1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
4HG6A 3F0DA 1OQMB 3QVBA 1EYRA 1H7LA 4P02A 4NAKA 2QKXA 3USQA 4ARWA 2BO8A 4B42A 1NMMB 1ZCYA 2ZU9A 4ASYA 4Y63A 3NGWA 1VZXA 2FFUA 2O1GA 2I5EA 3MBMA 1H7TA 3JUJA 3K8EA 3FPIA 1SS9A 1H5RB 3CGXA 3OH1A 5FU0A 2RJ8A 5C4DA 2FYCB 3T80A 3USRA 1WT2A 1U3LA 1TZFA 2NXVA 1YROB 4G3SA 1IINA 1R81A 4FRMA 4KXOA 1FZWA 4MNDA 4M2BA 4EEOA 3P0ZA 2YQSA 2GGOA 3T7MA 1VZUA 2Y4LA 4C81A 5C48A 2RJ6A 1Z90A 2AE7A 2GGQA 2Y4MA 2D7RA 1MC3A 3DK5A 3T7OA 1H4DA 1R7TA 2E3DA 1FOAA 3OH0A 3SX5A 3RMWA 2YCMA 1XHBA 1EZIA 3PNNA 3ELCA 2AECA 3K14A 1FR8A 3O3PA 4EEAA 3U0XA 4JD0A 2JCJA 2WVKA 2Y4JA 3DUVA 4M4KA 4ZDQA 5CMJA 1ZI1A 2FY7A 3IEWA 3OH3A 3IOIA 4B5BA 3IOJA 3U2TA 1MP5A 3BRKX 3ZGGA 1H7FA 4KC4A 1R80A 2A8UA 4R7PA 2Z87A 4D0ZA 4Y7VA 3POLA 2QH5A 3I0LA 3JUKA 3I0CA 1V84A 5J49A 4HO4A 3U2UA 2Y7AA 2O1FA 2VD4A 3SX3A 2OEGA 1H4CA 2A8WA 1FG5N 1H48A 1H7EA 1ZJPA 2W0VA 1G8OA 1LZIA 4P00A 3R3IA 2GZLA 2RIXA 2V0KA 4CJBA 2BO7A 2WGZA 2I5KA 5DDTA 1INIA 3CKNA 1LL0A 3LW6A 1WT0A 5C1LA 4AYLA 4ECMA 4E1KA 1FRWA 1G0RA 1LL3A 1O0RA 1GQCA 1U43A 1JVGA 5C1GA 1OMXA 4NALA 3ST8A 1JY8A 2YQHA 3SX8A 1W77A 2YQCA 1H7GA 5C36A 1JV3A 2ICXA 3KE1A 1LZ0A 3SXBA 1HJLA 1PZTA 4MYBA 1TW5A 3U2WA 2RJ5A 1QG8A 1ZIZA 1E5KA 2AGDA 2D0JA 2VSIA 4KPXA 4KQLA 4B3UA 4B4BA 4C8GA 1VGTA 3ESJA 1IV3A 4HO6A 5C38A 4GBPA 1VHAA 3RSBA 4L41C 2X60A 2X5SA 1FR9A 4FRBA 5C4CA 1S4PA 4FRDA 1G3LA 4BMAA 4HO0A 1H7QA 4Y64A 1ZI5A 3OGZA 3Q8HA 2AMTA 1WVCA 4HO3A 1YQNA 1ZJ0A 3RMVA 2FYDB 1NKHB 2RJ4A 1HM9A 1H47A 1V82A 1VGWA 2D7IA 4Y7FA 4XWIA 5C4EA 3SXEA 1LZ7A 2P73A 1GX1A 1H7HA 1HM0A 4FQWA 5EJ1A 5C3AA 4D48A 2XWLA 2Y6PA 3PKQA 5C3BA 2VS3A 3F6MA 1NQIB 4Y7GA 5I1FA 1ZJOA 2VXMA 3I0GA 4FRHA 3KIAA 4LW3A 3SXGA 1JN1A 2WVMA 4FROA 1QGSA 2JCKA 1WSZA 1FO9A 2XWNA 3I0EA 4B4MA 3ZF8A 3V90A 2UX8A 2XMEA 5CQMX 3Q80A 5EIYA 3OH2A 1G97A 1H5TA 3EE5A 3ERNA 4EVWA 1ZCUA 4AC3A 1IIMA 2WVLA 3K8DA 5L6SA 1R82A 1H5SA 3I0DA 5IFYA 3BCVA 1LVWA 1R7YA 3FWWA 2WE9A 3IOHA 4IRPA 1G9RA 1R7VA 2Z86A 3R2WA 2WAWA 2CU2A 3OKRA 4K6RA 3V0MA 3OC9A 4AAWA 4FRQA 4C82A 1ON6A 3CKJA 4HOCA 5JQQA 5HS2A 3TZTA 3V8YA 1VGUA 3SXAA 2FYBA 3JVHA 4M2AA 5C47A 1H5RA 3OH4A 2RJ0A 4FREA 3CU0A 2PMPA 1IV4A 2V0JA 1VPAA 4KPZA 3OAMA 4NANA 1VH8A 2VS5A 1FGXA 4G87A 4KC2A 1U40A 3F1CA 4EE4A 1H5SC 2PX7A 4Y7TA 1LL2A 2RITA 1IV1A 3V0LA 5L6VA 1H3MA 5DDVA 1OMZA 1TW1A 3U0YA 3F0GA 1XZ6A 3E26A 4Y62A 1PZYB 1ZDGA 1ZI3A 3N9WA 3IKFA 1VM8A 2ZU8A 1GX0A 3I0IX 1JYKA 1KWSA 4Y6UA 4C8IA 3I0FA 1FWYA 5CQPA 3V0PA 3I0KA 2VSHA 2V0IA 4Y9XA 2RJ7A 4FCEA 5CQOA 2PGVA 5FV9A 4FRLA 3E25A 2PGYA 4CVHA 4HO8A 1FO8A 2RJ9A 1FXJA 2VS4A 4FRPA 1VICA 3SXDA 2PA4A 1GA8A 4J18A 1ON8A 3D98A 2RIYA 4D0TA 3IKEA 1H5TB 2O1HA 2YC3A 4KT7A 2P6WA 1G1LA 5CQNX 1G93A 5C4BA 2DPWA 1KNKA 1VZTA 1H5SB 3IEQA 5FTSA 1FXOA 1G95A 1GQ9A 2OI7A 2V0HA 5C3DA 4G3PA 3QHDA 1S4NA 2BO4A 4ASJA 1ZJ1A 2X65A 2OI5A 1ZI4A 2W0WA 1ZCVA 2AH9A 2AM4A 3V8ZA 1ZDFA 2MZBA 4EEMA 5CQLX 3Q4SA 1QWJA 4EE5A 4B2WA 4KC1A 5C4FA 1R7XA 1S4OA 1INJA 2P72A 3PKPA 1HV9A 3GHZA 4HO2A 1JVDA 4NAIA 5EJZA 5IDSA 1NHEB 5B8FA 3Q7UA 1JV1A 4YS8A 3ZLLA 4FRAA 4CJ8A 1U3PA 3TQDA 1VH1A 2APCA 2XMHA 1H4EA 2FFVA 3SX7A 4HCQA 5C8RA 3JTJA 1O7QA 1ZJ3A 2JCLA 3F0EA 1MP4A 2X5ZA 1R7UA 4UEGA 4C2SA 1TVYA 5IDTA 4M28A 3V0NA 4EEGA 2OI6A 5BXCA 3ZGFA 3DJ4A 1ZCTA 2RIZA 3SXCA 2VFZA 2I7BA 3CKVA 1IV2A 3FOQA 3U2XA 3D5NA 3GUEA 3SPTA 1G2VA 4Y6NA 3U2VA 4EE3A 2V0LA 2OEFA 5CMFX 5AJNA 4HO5A 3F0FA 1W57A 1VH3A 4B4GA 2AM3A 4FCUA 1KNJA 1HJJA 1ZHJA 2Y4KA 2YC5A 1GWVA 1ZJ2A 4AYJA 1V83A 2RJ1A 1T0AA 2QGIA 1GWWA 4DECA 1LZJA 4G3QA 3I0JA 1YP3A 3V91A 3RE3A 1YP4A 5AJOA 4KNRA 2E8BA 2AESA 3D8VA 4KRVA 4Y7UA 1GX4A 2FYAA 5CMHA 4D11A 3EORA 2WEEA 1NF5B 1K4VA 5CMGX 4IRQA 2YQJA 1NWGB 2ZU7A 5C1HA 1MP3A 4BQHA 3CKQA 5AJPA 3ZLKA 2VXLA 3B6NA 5FUHA 4C8EA 4HO9A 4CJCA 4LW6A 4JISA 5FYEA 3P10A 1YP2A 2BO6A 1HM8A 3V0QA 3K2XA 1QGQA 1O23B 1H5SD 3FBAA 1O7OA 3F1YA 3HL3A 5FTVA 5FU8A 1JYLA 3V0OA 2Q4JA 1VGZA 4DE7A 1W55A 1WT3A 2UZHA 2XWMA 2JCOA 2YESA 5CMIA 2AM5A 1FGGA 3I0HA 4D11C 4B2XA 5C49A 1I52A 1G23A 1WT1A 4KNXA 4DDZA 2ICYA 3CKOA 3T7NA
chains in the Genus database with same CATH superfamily
3JATA 4P02A 5GONA 1NMMB 5LYJB 2ZU9A 3PAFA 3MDOA 3C9RA 4Y63A 3IR9A 2O1GA 3MBMA 3ZP4A 1H7TA 1SS9A 5FU0A 4ZI7B 1X25A 2C0NA 1WT2A 1U3LA 4LCKA 1TZFA 2NXVA 5IYZB 1R81A 1M1KH 4DXDA 4M2BA 3LWRC 2AIFA 2B33A 4IHJB 2GGOA 3T7MA 5LXTB 1Z90A 3T7OA 2D7RA 2IAFA 1FOAA 3SX5A 2YCMA 2J0AA 2H6LA 5HP7A 3ELCA 2AECA 3K14A 3JAWA 2LBXA 5GANK 4M4KA 1VQNF 2FY7A 1YITF 3CCLF 4IIJA 4YJ3B 1KD1H 2A8UA 2CHTA 3POLA 3U0OA 3VMFB 1V84A 1Z5WA 5ITZA 2FC3A 4LNUA 1H7EA 2W0VA 1G8OA 5IJ0B 1LZIA 3MCAB 2GZLA 3JARA 2WGZA 1INIA 3OBWA 1JJ2F 5C1LA 4I4TB 1O0RA 1GQCA 3S02A 1U43A 4O4JA 1OMXA 3ST8A 3SX8A 2YQCA 1JV3A 3J80M 3KE1A 4EI8A 1LZ0A 4ZHQA 4MYBA 1TW5A 3CCMF 5LP6C 2RJ5A 5EIBD 1TVKB 5JH7A 4KQLA 4B4BA 1VGTA 3ESJA 3RA6A 2V9YA 4FRBA 2P6YA 1FR9A 4FRDA 1G3LA 2DT4A 4BMAA 5CA1B 4X1KA 3SIUA 5LOVB 5JVDA 3HKEA 3LWVC 2EWCA 1HM9A 1V82A 2D7IA 5BMVA 4ZK7A 3K12A 2P73A 5EJ1A 5LP6B 3WJPA 1YHQF 4NQ3A 5J2UA 