 A;  2N48 A;  3ON1 A;  1V84 A;  3CB2 A;  2AGD A;  1INJ A;  2RJ7 A;  2ZF8 A;  4C8I A;  1R7X A;  2HX0 A;  4XWI A;  3CME F;  2GGQ A;  1I52 A;  2RJ0 A;  1ZCT A;  4HO8 A;  3I0J A;  3JAK A;  2HRY A;  1J7H A;  3IKE A;  1TW1 A;  2H8C A;  2VAP A;  2HP0 A;  4EVW A;  4NAK A;  2VGN A;  1ZHJ A;  4YJ3 B;  4X20 B;  1G2V A;  4BVR A;  2L26 A;  1FWY A;  1YIT F;  4EI9 A;  4AAW A;  1LL2 A;  1K8A H;  1VQ8 F;  3ZLK A;  1QGQ A;  3CYP B;  1GWV A;  1H7E A;  2W0V A;  5HWE A;  4I4T B;  2OHW A;  2PA4 A;  3G71 F;  3RYI A;  5FU0 A;  3R2W A;  2UZH A;  4KT7 A;  2RIZ A;  2Y7A A;  5EIB D;  1QD9 A;  5AJN A;  2I6R A;  5C8R A;  2RIY A;  2PX7 A;  2X5Z A;  1SA0 A;  2RHO A;  2JCL A;  5LP6 C;  3JUJ A;  5J2T A;  3LWO C;  4R40 B;  1U40 A;  2RJ1 A;  1FR9 A;  1KC8 H;  1YQN A;  2P72 A;  3F1Y A;  3IKF A;  2AMT A;  2JCJ A;  2VK9 A;  1LL0 A;  3POL A;  3DUV A;  1CLI A;  3CC7 F;  1ZCY A;  3CKQ A;  3OH1 A;  4BT3 A;  4Q7C A;  1VH3 A;  3E26 A;  2UYK A;  2LBX A;  1R7Y A;  4U3J B;  5C4C A;  1QVG F;  4Y63 A;  4C8G A;  1W59 A;  1UFY A;  1XRG A;  4B4M A;  1NQI B;  2OEG A;  1PZY B;  1JFF A;  2DYY A;  1G8O A;  1JYK A;  3UT5 B;  2PGY A;  1WVC A;  3IOI A;  2ICX A;  4D11 C;  1JN1 A;  4F6R B;  3DDN A;  4O4J A;  2YQS A;  3N4Z A;  3N2G B;  1YP3 A;  1H5S C;  3HKE B;  5IT9 M;  2F9Z C;  4HO0 A;  5KX5 B;  3PKP A;  2YQC A;  2UYN B;  1HM9 A;  4ASY A;  4LW3 A;  5HXU A;  3KE1 A;  4Y6N A;  2Z1T A;  3E25 A;  2CHS A;  2EWC A;  4BT7 A;  1UI9 A;  5EYP B;  4BVT A;  4E1K A;  2QI2 A;  3LYB A;  2J0A A;  4ZOL A;  3CCJ F;  3LDT A;  1O7Q A;  2BO6 A;  5GON B;  3T7M A;  4FCE A;  3U2W A;  4G87 A;  4IHJ A;  2R75 1;  3V7Q A;  4AYJ A;  3C9U A;  1WT0 A;  1TVK A;  1YRO B;  1ZI5 A;  2Q4J A;  3I0K A;  3V0N A;  4O2A A;  5JQG B;  3E22 B;  1MP4 A;  4FRB A;  3CC4 F;  4KQL A;  1ZDF A;  3LFO A;  2JNB A;  3KIZ A;  4FIY A;  5IDT A;  4O4L A;  4HNA A;  4FRQ A;  1OFU A;  4O6N A;  3SXD A;  4O2B B;  2ZU8 A;  4YS8 A;  3J81 M;  1CN7 A;  2FYA A;  5CQO A;  3ZO8 A;  1GQC A;  5EB1 B;  5C36 A;  2VD4 A;  5A2Q M;  1JVD A;  3V0Q A;  2FFV A;  1E5K A;  1O7O A;  1QGS A;  1W77 A;  3OC9 A;  1FO9 A;  2CVL A;  2BO7 A;  5J2U B;  3C8L A;  4EE5 A;  2O1H A;  4G4X A;  1DBF A;  5LYJ B;  3V8Z A;  1FGX A;  2YQH A;  4KRV A;  2OI7 A;  3V0L A;  3N4Y A;  1G93 A;  2NMU A;  1TW5 A;  4ASJ A;  1ZI1 A;  4HO4 A;  2WVK A;  2D0J A;  3I0I X;  2MZB A;  4B5B A;  