2VXMA 3N2KA 3KJJA 1W581 3VOAA 3C8LA 3V90A 2XMEA 3G4SF 5CQMX 5KX5A 1H5TA 3EE5A 3ERNA 5J2TB 2WVLA 3K8DA 5L6SA 1H5SA 3BCVA 5EB0A 1R7YA 3R2WA 2GVIA 2CU2A 3CKJA 3V8YA 3CXCF 2BTUA 1U40A 1Q7YH 4X1YB 5CA0B 3U0YA 3F0GA 1XZ6A 1PZYB 2VK9A 1VM8A 3LFOA 2OHWA 4C8IA 3I0FA 5CQPA 1W2BF 1DBFA 1RLUA 2PGVA 4ZHWA 3WJRA 3OONA 5EYPB 3SXDA 5HY4A 2PA4A 1GA8A 1GO1A 1W5FA 4D0TA 1XBIA 4KT7A 2P6WA 1G1LA 3WGLA 3IEQA 1FXOA 5C3DA 3QHDA 4O4LB 4YJ3A 4YJ2B 2AM4A 2AH9A 3V8ZA 5CQLX 3Q4SA 4B2WA 5C4FA 4X20B 1R7XA 3CC2F 3G6EF 3N4ZA 1JVDA 2I6RA 5EJZA 2UYPA 2OTLF 1JV1A 2ZVYA 5KMGB 3CC7F 3TQDA 1R1MA 1NJIH 3SX7A 4HCQA 1O7QA 1ZJ3A 3F0EA 3E22A 3JAMM 1QVGF 4C2SA 4EEGA 3DJ4A 3S06A 3KHNA 2HRYA 2RHLA 3E20B 2OTMA 2I7BA 3CYPB 4TZZA 3GUEA 1G2VA 4E6EA 4EE3A 2V0LA 2HS4A 5AJNA 2KGWA 1X52A 1VQVA 2VGNA 2YC5A 1ZJ2A 4AYJA 1V83A 1VQOF 4G3QA 1K9MH 3V91A 4KNRA 2AESA 4KRVA 3DC2A 3CG6A 3OW2F 1K4VA 2Z1FA 1MP3A 3WPXA 5AJPA 1SZQA 2VXLA 3KIZA 3B6NA 1K73H 4HO9A 4F6RA 3VOBA 4JISA 1YP2A 3V0QA 5FNVB 1S72F 3F1YA 2HS0A 4I55B 1W5AA 1W55A 2XWMA 5JQGB 3CCSF 1FGGA 3I0HA 4D11C 5EIBC 1Q86H 1I52A 1YI2F 2CZWA 3CKOA 3IMPA 1EYRA 1H7LA 1VQ4F 3USQA 1ZCYA 3HKCA 3RYHB 3CCRF 3N2GA 1VZXA 1XV2A 1VQ7F 3FPIA 4EI7A 1H5RB 3CGXA 3OH1A 2RJ8A 2FYCB 3T80A 1RQ7A 3WXMB 4U39A 3WGJA 1FZWA 4ZOLA 2YQSA 4X1YA 5CA0A 2Y4LA 4C81A 2RJ6A 2AE7A 2Y4MA 1Q8RA 3M84A 3CCUF 3RMWA 4BVRA 1XHBA 4EEAA 4JD0A 2JCJA 2WVKA 4B45A 2KTVA 4ZDQA 3TD3A 3NVKE 5CMJA 4B5BA 5HWEA 3IOJA 2N48A 4O2BB 1H7FA 4KC4A 4D0ZA 4Y7VA 3JUKA 4X3LA 1Q81H 3U2UA 4O4LA 1TUBA 3SX3A 2OEGA 5HXUA 2CVLA 4BT6A 4P00A 4BT3A 4U3JA 2V0KA 5HY0A 3VYSC 5DDTA 1COMA 1VQMF 4NWOB 1YIJF 3LW6A 2RHOA 3HKBB 3RYCB 5HY2A 1M90H 1JVGA 2ZVZA 5CB4B 4I50B 4FIYA 5C36A 3NMUC 2ICXA 3SXBA 1PZTA 2Q1YA 4HNAB 3VO8A 1E5KA 2AGDA 2VSIA 4KPXA 4B3UA 1IV3A 5C38A 2OTJF 4GBPA 5DCVA 5C4CA 1FFXB 1H7QA 2QTPA 1SDSA 5EZYB 1VK3A 2Z1TA 4HO3A 3C9SA 1YQNA 3RMVA 5FJ4C 4TV9B 1NKHB 3RYFA 4FFBB 2HVYD 2NMUA 1H47A 1IPAA 4XWIA 3LWPC 3SXEA 1H7HA 5HP8A 2Y6PA 1FNKA 3D01A 4BVSA 2VS3A 1NQIB 4Y7GA 1ZJOA 3I0GA 3KIAA 4O2AB 3MQWA 1WSZA 1FO9A 3ZF8A 3Q80A 1JFFA 1G97A 2HP0A 2JNBA 4BW0B 4WBNA 4X1IA 1R82A 5IFYA 1LVWA 3S0YA 3FWWA 4IRPA 3VYUC 3ZP7A 3OKRA 5AVMA 3OC9A 4AAWA 4FRQA 5JQQA 4EB6A 1VGUA 3SXAA 3JVHA 1H5RA 1IV4A 2V0JA 5IJ9A 4KPZA 2H8EA 4NANA 1VH8A 3UT5A 4G87A 3F1CA 4Y7TA 3I56F 1LL2A 2RITA 4G4WA 1IV1A 5L6VA 1H3MA 3ON1A 3BYQA 3G71F 1OMZA 1UFYA 3E26A 1ZI3A 4O4IB 5MN6A 4Y6UA 2ZODA 4Y9XA 4FCEA 5CQOA 2PGYA 4G88A 4R40B 4J18A 1ON8A 2RIYA 3HKDB 2HQSC 2O1HA 2YC3A 5GIPC 5CQNX 3JAKB 2R6R1 5C4BA 2DPWA 3ZO8A 4KWEA 1G95A 2UYKA 3O85A 1ZDFA 3RYIA 2Q1XA 4BT2A 3PKPA 1HV9A 1X7PA 1UI9A 4CJ8A 2UYNB 4B5CA 3CCQF 2BTOA 1JD1A 1VH1A 2XMHA 1H4EA 2FFVA 5C8RA 1Z5VA 2JCLA 5MN5A 4MIXA 2DYYA 2IQQA 2OI6A 5BXCA 4BY9D 5LA6A 2VFZA 4I50A 3U2XA 2VAPA 3LYBA 3J81M 1YJWF 2OEFA 1QVFF 1DT9A 1VH3A 4B4GA 1OAPA 4FCUA 5LYJA 2YXZA 2Y4KA 2VXYA 1T0AA 2QGIA 2FGYA 2RJ1A 1GWWA 3I0JA 4ZI7A 1YP3A 2OZBA 1XHOA 4TUYB 5IYZA 1VQ6F 2MQEA 4BVTA 5CMHA 1FSZA 4IRQA 4DRXB 5C1HA 2HRUA 5FUHA 4IHJA 4LW6A 5FYEA 5LXTA 3QTYA 1H5SD 1O7OA 1JYLA 3KJKA 3CCEF 1WT3A 5CMIA 2AM5A 5C49A 1WT1A 3P4EA 4B42A 4O4HB 2RHJA 2UYJA 1CLIA 4Q7CA 4ASYA 5A2QM 3ZOPA 2I5EA 3JUJA 2Z1UA 5IJ0A 3CMEF 1YGYA 3AGKA 4G3SA 1QD9A 4KXOA 2I6DA 1QAHA 3SIVA 4EEOA 2QEXF 3P0ZA 1KQSF 4I4TA 1PF5A 1MC3A 3DK5A 1H4DA 1R7TA 2E3DA 5EWRA 1EZIA 3JASB 1RA4A 3FD5A 3GYQA 2AIZP 3U0XA 2Y4JA 3DUVA 3HKDA 3CPWF 2L26A 1TVKA 2VAMA 1MP5A 3JATB 3BRKX 1R80A 4R7PA 4ERHA 5GONB 2QH5A 3I0CA 1RQ2A 5J49A 4HO4A 2VAWA 2Y7AA 2O1FA 2VD4A 1H4CA 2QA4F 1H48A 5CA1A 1T0KB 5LOVA 1VQPF 3C9TA 3JCMM 4FIXA 5GAPK 1VQKF 2I5KA 3WGNA 3CKNA 1X7OA 1LL0A 5LP6A 4AYLA 2RHHA 1G0RA 1LL3A 5C1GA 4G4YA 4NALA 1JY8A 1VQ8F 3JAWB 5J2TA 1HJLA 3U2WA 1QG8A 4HO6A 2Z01A 1VHAA 3RSBA 2X60A 2X5SA 3CMAF 1E7KA 1S4PA 4RQOA 5FLXM 5ITZB 4HO0A 4LNUB 3CC4F 4Y64A 3LWQC 4TUYA 1ZJ0A 3R0PA 2RJ4A 2YYEA 3CYQA 4Y7FA 3PLAC 1LZ7A 5C3AA 3D00A 2XWLA 3PKQA 1YJ9F 3V7EA 4FRHA 1JN1A 4FROA 2H8CA 4O4JB 5HY1A 1QGSA 4X3MA 5D91A 5EYPA 3I0EA 3CB2A 3VTIC 1ZCUA 4AC3A 4C4WC 4ZHQB 1IIMA 3LWOC 5IT9M 3I0DA 1KC8H 3IOHA 3WGMA 5JH7B 2Z86A 3M1XA 4YJ2A 2LBTA 4K6RA 4O4HA 3V0MA 4HOCA 4C82A 3NK7A 3VIUA 1ON6A 4X20A 5HS2A 2FYBA 4M2AA 3VYTC 2PMPA 4X1KB 3OAMA 2QI2A 4EE4A 1H5SC 5KMGA 3HKEB 5DDVA 3CPQA 5BMVB 1SA0B 4M8IA 1ZDGA 4O6MA 3I0IX 1KWSA 3I0KA 2V0IA 5J2UB 5G4UC 3N2KB 5FV9A 3E25A 3WJQA 1FO8A 2RJ9A 2VS4A 4PWTA 1VICA 3NVIB 5KX5B 1H5TB 2VGMA 3N4YA 3HAXD 1G93A 3E1YA 1KNKA 4TV8B 1H5SB 4B62A 3CCJF 2OI7A 5MN4A 1S4NA 2BO4A 1ZJ1A 2X65A 2OI5A 3K0TA 2CW4A 2W0WA 2MZBA 1QWJA 4EE5A 4KC1A 3VI6A 1INJA 2P72A 1ZWZA 3VCZA 1NHEB 3ZLLA 2APCA 1GO0A 5FNVA 3JTJA 2X5ZA 4UEGA 1TVYA 3DDNA 4I55A 1VQ9F 5IDTA 5JQGA 4M28A 3V0NA 1W5EA 1ZCTA 2RIZA 2CHSA 3I55F 3SXCA 1XRGA 3CKVA 1IV2A 3SPTA 4Y6NA 1W3EX 5CMFX 4HO5A 1W57A 1NMUB 1KNJA 1HJJA 1ZHJA 3RYHA 2KG4A 2CSLA 1LZJA 5G4VC 3RE3A 1YP4A 2E8BA 3D8VA 2IG8A 1GX4A 4D11A 2WEEA 5CMGX 2YQJA 4C8EA 1W42A 2BO6A 3K2XA 1QGQA 1O23B 2HS3A 1W59A 3E22B 5FTVA 5FU8A 3V0OA 2Q4JA 4DE7A 3WGKA 4B2XA 3GTZA 2G9IA 2ICYA 4HG6A 3F0DA 1OQMB 1NQ3A 2LCAA 3QVBA 1Q82H 1CN7A 1QU9A 4O2BA 4NAKA 2QKXA 4ARWA 2BO8A 4XCQA 3JALB 3I3FA 3NGWA 2ZAUA 2FFUA 3K8EA 3WPWA 5C4DA 3USRA 5JCOC 1YROB 1IINA 4FRMA 1GZ0A 4MNDA 2PHNA 3QUWA 1VZUA 3HKBA 4F6RB 3RYCA 5C48A 2GGQA 1SA0A 3OH0A 5CB4A 3HWUA 3PNNA 5GINC 1FR8A 3O3PA 1ODEA 3V3TA 3D54A 1ZI1A 3RA5A 3TD5A 3IEWA 3OH3A 3IOIA 4HNAA 3U2TA 3ZGGA 2Z87A 5EB1B 4TV8A 1W5BA 3I0LA 3HKCB 3N2GB 3FD6A 1FFXA 2A8WA 1FG5N 2HX0A 2K1SA 1ZJPA 2RB9A 4B46A 5EZYA 5GIOC 3R3IA 2RIXA 4TV9A 4CJBA 4FFBA 2BO7A 4ZHYB 4ZOLB 1WT0A 4NUTA 4BT5A 4ECMA 4E1KA 1FRWA 2BO1A 4O2AA 4RHAA 5HXZA 2YQHA 2ZOVA 1W77A 3I7TA 3OBYA 1H7GA 2BTQB 1ZIZA 2D0JA 4C8GA 5C8YB 4G4ZA 4L41C 1TUBB 3S03A 1ZI5A 3OGZA 3Q8HA 2AMTA 1WVCA 4U3JB 2FYDB 1VGWA 5C4EA 4BT4A 4O4IA 1GX1A 3LDTA 1HM0A 4FQWA 4D48A 5C3BA 1YJNF 3F6MA 5I1FA 1ONIA 1VQ5F 2F9ZC 3S0WA 4LW3A 3SXGA 2WVMA 2JCKA 5EO3A 2XWNA 4B4MA 1PXWA 2UX8A 5EIYA 3OH2A 4EVWA 3JAKA 3V7QA 3FFMA 2CWJA 3C9UA 2ZF8A 2ALEA 2W8BC 2WE9A 1G9RA 1R7VA 1H7MA 3M4SA 2WAWA 3JALA 3TZTA 5C47A 3OH4A 2RJ0A 4FREA 3CU0A 2Z1EA 1VPAA 4EI9A 2VS5A 4G4VA 1FGXA 2KTUA 4KC2A 2PX7A 2UYNA 1N8RH 3V0LA 3RYFB 2J0BA 1TW1A 4Y62A 3N9WA 3IKFA 2ZU8A 1GX0A 1JYKA 1FWYA 3V0PA 2VSHA 2RJ7A 4FRLA 4CVHA 4HO8A 1FXJA 4FRPA 3NK6A 5EAZA 5D92A 3D98A 1JFFB 3IKEA 4IIJB 2HP0B 4WBNB 4X1IB 2GLZA 5JCOA 1VZTA 1FNJA 5FTSA 1GQ9A 2V0HA 4G3PA 1CK2A 4ASJA 3TD4A 1ZI4A 4EEMA 1ZCVA 3L7QA 4BT7A 3HTNA 4EB6B 1S4OA 3GHZA 3JARB 3HJWC 4HO2A 4NAIA 5IJ9B 5IDSA 5B8FA 3UT5B 3S0HA 3Q7UA 4DRXA 4YS8A 4FRAA 4ZHVA 1U3PA 3V4DA 3CD6F 2LBWA 1MP4A 1R7UA 1OFUA 3LMEA 1W41A 3ZGFA 3MCQA 3FOQA 3D5NA 3U2VA 3CCVF 3F0FA 3J7AR 4G4XA 2AM3A 1J7HA 1GWVA 4DECA 5C8YA 3RYIB 1W40A 5AJOA 1VQLF 5JVDB 4Y7UA 2R751 2FYAA 3EORA 1NF5B 1NWGB 2ZU7A 4BQHA 3CKQA 3ZLKA 2HP3A 4CJCA 3P10A 1HM8A 1K8AH 3FBAA 1RLGA 3HL3A 4BVQA 3JASA 1VGZA 2UZHA 2JCOA 2YESA 4O6NA 5LA6B 2WALA 1G23A 4KNXA 4DDZA 3T7NA
chains in the Genus database with same CATH topology
4HG6A 3F0DA 1OQMB 3QVBA 1EYRA 1H7LA 4P02A 4NAKA 2QKXA 3USQA 4ARWA 2BO8A 4B42A 1NMMB 1ZCYA 2ZU9A 4Q7CA 4ASYA 4Y63A 3NGWA 1VZXA 2FFUA 2O1GA 2I5EA 3MBMA 1H7TA 3JUJA 3K8EA 3FPIA 1SS9A 1H5RB 3CGXA 3OH1A 5FU0A 2RJ8A 5C4DA 2FYCB 3T80A 2C0NA 3USRA 1WT2A 1U3LA 1TZFA 2NXVA 1YROB 4G3SA 1IINA 1R81A 4FRMA 4KXOA 1FZWA 4MNDA 4M2BA 4EEOA 3P0ZA 2YQSA 2GGOA 3T7MA 1VZUA 2Y4LA 4C81A 5C48A 2RJ6A 1Z90A 2AE7A 2GGQA 2Y4MA 2D7RA 1MC3A 3DK5A 3T7OA 1H4DA 1R7TA 2E3DA 1FOAA 3OH0A 3SX5A 3RMWA 2YCMA 2J0AA 1XHBA 1EZIA 3PNNA 3ELCA 2AECA 3K14A 1FR8A 3O3PA 4EEAA 3U0XA 4JD0A 2JCJA 2WVKA 2Y4JA 3DUVA 4M4KA 4ZDQA 5CMJA 1ZI1A 2FY7A 3IEWA 3OH3A 3IOIA 4B5BA 3IOJA 3U2TA 1MP5A 3BRKX 3ZGGA 1H7FA 4KC4A 1R80A 2A8UA 4R7PA 2Z87A 4D0ZA 4Y7VA 3POLA 2QH5A 3I0LA 3JUKA 3I0CA 1V84A 5J49A 4HO4A 3U2UA 2Y7AA 2O1FA 2VD4A 3SX3A 2OEGA 1H4CA 2A8WA 1FG5N 1H48A 1H7EA 1ZJPA 2W0VA 1G8OA 1LZIA 4P00A 3R3IA 2GZLA 2RIXA 4FIXA 2V0KA 4CJBA 2BO7A 2WGZA 2I5KA 5DDTA 1INIA 3CKNA 1LL0A 3LW6A 1WT0A 5C1LA 4AYLA 4ECMA 4E1KA 1FRWA 1G0RA 1LL3A 1O0RA 1GQCA 1U43A 1JVGA 5C1GA 1OMXA 4NALA 3ST8A 1JY8A 2YQHA 3SX8A 1W77A 2YQCA 4FIYA 1H7GA 5C36A 1JV3A 2ICXA 3KE1A 1LZ0A 3SXBA 1HJLA 1PZTA 4MYBA 1TW5A 3U2WA 2RJ5A 1QG8A 1ZIZA 1E5KA 2AGDA 2D0JA 2VSIA 4KPXA 4KQLA 4B3UA 4B4BA 4C8GA 1VGTA 3ESJA 1IV3A 4HO6A 5C38A 4GBPA 1VHAA 3RSBA 4L41C 2X60A 2X5SA 1FR9A 4FRBA 5C4CA 1S4PA 4FRDA 1G3LA 4BMAA 4HO0A 1H7QA 4Y64A 1ZI5A 3OGZA 3Q8HA 2AMTA 1WVCA 4HO3A 1YQNA 1ZJ0A 3RMVA 2FYDB 1NKHB 2RJ4A 1HM9A 1H47A 1V82A 1VGWA 2D7IA 4Y7FA 4XWIA 5C4EA 3SXEA 1LZ7A 2P73A 1GX1A 1H7HA 1HM0A 4FQWA 5EJ1A 5C3AA 4D48A 2XWLA 2Y6PA 3PKQA 5C3BA 2VS3A 3F6MA 1NQIB 4Y7GA 5I1FA 1ZJOA 2VXMA 3I0GA 4FRHA 3KIAA 4LW3A 3SXGA 1JN1A 2WVMA 4FROA 1QGSA 2JCKA 5D91A 1WSZA 1FO9A 2XWNA 3I0EA 4B4MA 3ZF8A 3V90A 2UX8A 2XMEA 5CQMX 3Q80A 5EIYA 3OH2A 1G97A 1H5TA 3EE5A 3ERNA 4EVWA 1ZCUA 4AC3A 1IIMA 2WVLA 3K8DA 5L6SA 1R82A 1H5SA 3I0DA 5IFYA 3BCVA 1LVWA 1R7YA 3FWWA 2WE9A 3IOHA 4IRPA 1G9RA 1R7VA 2Z86A 3R2WA 2WAWA 2CU2A 3OKRA 4K6RA 3V0MA 3OC9A 4AAWA 4FRQA 4C82A 1ON6A 3CKJA 4HOCA 5JQQA 5HS2A 3TZTA 3V8YA 1VGUA 3SXAA 2FYBA 3JVHA 4M2AA 5C47A 1H5RA 3OH4A 2RJ0A 4FREA 3CU0A 2PMPA 1IV4A 2V0JA 1VPAA 4KPZA 3OAMA 4NANA 1VH8A 2VS5A 1FGXA 4G87A 4KC2A 1U40A 3F1CA 4EE4A 1H5SC 2PX7A 4Y7TA 1LL2A 2RITA 1IV1A 3V0LA 5L6VA 1H3MA 5DDVA 2J0BA 1OMZA 1TW1A 3U0YA 3F0GA 1XZ6A 3E26A 4Y62A 1PZYB 4O6MA 1ZDGA 1ZI3A 2VK9A 3N9WA 3IKFA 1VM8A 2ZU8A 1GX0A 3I0IX 1JYKA 1KWSA 4Y6UA 4C8IA 3I0FA 1FWYA 5CQPA 3V0PA 3I0KA 2VSHA 2V0IA 4Y9XA 2RJ7A 4FCEA 5CQOA 2PGVA 5FV9A 4FRLA 3E25A 2PGYA 4CVHA 4HO8A 1FO8A 2RJ9A 1FXJA 2VS4A 4FRPA 1VICA 3SXDA 2PA4A 5D92A 1GA8A 4J18A 1ON8A 3D98A 2RIYA 4D0TA 3IKEA 1H5TB 2O1HA 2YC3A 4KT7A 2P6WA 1G1LA 5CQNX 1G93A 5C4BA 2DPWA 1KNKA 1VZTA 1H5SB 3IEQA 5FTSA 1FXOA 1G95A 1GQ9A 2OI7A 2V0HA 5C3DA 4G3PA 3QHDA 1S4NA 2BO4A 4ASJA 1ZJ1A 2X65A 2OI5A 1ZI4A 2W0WA 1ZCVA 2AH9A 2AM4A 3V8ZA 1ZDFA 2MZBA 4EEMA 5CQLX 3Q4SA 1QWJA 4EE5A 4B2WA 4KC1A 5C4FA 1R7XA 1S4OA 1INJA 2P72A 3PKPA 1HV9A 3GHZA 4HO2A 1JVDA 4NAIA 5EJZA 5IDSA 1NHEB 5B8FA 