4B62 A;  4MND A;  3CGX A;  1EZI A;  5EO3 A;  3T7N A;  3CG6 A;  2QA4 F;  2W0W A;  4X1K A;  3WPW A;  1VGZ A;  4HG6 A;  1OQM B;  1VQL F;  1LZI A;  3R3I A;  4P02 A;  4KC4 A;  4JD0 A;  3Q8H A;  3E1Y A;  3JAT A;  1R7T A;  2FYD B;  5ITZ A;  4E6E A;  1H47 A;  2HRU A;  1RQ7 A;  2ZU7 A;  5C4B A;  1W55 A;  1RLU A;  5MN5 A;  5FV9 A;  3U2V A;  2YES A;  3C9T A;  3TD3 A;  2Z1E A;  3VMF B;  3V7E A;  1FXO A;  2YC3 A;  3Q7U A;  3JCM M;  3V91 A;  1H7G A;  1VQO F;  1H4E A;  1MP3 A;  3I0H A;  5C3D A;  4YJ2 B;  3CKO A;  1X7P A;  3U0Y A;  3HWU A;  5D92 A;  2BO4 A;  3MCA B;  5GIP C;  1NWG B;  2PGV A;  3SX8 A;  2ZOD A;  1TZF A;  1FNK A;  2X60 A;  1FO8 A;  3JAM M;  1ZJO A;  2CSL A;  2G9I A;  3ZGF A;  1G3L A;  4M2A A;  1NKH B;  4DRX A;  4ZHQ A;  3HL3 A;  4BT2 A;  4TUY A;  1NMU B;  3JAK B;  2BTQ B;  3RYF A;  3RYC A;  2IG8 A;  5C1L A;  1R1M A;  4KWE A;  2V0H A;  1H7H A;  5C8Y A;  2CHT A;  2HP0 B;  2E3D A; 
#chains in the Genus database with same CATH homology
 2XME A;  1ZCU A;  1NMM B;  3DK5 A;  1GWV A;  1G1L A;  3IEQ A;  1H7E A;  2W0V A;  2Y4L A;  5EIY A;  5C4E A;  5C48 A;  2FY7 A;  4C8E A;  3FOQ A;  2PA4 A;  5FU0 A;  2RJ8 A;  3R2W A;  1NF5 B;  2UZH A;  4KT7 A;  5CQN X;  4CJC A;  2D7R A;  2GZL A;  4C81 A;  2RIZ A;  2Y7A A;  2VSH A;  2Z87 A;  5C1H A;  3FWW A;  5AJN A;  2RIX A;  5C8R A;  3ZF8 A;  4Y7G A;  2V0L A;  1G97 A;  3F0G A;  2RIY A;  4FCU A;  2PX7 A;  2X5Z A;  4G3P A;  2WE9 A;  2WVL A;  4B2X A;  2JCL A;  3JUJ A;  3ZGG A;  1VH8 A;  2RJ4 A;  5CMG X;  4B42 A;  1U40 A;  3ESJ A;  3D8V A;  1LZ0 A;  2RJ1 A;  3OKR A;  3OH0 A;  5AJO A;  2CU2 A;  3SXA A;  1FR9 A;  1HM8 A;  3SXG A;  1YQN A;  2P72 A;  1FGG A;  5IDS A;  3ST8 A;  1PZT A;  4LW6 A;  3F1Y A;  3IKF A;  2AMT A;  1G0R A;  2JCJ A;  5FU8 A;  3I0F A;  1HM0 A;  1V83 A;  1FG5 N;  1O0R A;  2VK9 A;  1LL0 A;  3POL A;  3DUV A;  4KC1 A;  1H3M A;  1VGU A;  5C1G A;  3U2T A;  1ZCY A;  4K6R A;  3CKQ A;  3Q80 A;  1IV1 A;  1ZJ1 A;  2AM4 A;  3OH1 A;  3SX7 A;  2QKX A;  3TZT A;  3I0E A;  4Y7F A;  2AM5 A;  1ZI4 A;  4FIX A;  4Q7C A;  1VH3 A;  3E26 A;  4HO3 A;  1H5S D;  2A8U A;  2I7B A;  3F0F A;  1R7Y A;  5BXC A;  4EEA A;  4IRQ A;  3I0C A;  5C4C A;  2Y6P A;  2YQJ A;  2JCK A;  4Y63 A;  3FBA A;  4KPX A;  1HJL A;  4C8G A;  1MC3 A;  4B4M A;  2AES A;  1H4C A;  1NQI B;  1H5R A;  1QG8 A;  2AH9 A;  2OEG A;  2V0K A;  1WT3 A;  