3Q7UA 1JV1A 4YS8A 3ZLLA 4FRAA 4CJ8A 1U3PA 3TQDA 1VH1A 2APCA 2XMHA 1H4EA 2FFVA 3SX7A 4HCQA 5C8RA 3JTJA 1O7QA 1ZJ3A 2JCLA 3F0EA 1MP4A 2X5ZA 1R7UA 4MIXA 4UEGA 4C2SA 1TVYA 5IDTA 4M28A 3V0NA 4EEGA 2OI6A 5BXCA 3ZGFA 3DJ4A 1ZCTA 2RIZA 3SXCA 2VFZA 2I7BA 3CKVA 1IV2A 3FOQA 3U2XA 3D5NA 3GUEA 3SPTA 1G2VA 4Y6NA 3U2VA 4EE3A 2V0LA 2OEFA 5CMFX 5AJNA 4HO5A 3F0FA 1W57A 1VH3A 4B4GA 2AM3A 4FCUA 1KNJA 1HJJA 1ZHJA 2Y4KA 2YC5A 1GWVA 1ZJ2A 4AYJA 1V83A 2RJ1A 1T0AA 2QGIA 1GWWA 4DECA 1LZJA 4G3QA 3I0JA 1YP3A 3V91A 3RE3A 1YP4A 5AJOA 4KNRA 2E8BA 2AESA 3D8VA 4KRVA 4Y7UA 1GX4A 2FYAA 5CMHA 4D11A 3EORA 2WEEA 1NF5B 1K4VA 5CMGX 4IRQA 2YQJA 1NWGB 2ZU7A 5C1HA 1MP3A 4BQHA 3CKQA 5AJPA 3ZLKA 2VXLA 3B6NA 5FUHA 4C8EA 4HO9A 4CJCA 4LW6A 4JISA 5FYEA 3P10A 1YP2A 2BO6A 1HM8A 3V0QA 3K2XA 1QGQA 1O23B 1H5SD 3FBAA 1O7OA 3F1YA 3HL3A 5FTVA 5FU8A 1JYLA 3V0OA 2Q4JA 1VGZA 4DE7A 1W55A 1WT3A 2UZHA 2XWMA 2JCOA 2YESA 5CMIA 2AM5A 1FGGA 4O6NA 3I0HA 4D11C 4B2XA 5C49A 1I52A 1G23A 1WT1A 4KNXA 4DDZA 2ICYA 3CKOA 3T7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HG6 A;  3F0D A;  1OQM B;  3QVB A;  1EYR A;  1H7L A;  4P02 A;  4NAK A;  2QKX A;  3USQ A;  4ARW A;  2BO8 A;  4B42 A;  1NMM B;  1ZCY A;  2ZU9 A;  4ASY A;  4Y63 A;  3NGW A;  1VZX A;  2FFU A;  2O1G A;  2I5E A;  3MBM A;  1H7T A;  3JUJ A;  3K8E A;  3FPI A;  1SS9 A;  1H5R B;  3CGX A;  3OH1 A;  5FU0 A;  2RJ8 A;  5C4D A;  2FYC B;  3T80 A;  3USR A;  1WT2 A;  1U3L A;  1TZF A;  2NXV A;  1YRO B;  4G3S A;  1IIN A;  1R81 A;  4FRM A;  4KXO A;  1FZW A;  4MND A;  4M2B A;  4EEO A;  3P0Z A;  2YQS A;  2GGO A;  3T7M A;  1VZU A;  2Y4L A;  4C81 A;  5C48 A;  2RJ6 A;  1Z90 A;  2AE7 A;  2GGQ A;  2Y4M A;  2D7R A;  1MC3 A;  3DK5 A;  3T7O A;  1H4D A;  1R7T A;  2E3D A;  1FOA A;  3OH0 A;  3SX5 A;  3RMW A;  2YCM A;  1XHB A;  1EZI A;  3PNN A;  3ELC A;  2AEC A;  3K14 A;  1FR8 A;  3O3P A;  4EEA A;  3U0X A;  4JD0 A;  2JCJ A;  2WVK A;  2Y4J A;  3DUV A;  4M4K A;  4ZDQ A;  5CMJ A;  1ZI1 A;  2FY7 A;  3IEW A;  3OH3 A;  3IOI A;  4B5B A;  3IOJ A;  3U2T A;  1MP5 A;  3BRK X;  3ZGG A;  1H7F A;  4KC4 A;  1R80 A;  2A8U A;  4R7P A;  2Z87 A;  4D0Z A;  4Y7V A;  3POL A;  2QH5 A;  3I0L A;  3JUK A;  3I0C A;  1V84 A;  5J49 A;  4HO4 A;  3U2U A;  2Y7A A;  2O1F A;  2VD4 A;  3SX3 A;  2OEG A;  1H4C A;  2A8W A;  1FG5 N;  1H48 A;  1H7E A;  1ZJP A;  2W0V A;  1G8O A;  1LZI A;  4P00 A;  3R3I A;  2GZL A;  2RIX A;  2V0K A;  4CJB A;  2BO7 A;  2WGZ A;  2I5K A;  5DDT A;  1INI A;  3CKN A;  1LL0 A;  3LW6 A;  1WT0 A;  5C1L A;  4AYL A;  4ECM A;  4E1K A;  1FRW A;  1G0R A;  1LL3 A;  1O0R A;  1GQC A;  1U43 A;  1JVG A;  5C1G A;  1OMX A;  4NAL A;  3ST8 A;  1JY8 A;  2YQH A;  3SX8 A;  1W77 A;  2YQC A;  1H7G A;  5C36 A;  1JV3 A;  2ICX A;  3KE1 A;  1LZ0 A;  3SXB A;  1HJL A;  1PZT A;  4MYB A;  1TW5 A;  3U2W A;  2RJ5 A;  1QG8 A;  1ZIZ A;  1E5K A;  2AGD A;  2D0J A;  2VSI A;  4KPX A;  4KQL A;  4B3U A;  4B4B A;  4C8G A;  1VGT A;  3ESJ A;  1IV3 A;  4HO6 A;  5C38 A;  4GBP A;  1VHA A;  3RSB A;  4L41 C;  2X60 A;  2X5S A;  1FR9 A;  4FRB A;  5C4C A;  1S4P A;  4FRD A;  1G3L A;  4BMA A;  4HO0 A;  1H7Q A;  4Y64 A;  1ZI5 A;  3OGZ A;  3Q8H A;  2AMT A;  1WVC A;  4HO3 A;  1YQN A;  1ZJ0 A;  3RMV A;  2FYD B;  1NKH B;  2RJ4 A;  1HM9 A;  1H47 A;  1V82 A;  1VGW A;  2D7I A;  4Y7F A;  4XWI A;  5C4E A;  3SXE A;  1LZ7 A;  2P73 A;  1GX1 A;  1H7H A;  1HM0 A;  4FQW A;  5EJ1 A;  5C3A A;  4D48 A;  2XWL A;  2Y6P A;  3PKQ A;  5C3B A;  2VS3 A;  3F6M A;  1NQI B;  4Y7G A;  5I1F A;  1ZJO A;  2VXM A;  3I0G A;  4FRH A;  3KIA A;  4LW3 A;  3SXG A;  1JN1 A;  2WVM A;  4FRO A;  1QGS A;  2JCK A;  1WSZ A;  1FO9 A;  2XWN A;  3I0E A;  4B4M A;  3ZF8 A;  3V90 A;  2UX8 A;  2XME A;  5CQM X;  3Q80 A;  5EIY A;  3OH2 A;  1G97 A;  1H5T A;  3EE5 A;  3ERN A;  4EVW A;  1ZCU A;  4AC3 A;  1IIM A;  2WVL A;  3K8D A;  5L6S A;  1R82 A;  1H5S A;  3I0D A;  5IFY A;  3BCV A;  1LVW A;  1R7Y A;  3FWW A;  2WE9 A;  3IOH A;  4IRP A;  1G9R A;  1R7V A;  2Z86 A;  3R2W A;  2WAW A;  2CU2 A;  3OKR A;  4K6R A;  3V0M A;  3OC9 A;  4AAW A;  4FRQ A;  4C82 A;  1ON6 A;  3CKJ A;  4HOC A;  5JQQ A;  5HS2 A;  3TZT A;  3V8Y A;  1VGU A;  3SXA A;  2FYB A;  3JVH A;  4M2A A;  5C47 A;  1H5R A;  3OH4 A;  2RJ0 A;  4FRE A;  3CU0 A;  2PMP A;  1IV4 A;  2V0J A;  1VPA A;  4KPZ A;  3OAM A;  4NAN A;  1VH8 A;  2VS5 A;  1FGX A;  4G87 A;  4KC2 A;  1U40 A;  3F1C A;  4EE4 A;  1H5S C;  2PX7 A;  4Y7T A;  1LL2 A;  2RIT A;  1IV1 A;  3V0L A;  5L6V A;  1H3M A;  5DDV A;  1OMZ A;  1TW1 A;  3U0Y A;  3F0G A;  1XZ6 A;  3E26 A;  4Y62 A;  1PZY B;  1ZDG A;  1ZI3 A;  3N9W A;  3IKF A;  1VM8 A;  2ZU8 A;  1GX0 A;  3I0I X;  1JYK A;  1KWS A;  4Y6U A;  4C8I A;  3I0F A;  1FWY A;  5CQP A;  3V0P A;  3I0K A;  2VSH A;  2V0I A;  4Y9X A;  2RJ7 A;  4FCE A;  5CQO A;  2PGV A;  5FV9 A;  4FRL A;  3E25 A;  2PGY A;  4CVH A;  4HO8 A;  1FO8 A;  2RJ9 A;  1FXJ A;  2VS4 A;  4FRP A;  1VIC A;  3SXD A;  2PA4 A;  1GA8 A;  4J18 A;  1ON8 A;  3D98 A;  2RIY A;  4D0T A;  3IKE A;  1H5T B;  2O1H A;  2YC3 