3OH2 A;  1PZY B;  3ELC A;  1H5T A;  4Y6U A;  1FRW A;  1G8O A;  1R81 A;  5C47 A;  1JYK A;  2P6W A;  2FYB A;  2PGY A;  1WVC A;  3QVB A;  3IOI A;  1H4D A;  2ICX A;  2X65 A;  5C3A A;  1INI A;  4D11 C;  3SXC A;  1JN1 A;  4DDZ A;  1NHE B;  1JVG A;  4O6M A;  3ERN A;  3EE5 A;  4CJB A;  3V0M A;  3F0D A;  4ARW A;  2YQS A;  1H5R B;  3V0P A;  2A8W A;  1YP3 A;  1H5S C;  3IOH A;  5DDT A;  3P10 A;  3SX3 A;  1W57 A;  4Y9X A;  2I5K A;  1H5T B;  1OMX A;  4HO0 A;  4D48 A;  5CMJ A;  5C3B A;  1YP4 A;  3PKP A;  1ZCV A;  1GWW A;  5CQP A;  5JQQ A;  2YQC A;  1VM8 A;  5CMI A;  1HM9 A;  2QGI A;  4ASY A;  3SXE A;  4LW3 A;  3KE1 A;  1VHA A;  4Y6N A;  3E25 A;  5C4F A;  1WT2 A;  1ZJ0 A;  1ZDG A;  4FRM A;  4J18 A;  2ZU9 A;  4E1K A;  1Z90 A;  3N9W A;  1ZJP A;  4HCQ A;  4B4B A;  4FRD A;  1GQ9 A;  3RE3 A;  2X5S A;  2J0A A;  4Y7U A;  2WEE A;  2WVM A;  1LZJ A;  1O7Q A;  1O23 B;  3OH4 A;  4FRL A;  3F0E A;  2BO6 A;  4ECM A;  4D11 A;  4M4K A;  1TVY A;  3D5N A;  1IIM A;  2WGZ A;  1H7L A;  3T7M A;  4KPZ A;  3CKN A;  3NGW A;  4GBP A;  4FCE A;  1MP5 A;  3MBM A;  3O3P A;  2O1F A;  3JUK A;  1H5S A;  4Y7T A;  2E8B A;  5B8F A;  3PNN A;  2JCO A;  4IRP A;  1XHB A;  3V90 A;  1VH1 A;  3U2W A;  4HO2 A;  4G87 A;  1YP2 A;  4B4G A;  2XMH A;  2FFU A;  1KNK A;  5C4D A;  3DJ4 A;  3SXB A;  4AYJ A;  1R7V A;  5DDV A;  4KNX A;  1WT0 A;  2WAW A;  2P73 A;  4G3Q A;  1YRO B;  1LL3 A;  1ZI5 A;  1S4P A;  2Q4J A;  3I0K A;  3OH3 A;  3V0N A;  4FRA A;  2ICY A;  2OI6 A;  4B2W A;  5AJP A;  1H5S B;  4CVH A;  1MP4 A;  4FRB A;  4NAL A;  1GX0 A;  4KQL A;  3TQD A;  1ZDF A;  3U2U A;  2RJ6 A;  3T7O A;  3V8Y A;  3F6M A;  2OI5 A;  4FIY A;  5IDT A;  4EE4 A;  4FQW A;  2J0B A;  3I0D A;  4FRQ A;  2VSI A;  3CKJ A;  1ZJ2 A;  4O6N A;  5IFY A;  2Y4M A;  3SXD A;  2ZU8 A;  2VXM A;  4YS8 A;  2YC5 A;  1VGT A;  2Y4K A;  4EEO A;  1FXJ A;  3D98 A;  1K4V A;  4Y7V A;  4HO6 A;  5CMF X;  2FYA A;  5CQO A;  3PKQ A;  1GQC A;  3ZLL A;  5HS2 A;  2XWM A;  5C36 A;  3RSB A;  2VD4 A;  1JVD A;  3IOJ A;  3V0Q A;  2FFV A;  1E5K A;  3RMW A;  1VZT A;  1O7O A;  3FPI A;  1G23 A;  2UX8 A;  1QGS A;  1FR8 A;  1VGW A;  1W77 A;  3OC9 A;  1FO9 A;  2O1G A;  1U43 A;  4Y64 A;  1VIC A;  2BO7 A;  4HO5 A;  3P0Z A;  4EE5 A;  2O1H A;  4CJ8 A;  2V0I A;  1JYL A;  2Y4J A;  4KXO A;  3V8Z A;  1FGX A;  2YQH A;  1WT1 A;  5I1F A;  2Z86 A;  2QH5 A;  4KRV