A;  4KT7 A;  2P6W A;  1G1L A;  5CQN X;  1G93 A;  5C4B A;  2DPW A;  1KNK A;  1VZT A;  1H5S B;  3IEQ A;  5FTS A;  1FXO A;  1G95 A;  1GQ9 A;  2OI7 A;  2V0H A;  5C3D A;  4G3P A;  3QHD A;  1S4N A;  2BO4 A;  4ASJ A;  1ZJ1 A;  2X65 A;  2OI5 A;  1ZI4 A;  2W0W A;  1ZCV A;  2AH9 A;  2AM4 A;  3V8Z A;  1ZDF A;  2MZB A;  4EEM A;  5CQL X;  3Q4S A;  1QWJ A;  4EE5 A;  4B2W A;  4KC1 A;  5C4F A;  1R7X A;  1S4O A;  1INJ A;  2P72 A;  3PKP A;  1HV9 A;  3GHZ A;  4HO2 A;  1JVD A;  4NAI A;  5EJZ A;  5IDS A;  1NHE B;  5B8F A;  3Q7U A;  1JV1 A;  4YS8 A;  3ZLL A;  4FRA A;  4CJ8 A;  1U3P A;  3TQD A;  1VH1 A;  2APC A;  2XMH A;  1H4E A;  2FFV A;  3SX7 A;  4HCQ A;  5C8R A;  3JTJ A;  1O7Q A;  1ZJ3 A;  2JCL A;  3F0E A;  1MP4 A;  2X5Z A;  1R7U A;  4UEG A;  4C2S A;  1TVY A;  5IDT A;  4M28 A;  3V0N A;  4EEG A;  2OI6 A;  5BXC A;  3ZGF A;  3DJ4 A;  1ZCT A;  2RIZ A;  3SXC A;  2VFZ A;  2I7B A;  3CKV A;  1IV2 A;  3FOQ A;  3U2X A;  3D5N A;  3GUE A;  3SPT A;  1G2V A;  4Y6N A;  3U2V A;  4EE3 A;  2V0L A;  2OEF A;  5CMF X;  5AJN A;  4HO5 A;  3F0F A;  1W57 A;  1VH3 A;  4B4G A;  2AM3 A;  4FCU A;  1KNJ A;  1HJJ A;  1ZHJ A;  2Y4K A;  2YC5 A;  1GWV A;  1ZJ2 A;  4AYJ A;  1V83 A;  2RJ1 A;  1T0A A;  2QGI A;  1GWW A;  4DEC A;  1LZJ A;  4G3Q A;  3I0J A;  1YP3 A;  3V91 A;  3RE3 A;  1YP4 A;  5AJO A;  4KNR A;  2E8B A;  2AES A;  3D8V A;  4KRV A;  4Y7U A;  1GX4 A;  2FYA A;  5CMH A;  4D11 A;  3EOR A;  2WEE A;  1NF5 B;  1K4V A;  5CMG X;  4IRQ A;  2YQJ A;  1NWG B;  2ZU7 A;  5C1H A;  1MP3 A;  4BQH A;  3CKQ A;  5AJP A;  3ZLK A;  2VXL A;  3B6N A;  5FUH A;  4C8E A;  4HO9 A;  4CJC A;  4LW6 A;  4JIS A;  5FYE A;  3P10 A;  1YP2 A;  2BO6 A;  1HM8 A;  3V0Q A;  3K2X A;  1QGQ A;  1O23 B;  1H5S D;  3FBA A;  1O7O A;  3F1Y A;  3HL3 A;  5FTV A;  5FU8 A;  1JYL A;  3V0O A;  2Q4J A;  1VGZ A;  4DE7 A;  1W55 A;  1WT3 A;  2UZH A;  2XWM A;  2JCO A;  2YES A;  5CMI A;  2AM5 A;  1FGG A;  3I0H A;  4D11 C;  4B2X A;  5C49 A;  1I52 A;  1G23 A;  1WT1 A;  4KNX A;  4DDZ A;  2ICY A;  3CKO A;  3T7N A; 
#chains in the Genus database with same CATH topology
 3JAT A;  4P02 A;  5GON A;  1NMM B;  5LYJ B;  2ZU9 A;  3PAF A;  3MDO A;  3C9R A;  4Y63 A;  3IR9 A;  2O1G A;  3MBM A;  3ZP4 A;  1H7T A;  1SS9 A;  5FU0 A;  4ZI7 B;  1X25 A;  2C0N A;  1WT2 A;  1U3L A;  4LCK A;  1TZF A;  2NXV A;  5IYZ B;  1R81 A;  1M1K H;  4DXD A;  4M2B A;  3LWR C;  2AIF A;  2B33 A;  4IHJ B;  2GGO A;  3T7M A;  5LXT B;  1Z90 A;  3T7O A;  2D7R A;  2IAF A;  1FOA A;  3SX5 A;  2YCM A;  2J0A A;  2H6L A;  5HP7 A;  3ELC A;  2AEC A;  3K14 A;  3JAW A;  2LBX A;  5GAN K;  4M4K A;  1VQN F;  2FY7 A;  1YIT F;  3CCL F;  4IIJ A;  4YJ3 B;  1KD1 H;  2A8U A;  2CHT A;  3POL A;  3U0O A;  3VMF B;  1V84 A;  1Z5W A;  5ITZ A;  2FC3 A;  4LNU A;  1H7E A;  2W0V A;  1G8O A;  5IJ0 B;  1LZI A;  3MCA B;  2GZL A;  3JAR A;  2WGZ A;  1INI A;  3OBW A;  1JJ2 F;  5C1L A;  4I4T B;  1O0R A;  1GQC A;  3S02 A;  1U43 A;  4O4J A;  1OMX A;  3ST8 A;  3SX8 A;  2YQC A;  1JV3 A;  3J80 M;  3KE1 A;  4EI8 A;  1LZ0 A;  4ZHQ A;  4MYB A;  1TW5 A;  3CCM F;  5LP6 C;  2RJ5 A;  5EIB D;  1TVK B;  5JH7 A;  4KQL A;  4B4B A;  1VGT A;  3ESJ A;  3RA6 A;  2V9Y A;  4FRB A;  2P6Y A;  1FR9 A;  4FRD A;  1G3L A;  2DT4 A;  4BMA A;  5CA1 B;  4X1K A;  3SIU A;  5LOV B;  5JVD A;  3HKE A;  3LWV C;  2EWC A;  1HM9 A;  1V82 A;  2D7I A;  5BMV A;  4ZK7 A;  3K12 A;  2P73 A;  5EJ1 A;  5LP6 B;  3WJP A;  1YHQ F;  4NQ3 A;  5J2U A;  2VXM A;  3N2K A;  3KJJ A;  1W58 1;  3VOA A;  3C8L A;  3V90 A;  2XME A;  3G4S F;  5CQM X;  5KX5 A;  1H5T A;  3EE5 A;  3ERN A;  5J2T B;  2WVL A;  3K8D A;  5L6S A;  1H5S A;  3BCV A;  5EB0 A;  1R7Y A;  3R2W A;  2GVI A;  2CU2 A;  3CKJ A;  3V8Y A;  3CXC F;  2BTU A;  1U40 A;  1Q7Y H;  4X1Y B;  5CA0 B;  3U0Y A;  3F0G A;  1XZ6 A;  1PZY B;  2VK9 A;  1VM8 A;  3LFO A;  2OHW A;  4C8I A;  3I0F A;  5CQP A;  1W2B F;  1DBF A;  1RLU A;  2PGV A;  4ZHW A;  3WJR A;  3OON A;  5EYP B;  3SXD A;  5HY4 A;  2PA4 A;  1GA8 A;  1GO1 A;  1W5F A;  4D0T A;  1XBI A;  4KT7 A;  2P6W A;  1G1L A;  3WGL A;  3IEQ A;  1FXO A;  5C3D A;  3QHD A;  4O4L B;  4YJ3 A;  4YJ2 B;  2AM4 A;  2AH9 A;  3V8Z A;  5CQL X;  3Q4S A;  4B2W A;  5C4F A;  4X20 B;  1R7X A;  3CC2 F;  3G6E F;  3N4Z A;  1JVD A;  2I6R A;  5EJZ A;  2UYP A;  2OTL F;  1JV1 A;  2ZVY A;  5KMG B;  3CC7 F;  3TQD A;  1R1M A;  1NJI H;  3SX7 A;  4HCQ A;  1O7Q A;  1ZJ3 A;  3F0E A;  3E22 A;  3JAM M;  1QVG F;  4C2S A;  4EEG A;  3DJ4 A;  3S06 A;  3KHN A;  2HRY A;  2RHL A;  3E20 B;  2OTM A;  2I7B A;  3CYP B;  4TZZ A;  3GUE A;  1G2V A;  4E6E A;  4EE3 A;  2V0L A;  2HS4 A;  5AJN A;  2KGW A;  1X52 A;  1VQV A;  2VGN A;  2YC5 A;  1ZJ2 A;  4AYJ A;  1V83 A;  1VQO F;  4G3Q A;  1K9M H;  3V91 A;  4KNR A;  2AES A;  4KRV A;  3DC2 A;  3CG6 A;  3OW2 F;  1K4V A;  2Z1F A;  1MP3 A;  3WPX A;  5AJP A;  1SZQ A;  2VXL A;  3KIZ A;  3B6N A;  1K73 H;  4HO9 A;  4F6R A;  3VOB A;  4JIS A;  1YP2 A;  3V0Q A;  5FNV B;  1S72 F;  3F1Y A;  2HS0 A;  4I55 B;  1W5A A;  1W55 A;  2XWM A;  5JQG B;  3CCS F;  1FGG A;  3I0H A;  4D11 C;  5EIB C;  1Q86 H;  1I52 A;  1YI2 F;  2CZW A;  3CKO A;  3IMP A;  1EYR A;  1H7L A;  1VQ4 F;  3USQ A;  1ZCY A;  3HKC A;  3RYH B;  3CCR F;  3N2G A;  1VZX A;  1XV2 A;  1VQ7 F;  3FPI A;  4EI7 A;  1H5R B;  3CGX A;  3OH1 A;  2RJ8 A;  2FYC B;  3T80 A;  1RQ7 A;  3WXM B;  4U39 A;  3WGJ A;  1FZW A;  4ZOL A;  2YQS A;  4X1Y A;  5CA0 A;  2Y4L A;  4C81 A;  2RJ6 A;  2AE7 A;  2Y4M A;  1Q8R A;  3M84 A;  3CCU F;  3RMW A;  4BVR A;  1XHB A;  4EEA A;  4JD0 A;  2JCJ A;  2WVK A;  4B45 A;  2KTV A;  4ZDQ A;  3TD3 A;  3NVK E;  5CMJ A;  4B5B A;  5HWE A;  3IOJ A;  2N48 A;  4O2B B;  1H7F A;  4KC4 A;  4D0Z A;  4Y7V A;  3JUK A;  4X3L A;  1Q81 H;  3U2U A;  4O4L A;  1TUB A;  3SX3 A;  2OEG A;  5HXU A;  2CVL A;  4BT6 A;  4P00 A;  4BT3 A;  4U3J A;  2V0K A;  5HY0 A;  3VYS C;  5DDT A;  1COM A;  1VQM F;  4NWO B;  1YIJ F;  3LW6 A;  2RHO A;  3HKB B;  3RYC B;  5HY2 A;  1M90 H;  1JVG A;  2ZVZ A;  5CB4 B;  4I50 B;  4FIY A;  5C36 A;  3NMU C;  2ICX A;  3SXB A;  1PZT A;  2Q1Y A;  4HNA B;  3VO8 A;  1E5K A;  2AGD A;  2VSI A;  4KPX A;  4B3U A;  1IV3 A;  5C38 A;  2OTJ F;  4GBP A;  5DCV A;  5C4C A;  1FFX B;  1H7Q A;  2QTP A;  1SDS A;  5EZY B;  1VK3 A;  2Z1T A;  4HO3 A;  3C9S A;  1YQN A;  3RMV A;  5FJ4 C;  4TV9 B;  1NKH B;  3RYF A;  4FFB B;  2HVY D;  2NMU A;  1H47 A;  1IPA A;  4XWI A;  3LWP C;  3SXE A;  1H7H A;  5HP8 A;  2Y6P A;  1FNK A;  3D01 A;  4BVS A;  2VS3 A;  1NQI B;  4Y7G A;  1ZJO A;  3I0G A;  3KIA A;  4O2A B;  3MQW A;  1WSZ A;  1FO9 A;  3ZF8 A;  3Q80 A;  1JFF A;  1G97 A;  2HP0 A;  2JNB A;  4BW0 B;  4WBN A;  4X1I A;  1R82 A;  5IFY A;  1LVW A;  3S0Y A;  3FWW A;  4IRP A;  3VYU C;  3ZP7 A;  3OKR A;  5AVM A;  3OC9 A;  4AAW A;  4FRQ A;  5JQQ A;  4EB6 A;  1VGU A;  3SXA A;  3JVH A;  1H5R A;  1IV4 A;  2V0J A;  5IJ9 A;  4KPZ A;  2H8E A;  4NAN A;  1VH8 A;  3UT5 A;  4G87 A;  3F1C A;  4Y7T A;  3I56 F;  1LL2 A;  2RIT A;  4G4W A;  1IV1 A;  5L6V A;  1H3M A;  3ON1 A;  3BYQ A;  3G71 F;  1OMZ A;  1UFY A;  3E26 A;  1ZI3 A;  4O4I B;  5MN6 A;  4Y6U A;  2ZOD A;  4Y9X A;  4FCE A;  5CQO A;  2PGY A;  4G88 A;  4R40 B;  4J18 A;  1ON8 A;  2RIY A;  3HKD B;  2HQS C;  2O1H A;  2YC3 A;  5GIP C;  5CQN X;  3JAK B;  2R6R 1;  5C4B A;  2DPW A;  3ZO8 A;  4KWE A;  1G95 A;  2UYK A;  3O85 A;  1ZDF A;  3RYI A;  2Q1X A;  4BT2 A;  3PKP A;  1HV9 A;  1X7P A;  1UI9 A;  4CJ8 A;  2UYN B;  4B5C A;  3CCQ F;  2BTO A;  1JD1 A;  1VH1 A;  2XMH A;  1H4E A;  2FFV A;  5C8R A;  1Z5V A;  2JCL A;  5MN5 A;  4MIX A;  2DYY A;  2IQQ A;  2OI6 A;  5BXC A;  4BY9 D;  5LA6 A;  2VFZ A;  4I50 A;  3U2X A;  2VAP A;  3LYB A;  3J81 M;  1YJW F;  2OEF A;  1QVF F;  1DT9 A;  1VH3 A;  4B4G A;  1OAP A;  4FCU A;  5LYJ A;  2YXZ A;  2Y4K A;  2VXY A;  1T0A A;  2QGI A;  2FGY A;  2RJ1 A;  1GWW A;  3I0J A;  4ZI7 A;  1YP3 A;  2OZB A;  1XHO A;  4TUY B;  5IYZ A;  1VQ6 F;  2MQE A;  4BVT A;  5CMH A;  1FSZ A;  4IRQ A;  4DRX B;  5C1H A;  2HRU A;  5FUH A;  4IHJ A;  4LW6 A;  5FYE A;  5LXT A;  3QTY A;  1H5S D;  1O7O A;  1JYL A;  3KJK A;  3CCE F;  1WT3 A;  5CMI A;  2AM5 A;  5C49 A;  1WT1 A;  3P4E A;  4B42 A;  4O4H B;  2RHJ A;  2UYJ A;  1CLI A;  4Q7C A;  4ASY A;  5A2Q M;  3ZOP A;  2I5E A;  3JUJ A;  2Z1U A;  5IJ0 A;  3CME F;  1YGY A;  3AGK A;  4G3S A;  1QD9 A;  4KXO A;  2I6D A;  1QAH A;  3SIV A;  4EEO A;  2QEX F;  3P0Z A;  1KQS F;  4I4T A;  1PF5 A;  1MC3 A;  3DK5 A;  1H4D A;  1R7T A;  2E3D A;  5EWR A;  1EZI A;  3JAS B;  1RA4 A;  3FD5 A;  3GYQ A;  2AIZ P;  3U0X A;  2Y4J A;  3DUV A;  3HKD A;  3CPW F;  2L26 A;  1TVK A;  2VAM A;  1MP5 A;  3JAT B;  3BRK X;  1R80 A;  4R7P A;  4ERH A;  5GON B;  2QH5 A;  3I0C A;  1RQ2 A;  5J49 A;  4HO4 A;  2VAW A;  2Y7A A;  2O1F A;  2VD4 A;  1H4C A;  2QA4 F;  1H48 A;  5CA1 A;  1T0K B;  5LOV A;  1VQP F;  3C9T A;  3JCM M;  4FIX A;  5GAP K;  1VQK F;  2I5K A;  3WGN A;  3CKN A;  1X7O A;  1LL0 A;  5LP6 A;  4AYL A;  2RHH A;  1G0R A;  1LL3 A;  5C1G A;  4G4Y A;  4NAL A;  1JY8 A;  1VQ8 F;  3JAW B;  5J2T A;  1HJL A;  3U2W A;  1QG8 A;  4HO6 A;  2Z01 A;  1VHA A;  3RSB A;  2X60 A;  2X5S A;  3CMA F;  1E7K A;  1S4P A;  4RQO A;  5FLX M;  5ITZ B;  4HO0 A;  4LNU B;  3CC4 F;  4Y64 A;  3LWQ C;  4TUY A;  1ZJ0 A;  3R0P A;  2RJ4 A;  2YYE A;  3CYQ A;  4Y7F A;  3PLA C;  1LZ7 A;  5C3A A;  3D00 A;  2XWL A;  3PKQ A;  1YJ9 F;  3V7E A;  4FRH A;  1JN1 A;  4FRO A;  2H8C A;  4O4J B;  5HY1 A;  1QGS A;  4X3M A;  5D91 A;  5EYP A;  3I0E A;  3CB2 A;  3VTI C;  1ZCU A;  4AC3 A;  4C4W C;  4ZHQ B;  1IIM A;  3LWO C;  5IT9 M;  3I0D A;  1KC8 H;  3IOH A;  3WGM A;  5JH7 B;  2Z86 A;  3M1X A;  4YJ2 A;  2LBT A;  4K6R A;  4O4H A;  3V0M A;  4HOC A;  4C82 A;  3NK7 A;  3VIU A;  1ON6 A;  4X20 A;  5HS2 A;  2FYB A;  4M2A A;  3VYT C;  2PMP A;  4X1K B;  3OAM A;  2QI2 A;  4EE4 A;  1H5S C;  5KMG A;  3HKE B;  5DDV A;  3CPQ A;  5BMV B;  1SA0 B;  4M8I A;  1ZDG A;  4O6M A;  3I0I X;  1KWS A;  3I0K A;  2V0I A;  5J2U B;  5G4U C;  3N2K B;  5FV9 A;  3E25 A;  3WJQ A;  1FO8 A;  2RJ9 A;  2VS4 A;  4PWT A;  