A;  3T80 A;  4NAN A;  2OI7 A;  1FZW A;  3SX5 A;  3V0L A;  3USQ A;  1LVW A;  5FYE A;  1G93 A;  1VZU A;  3SPT A;  3RMV A;  1KWS A;  1TW5 A;  4ASJ A;  1ZI1 A;  5FUH A;  4HO4 A;  4Y62 A;  2WVK A;  2D0J A;  3I0I X;  2VFZ A;  3LW6 A;  4KC2 A;  2MZB A;  5C38 A;  3BCV A;  4AC3 A;  4B5B A;  1S4N A;  3CKV A;  2VS4 A;  4MND A;  4BQH A;  4FRP A;  1OMZ A;  1FOA A;  3BRK X;  3CGX A;  1EZI A;  1H48 A;  3T7N A;  2APC A;  5L6V A;  4FRO A;  1H7F A;  4B3U A;  4EEM A;  4C2S A;  2DPW A;  3V0O A;  2W0W A;  5CQL X;  2VS5 A;  1HV9 A;  4BMA A;  2BO8 A;  1SS9 A;  5D91 A;  5FTS A;  3K2X A;  3F1C A;  2FYC B;  5J49 A;  1VGZ A;  5L6S A;  4HG6 A;  1R82 A;  1H7T A;  3JTJ A;  1JV3 A;  1OQM B;  4R7P A;  5EJZ A;  1LZI A;  3R3I A;  4MYB A;  2XWN A;  4P02 A;  4NAI A;  4KC4 A;  2VS3 A;  5CMH A;  4HOC A;  4JD0 A;  2PMP A;  3Q8H A;  1VZX A;  2V0J A;  1GX1 A;  3GUE A;  4ZDQ A;  4DE7 A;  1EYR A;  5FTV A;  1R7T A;  2GGO A;  2FYD B;  4M2B A;  1U3P A;  1H47 A;  4HO9 A;  2AEC A;  2OEF A;  4UEG A;  2D7I A;  3USR A;  2ZU7 A;  5C4B A;  1W55 A;  5C49 A;  3K8E A;  5FV9 A;  3I0G A;  4P00 A;  3U2V A;  3U0X A;  2YES A;  3K14 A;  4C82 A;  1QWJ A;  3U2X A;  3JVH A;  4FRE A;  3K8D A;  1G95 A;  2I5E A;  4EEG A;  3I0L A;  3Q4S A;  3IEW A;  2RJ9 A;  1R80 A;  1JY8 A;  2NXV A;  1FXO A;  1V84 A;  2YC3 A;  2XWL A;  1ZIZ A;  1XZ6 A;  2AGD A;  1HJJ A;  1INJ A;  3Q7U A;  3V91 A;  2RJ5 A;  1ON8 A;  2RJ7 A;  4C8I A;  1R7X A;  1H7G A;  4XWI A;  5CQM X;  4M28 A;  1U3L A;  1H4E A;  1MP3 A;  3EOR A;  1H7Q A;  3GHZ A;  1IIN A;  1IV4 A;  1I52 A;  2GGQ A;  1IV3 A;  3I0H A;  4JIS A;  2RJ0 A;  1ZCT A;  5C3D A;  4HO8 A;  3KIA A;  3I0J A;  3CKO A;  2YCM A;  3B6N A;  4G3S A;  3U0Y A;  5D92 A;  4EE3 A;  2RIT A;  2BO4 A;  3IKE A;  1NWG B;  1LZ7 A;  1TW1 A;  2PGV A;  3SX8 A;  4MIX A;  3OAM A;  1TZF A;  3CU0 A;  1IV2 A;  1ZJ3 A;  2X60 A;  1FO8 A;  4EVW A;  4NAK A;  1ZHJ A;  1T0A A;  1V82 A;  1ZJO A;  3QHD A;  1GX4 A;  1G2V A;  1VPA A;  4D0T A;  3ZGF A;  1G3L A;  1FWY A;  4M2A A;  1ZI3 A;  1NKH B;  2AE7 A;  4DEC A;  2AM3 A;  2VXL A;  1GA8 A;  3HL3 A;  4AAW A;  1LL2 A;  1WSZ A;  3OGZ A;  1R7U A;  1KNJ A;  4FRH A;  5C1L A;  2V0H A;  4D0Z A;  1H7H A;  4L41 C;  3ZLK A;  1S4O A;  4AYL A;  1ON6 A;  1QGQ A;  4KNR A;  2E3D A;  2C0N A;  1G9R A;  5EJ1 A;  1JV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...