1VIC A;  3NVI B;  5KX5 B;  1H5T B;  2VGM A;  3N4Y A;  3HAX D;  1G93 A;  3E1Y A;  1KNK A;  4TV8 B;  1H5S B;  4B62 A;  3CCJ F;  2OI7 A;  5MN4 A;  1S4N A;  2BO4 A;  1ZJ1 A;  2X65 A;  2OI5 A;  3K0T A;  2CW4 A;  2W0W A;  2MZB A;  1QWJ A;  4EE5 A;  4KC1 A;  3VI6 A;  1INJ A;  2P72 A;  1ZWZ A;  3VCZ A;  1NHE B;  3ZLL A;  2APC A;  1GO0 A;  5FNV A;  3JTJ A;  2X5Z A;  4UEG A;  1TVY A;  3DDN A;  4I55 A;  1VQ9 F;  5IDT A;  5JQG A;  4M28 A;  3V0N A;  1W5E A;  1ZCT A;  2RIZ A;  2CHS A;  3I55 F;  3SXC A;  1XRG A;  3CKV A;  1IV2 A;  3SPT A;  4Y6N A;  1W3E X;  5CMF X;  4HO5 A;  1W57 A;  1NMU B;  1KNJ A;  1HJJ A;  1ZHJ A;  3RYH A;  2KG4 A;  2CSL A;  1LZJ A;  5G4V C;  3RE3 A;  1YP4 A;  2E8B A;  3D8V A;  2IG8 A;  1GX4 A;  4D11 A;  2WEE A;  5CMG X;  2YQJ A;  4C8E A;  1W42 A;  2BO6 A;  3K2X A;  1QGQ A;  1O23 B;  2HS3 A;  1W59 A;  3E22 B;  5FTV A;  5FU8 A;  3V0O A;  2Q4J A;  4DE7 A;  3WGK A;  4B2X A;  3GTZ A;  2G9I A;  2ICY A;  4HG6 A;  3F0D A;  1OQM B;  1NQ3 A;  2LCA A;  3QVB A;  1Q82 H;  1CN7 A;  1QU9 A;  4O2B A;  4NAK A;  2QKX A;  4ARW A;  2BO8 A;  4XCQ A;  3JAL B;  3I3F A;  3NGW A;  2ZAU A;  2FFU A;  3K8E A;  3WPW A;  5C4D A;  3USR A;  5JCO C;  1YRO B;  1IIN A;  4FRM A;  1GZ0 A;  4MND A;  2PHN A;  3QUW A;  1VZU A;  3HKB A;  4F6R B;  3RYC A;  5C48 A;  2GGQ A;  1SA0 A;  3OH0 A;  5CB4 A;  3HWU A;  3PNN A;  5GIN C;  1FR8 A;  3O3P A;  1ODE A;  3V3T A;  3D54 A;  1ZI1 A;  3RA5 A;  3TD5 A;  3IEW A;  3OH3 A;  3IOI A;  4HNA A;  3U2T A;  3ZGG A;  2Z87 A;  5EB1 B;  4TV8 A;  1W5B A;  3I0L A;  3HKC B;  3N2G B;  3FD6 A;  1FFX A;  2A8W A;  1FG5 N;  2HX0 A;  2K1S A;  1ZJP A;  2RB9 A;  4B46 A;  5EZY A;  5GIO C;  3R3I A;  2RIX A;  4TV9 A;  4CJB A;  4FFB A;  2BO7 A;  4ZHY B;  4ZOL B;  1WT0 A;  4NUT A;  4BT5 A;  4ECM A;  4E1K A;  1FRW A;  2BO1 A;  4O2A A;  4RHA A;  5HXZ A;  2YQH A;  2ZOV A;  1W77 A;  3I7T A;  3OBY A;  1H7G A;  2BTQ B;  1ZIZ A;  2D0J A;  4C8G A;  5C8Y B;  4G4Z A;  4L41 C;  1TUB B;  3S03 A;  1ZI5 A;  3OGZ A;  3Q8H A;  2AMT A;  1WVC A;  4U3J B;  2FYD B;  1VGW A;  5C4E A;  4BT4 A;  4O4I A;  1GX1 A;  3LDT A;  1HM0 A;  4FQW A;  4D48 A;  5C3B A;  1YJN F;  3F6M A;  5I1F A;  1ONI A;  1VQ5 F;  2F9Z C;  3S0W A;  4LW3 A;  3SXG A;  2WVM A;  2JCK A;  5EO3 A;  2XWN A;  4B4M A;  1PXW A;  2UX8 A;  5EIY A;  3OH2 A;  4EVW A;  3JAK A;  3V7Q A;  3FFM A;  2CWJ A;  3C9U A;  2ZF8 A;  2ALE A;  2W8B C;  2WE9 A;  1G9R A;  1R7V A;  1H7M A;  3M4S A;  2WAW A;  3JAL A;  3TZT A;  5C47 A;  3OH4 A;  2RJ0 A;  4FRE A;  3CU0 A;  2Z1E A;  1VPA A;  4EI9 A;  2VS5 A;  4G4V A;  1FGX A;  2KTU A;  4KC2 A;  2PX7 A;  2UYN A;  1N8R H;  3V0L A;  3RYF B;  2J0B A;  1TW1 A;  4Y62 A;  3N9W A;  3IKF A;  2ZU8 A;  1GX0 A;  1JYK A;  1FWY A;  3V0P A;  2VSH A;  2RJ7 A;  4FRL A;  4CVH A;  4HO8 A;  1FXJ A;  4FRP A;  3NK6 A;  5EAZ A;  5D92 A;  3D98 A;  1JFF B;  3IKE A;  4IIJ B;  2HP0 B;  4WBN B;  4X1I B;  2GLZ A;  5JCO A;  1VZT A;  1FNJ A;  5FTS A;  1GQ9 A;  2V0H A;  4G3P A;  1CK2 A;  4ASJ A;  3TD4 A;  1ZI4 A;  4EEM A;  1ZCV A;  3L7Q A;  4BT7 A;  3HTN A;  4EB6 B;  1S4O A;  3GHZ A;  3JAR B;  3HJW C;  4HO2 A;  4NAI A;  5IJ9 B;  5IDS A;  5B8F A;  3UT5 B;  3S0H A;  3Q7U A;  4DRX A;  4YS8 A;  4FRA A;  4ZHV A;  1U3P A;  3V4D A;  3CD6 F;  2LBW A;  1MP4 A;  1R7U A;  1OFU A;  3LME A;  1W41 A;  3ZGF A;  3MCQ A;  3FOQ A;  3D5N A;  3U2V A;  3CCV F;  3F0F A;  3J7A R;  4G4X A;  2AM3 A;  1J7H A;  1GWV A;  4DEC A;  5C8Y A;  3RYI B;  1W40 A;  5AJO A;  1VQL F;  5JVD B;  4Y7U A;  2R75 1;  2FYA A;  3EOR A;  1NF5 B;  1NWG B;  2ZU7 A;  4BQH A;  3CKQ A;  3ZLK A;  2HP3 A;  4CJC A;  3P10 A;  1HM8 A;  1K8A H;  3FBA A;  1RLG A;  3HL3 A;  4BVQ A;  3JAS A;  1VGZ A;  2UZH A;  2JCO A;  2YES A;  4O6N A;  5LA6 B;  2WAL A;  1G23 A;  4KNX A;  4DDZ A;  3T7N A; 
#chains in the Genus database with same CATH homology
 4HG6 A;  3F0D A;  1OQM B;  3QVB A;  1EYR A;  1H7L A;  4P02 A;  4NAK A;  2QKX A;  3USQ A;  4ARW A;  2BO8 A;  4B42 A;  1NMM B;  1ZCY A;  2ZU9 A;  4Q7C A;  4ASY A;  4Y63 A;  3NGW A;  1VZX A;  2FFU A;  2O1G A;  2I5E A;  3MBM A;  1H7T A;  3JUJ A;  3K8E A;  3FPI A;  1SS9 A;  1H5R B;  3CGX A;  3OH1 A;  5FU0 A;  2RJ8 A;  5C4D A;  2FYC B;  3T80 A;  2C0N A;  3USR A;  1WT2 A;  1U3L A;  1TZF A;  2NXV A;  1YRO B;  4G3S A;  1IIN A;  1R81 A;  4FRM A;  4KXO A;  1FZW A;  4MND A;  4M2B A;  4EEO A;  3P0Z A;  2YQS A;  2GGO A;  3T7M A;  1VZU A;  2Y4L A;  4C81 A;  5C48 A;  2RJ6 A;  1Z90 A;  2AE7 A;  2GGQ A;  2Y4M A;  2D7R A;  1MC3 A;  3DK5 A;  3T7O A;  1H4D A;  1R7T A;  2E3D A;  1FOA A;  3OH0 A;  3SX5 A;  3RMW A;  2YCM A;  2J0A A;  1XHB A;  1EZI A;  3PNN A;  3ELC A;  2AEC A;  3K14 A;  1FR8 A;  3O3P A;  4EEA A;  3U0X A;  4JD0 A;  2JCJ A;  2WVK A;  2Y4J A;  3DUV A;  4M4K A;  4ZDQ A;  5CMJ A;  1ZI1 A;  2FY7 A;  3IEW A;  3OH3 A;  3IOI A;  4B5B A;  3IOJ A;  3U2T A;  1MP5 A;  3BRK X;  3ZGG A;  1H7F A;  4KC4 A;  1R80 A;  2A8U A;  4R7P A;  2Z87 A;  4D0Z A;  4Y7V A;  3POL A;  2QH5 A;  3I0L A;  3JUK A;  3I0C A;  1V84 A;  5J49 A;  4HO4 A;  3U2U A;  2Y7A A;  2O1F A;  2VD4 A;  3SX3 A;  2OEG A;  1H4C A;  2A8W A;  1FG5 N;  1H48 A;  1H7E A;  1ZJP A;  2W0V A;  1G8O A;  1LZI A;  4P00 A;  3R3I A;  2GZL A;  2RIX A;  4FIX A;  2V0K A;  4CJB A;  2BO7 A;  2WGZ A;  2I5K A;  5DDT A;  1INI A;  3CKN A;  1LL0 A;  3LW6 A;  1WT0 A;  5C1L A;  4AYL A;  4ECM A;  4E1K A;  1FRW A;  1G0R A;  1LL3 A;  1O0R A;  1GQC A;  1U43 A;  1JVG A;  5C1G A;  1OMX A;  4NAL A;  3ST8 A;  1JY8 A;  2YQH A;  3SX8 A;  1W77 A;  2YQC A;  4FIY A;  1H7G A;  5C36 A;  1JV3 A;  2ICX A;  3KE1 A;  1LZ0 A;  3SXB A;  1HJL A;  1PZT A;  4MYB A;  1TW5 A;  3U2W A;  2RJ5 A;  1QG8 A;  1ZIZ A;  1E5K A;  2AGD A;  2D0J A;  2VSI A;  4KPX A;  4KQL A;  4B3U A;  4B4B A;  4C8G A;  1VGT A;  3ESJ A;  1IV3 A;  4HO6 A;  5C38 A;  4GBP A;  1VHA A;  3RSB A;  4L41 C;  2X60 A;  2X5S A;  1FR9 A;  4FRB A;  5C4C A;  1S4P A;  4FRD A;  1G3L A;  4BMA A;  4HO0 A;  1H7Q A;  4Y64 A;  1ZI5 A;  3OGZ A;  3Q8H A;  2AMT A;  1WVC A;  4HO3 A;  1YQN A;  1ZJ0 A;  3RMV A;  2FYD B;  1NKH B;  2RJ4 A;  1HM9 A;  1H47 A;  1V82 A;  1VGW A;  2D7I A;  4Y7F A;  4XWI A;  5C4E A;  3SXE A;  1LZ7 A;  2P73 A;  1GX1 A;  1H7H A;  1HM0 A;  4FQW A;  5EJ1 A;  5C3A A;  4D48 A;  2XWL A;  2Y6P A;  3PKQ A;  5C3B A;  2VS3 A;  3F6M A;  1NQI B;  4Y7G A;  5I1F A;  1ZJO A;  2VXM A;  3I0G A;  4FRH A;  3KIA A;  4LW3 A;  3SXG A;  1JN1 A;  2WVM A;  4FRO A;  1QGS A;  2JCK A;  5D91 A;  1WSZ A;  1FO9 A;  2XWN A;  3I0E A;  4B4M A;  3ZF8 A;  3V90 A;  2UX8 A;  2XME A;  5CQM X;  3Q80 A;  5EIY A;  3OH2 A;  1G97 A;  1H5T A;  3EE5 A;  3ERN A;  4EVW A;  1ZCU A;  4AC3 A;  1IIM A;  2WVL A;  3K8D A;  5L6S A;  1R82 A;  1H5S A;  3I0D A;  5IFY A;  3BCV A;  1LVW A;  1R7Y A;  3FWW A;  2WE9 A;  3IOH A;  4IRP A;  1G9R A;  1R7V A;  2Z86 A;  3R2W A;  2WAW A;  2CU2 A;  3OKR A;  4K6R A;  3V0M A;  3OC9 A;  4AAW A;  4FRQ A;  4C82 A;  1ON6 A;  3CKJ A;  4HOC A;  5JQQ A;  5HS2 A;  3TZT A;  3V8Y A;  1VGU A;  3SXA A;  2FYB A;  3JVH A;  4M2A A;  5C47 A;  1H5R A;  3OH4 A;  2RJ0 A;  4FRE A;  3CU0 A;  2PMP A;  1IV4 A;  2V0J A;  1VPA A;  4KPZ A;  3OAM A;  4NAN A;  1VH8 A;  2VS5 A;  1FGX A;  4G87 A;  4KC2 A;  1U40 A;  3F1C A;  4EE4 A;  1H5S C;  2PX7 A;  4Y7T A;  1LL2 A;  2RIT A;  1IV1 A;  3V0L A;  5L6V A;  1H3M A;  5DDV A;  2J0B A;  1OMZ A;  1TW1 A;  3U0Y A;  3F0G A;  1XZ6 A;  3E26 A;  4Y62 A;  1PZY B;  4O6M A;  1ZDG A;  1ZI3 A;  2VK9 A;  3N9W A;  3IKF A;  1VM8 A;  2ZU8 A;  1GX0 A;  3I0I X;  1JYK A;  1KWS A;  4Y6U A;  4C8I A;  3I0F A;  1FWY A;  5CQP A;  3V0P A;  3I0K A;  2VSH A;  2V0I A;  4Y9X A;  2RJ7 A;  4FCE A;  5CQO A;  2PGV A;  5FV9 A;  4FRL A;  3E25 A;  2PGY A;  4CVH A;  4HO8 A;  1FO8 A;  2RJ9 A;  1FXJ A;  2VS4 A;  4FRP A;  1VIC A;  3SXD A;  2PA4 A;  5D92 A;  1GA8 A;  4J18 A;  1ON8 A;  3D98 A;  2RIY A;  4D0T A;  3IKE A;  1H5T B;  2O1H A;  2YC3 A;  4KT7 A;  2P6W A;  1G1L A;  5CQN X;  1G93 A;  5C4B A;  2DPW A;  1KNK A;  1VZT A;  1H5S B;  3IEQ A;  5FTS A;  1FXO A;  1G95 A;  1GQ9 A;  2OI7 A;  2V0H A;  5C3D A;  4G3P A;  3QHD A;  1S4N A;  2BO4 A;  4ASJ A;  1ZJ1 A;  2X65 A;  2OI5 A;  1ZI4 A;  2W0W A;  1ZCV A;  2AH9 A;  2AM4 A;  3V8Z A;  1ZDF A;  2MZB A;  4EEM A;  5CQL X;  3Q4S A;  1QWJ A;  4EE5 A;  4B2W A;  4KC1 A;  5C4F A;  1R7X A;  1S4O A;  1INJ A;  2P72 A;  3PKP A;  1HV9 A;  3GHZ A;  4HO2 A;  1JVD A;  4NAI A;  5EJZ A;  5IDS A;  1NHE B;  5B8F A;  3Q7U A;  1JV1 A;  4YS8 A;  3ZLL A;  4FRA A;  4CJ8 A;  1U3P A;  3TQD A;  1VH1 A;  2APC A;  2XMH A;  1H4E A;  2FFV A;  3SX7 A;  4HCQ A;  5C8R A;  3JTJ A;  1O7Q A;  1ZJ3 A;  2JCL A;  3F0E A;  1MP4 A;  2X5Z A;  1R7U A;  4MIX A;  4UEG A;  4C2S A;  1TVY A;  5IDT A;  4M28 A;  3V0N A;  4EEG A;  2OI6 A;  5BXC A;  3ZGF A;  3DJ4 A;  1ZCT A;  2RIZ A;  3SXC A;  2VFZ A;  2I7B A;  3CKV A;  1IV2 A;  3FOQ A;  3U2X A;  3D5N A;  3GUE A;  3SPT A;  1G2V A;  4Y6N A;  3U2V A;  4EE3 A;  2V0L A;  2OEF A;  5CMF X;  5AJN A;  4HO5 A;  3F0F A;  1W57 A;  1VH3 A;  4B4G A;  2AM3 A;  4FCU A;  1KNJ A;  1HJJ A;  1ZHJ A;  2Y4K A;  2YC5 A;  1GWV A;  1ZJ2 A;  4AYJ A;  1V83 A;  2RJ1 A;  1T0A A;  2QGI A;  1GWW A;  4DEC A;  1LZJ A;  4G3Q A;  3I0J A;  1YP3 A;  3V91 A;  3RE3 A;  1YP4 A;  5AJO A;  4KNR A;  2E8B A;  2AES A;  3D8V A;  4KRV A;  4Y7U A;  1GX4 A;  2FYA A;  5CMH A;  4D11 A;  3EOR A;  2WEE A;  1NF5 B;  1K4V A;  5CMG X;  4IRQ A;  2YQJ A;  1NWG B;  2ZU7 A;  5C1H A;  1MP3 A;  4BQH A;  3CKQ A;  5AJP A;  3ZLK A;  2VXL A;  3B6N A;  5FUH A;  4C8E A;  4HO9 A;  4CJC A;  4LW6 A;  4JIS A;  5FYE A;  3P10 A;  1YP2 A;  2BO6 A;  1HM8 A;  3V0Q A;  3K2X A;  1QGQ A;  1O23 B;  1H5S D;  3FBA A;  1O7O A;  3F1Y A;  3HL3 A;  5FTV A;  5FU8 A;  1JYL A;  3V0O A;  2Q4J A;  1VGZ A;  4DE7 A;  1W55 A;  1WT3 A;  2UZH A;  2XWM A;  2JCO A;  2YES A;  5CMI A;  2AM5 A;  1FGG A;  4O6N A;  3I0H A;  4D11 C;  4B2X A;  5C49 A;  1I52 A;  1G23 A;  1WT1 A;  4KNX A;  4DDZ A;  2ICY A;  3CKO A;  3T7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...