1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
1ZCTA 4HO0A 3CKQA 3P10A 1U40A 4P00A 3CKJA 1H7LA 2BO4A 2JCKA 3OH3A 5FUHA 1EYRA 4JISA 5EJZA 3U2VA 3P0ZA 1V82A 2PGYA 3R3IA 1OQMB 1H7QA 1GA8A 5C48A 3KIAA 2UZHA 3F0FA 2X5ZA 3SX5A 4D11A 1YP4A 3Q80A 4ARWA 1R82A 3OAMA 2X5SA 1HJJA 4Y7UA 4ZDQA 2XWMA 1G1LA 2UX8A 4NAKA 1R7UA 2WVMA 3K2XA 1HM0A 4B5BA 1TW5A 1MP4A 4D11C 4B3UA 5CMIA 3F0DA 3EE5A 3HL3A 3SXDA 3RMVA 5L6VA 1H3MA 1W77A 3DUVA 3JTJA 4EE3A 4HOCA 2XMEA 3CGXA 2D0JA 4Y64A 1G2VA 2WE9A 1KWSA 4FREA 5C1GA 5FU8A 1FR8A 3CKOA 4FRMA 3V0PA 1IV4A 3V8YA 3I0IX 1H5SA 4AYJA 1ZCUA 1JV3A 5CMGX 2Y4MA 1SS9A 1LL0A 4C8EA 1ZI1A 2RJ0A 1R7TA 2AECA 3USRA 3ERNA 2AM4A 3ESJA 2FYCB 4ASJA 5AJPA 1QGQA 4L41C 1JYKA 4GBPA 3JVHA 3F0EA 1GQ9A 1G97A 4HCQA 3IOJA 4XWIA 2WEEA 2RJ5A 2PGVA 5HS2A 1H5SC 5C8RA 3CU0A 2ZU7A 4UEGA 2FYBA 2RJ7A 1NKHB 5FV9A 1U43A 3D5NA 4KNRA 1LZIA 4AC3A 1FZWA 1ZI3A 1ZJ2A 1NMMB 2VS4A 2Y4KA 2FYDB 3NGWA 1H4EA 3PNNA 2AESA 4KT7A 1JVGA 1O0RA 3RE3A 2FY7A 4FQWA 2I5EA 3KE1A 5FU0A 4NAIA 1H7EA 2Y6PA 2W0WA 3Q7UA 3R2WA 3ZGFA 3JUJA 3U2UA 2WGZA 4KPZA 1ZJ0A 2AM3A 2P73A 4D0ZA 4EVWA 2AM5A 2RJ6A 5L6SA 2XWLA 3F6MA 1FO8A 5DDTA 4IRPA 4NALA 3FPIA 2JCOA 2YQJA 1WT1A 4FCUA 2PX7A 2V0JA 2I7BA 3I0EA 3GHZA 4EEMA 3ZF8A 3ZGGA 4B4BA 3K8DA 2VS5A 2BO8A 3U2XA 4FRAA 2WAWA 4Y7GA 2P72A 1IV3A 1ZJ3A 1ZJOA 4EEGA 3TQDA 1HJLA 4C2SA 1H5SD 4G87A 4HO2A 2OEFA 1VM8A 1XHBA 2MZBA 5J49A 1FWYA 1JY8A 2Z86A 3RMWA 1IV2A 4HO8A 4Y7FA 1ZJ1A 1OMZA 1S4PA 4DE7A 2Z87A 1KNKA 4FCEA 3I0HA 1VHAA 2V0KA 4HO4A 4ECMA 1H4DA 4D48A 1GX0A 1R81A 3D8VA 1VGUA 2VSIA 4DECA 1FXJA 2ICXA 1U3PA 5AJOA 1MP5A 4Y62A 3GUEA 4MYBA 1G95A 1ZI5A 4HO5A 2Y4LA 1R7VA 2AE7A 1FO9A 4FRPA 4C8IA 2YQHA 3CKNA 2A8UA 1T0AA 1NF5B 1FXOA 1H5SB 2APCA 3SXCA 4BQHA 4EE5A 3FBAA 1LVWA 3V91A 4P02A 4KC2A 2QH5A 4FROA 1R7XA 1YROB 2E8BA 3PKPA 4YS8A 1QG8A 1ZJPA 3SPTA 4FRLA 1H5TA 3T80A 1HV9A 5C47A 1YQNA 1TVYA 3IEQA 3QVBA 3OH1A 1V84A 1ON8A 2QGIA 3SXAA 2WVKA 3V0NA 5CMJA 5AJNA 1MP3A 1QGSA 3I0DA 1ZDFA 1QWJA 4ASYA 5C4CA 2RITA 3TZTA 4KXOA 5C38A 1K4VA 3EORA 4KPXA 1H48A 1IIMA 5CQLX 1H7FA 1WT0A 3IKEA 2X65A 3E26A 2D7RA 1FR9A 3DK5A 2VXLA 1XZ6A 2NXVA 1GQCA 3FWWA 3V0QA 5EJ1A 2AMTA 2O1GA 2ZU9A 4M2BA 1GWWA 2YQCA 4R7PA 4FRQA 1H5RA 3V0OA 3F0GA 3OH0A 5CMHA 3OC9A 1HM8A 3PKQA 2Y4JA 4HO3A 3V90A 4LW3A 2YESA 2FYAA 3SX3A 4CVHA 4G3PA 3F1YA 5IDSA 3RSBA 2XWNA 4BMAA 1R80A 4B4MA 1I52A 2VFZA 3Q8HA 2GGQA 4AAWA 3BRKX 4M28A 1EZIA 2Q4JA 3IKFA 5DDVA 5C1HA 1JN1A 1VGTA 1OMXA 1FOAA 1GWVA 4J18A 1ZCVA 5C4BA 1LZ7A 3LW6A 4KQLA 1VGWA 3QHDA 2VSHA 5C4DA 3ZLKA 1IINA 3F1CA 2E3DA 3OGZA 3U2WA 1VZUA 4KC1A 3ZLLA 4M4KA 1W57A 3N9WA 1G8OA 5B8FA 1WT2A 1O7OA 1R7YA 3OH2A 1FGXA 4FRHA 4Y6UA 1FRWA 2AH9A 1G93A 1HM9A 1E5KA 1ZDGA 5C36A 2RJ4A 4CJBA 1H47A 2O1FA 1U3LA 2AGDA 3T7NA 3U2TA 5EIYA 4KRVA 3ST8A 2D7IA 3U0YA 1JV1A 1G9RA 3K8EA 2V0HA 3SXBA 5C3AA 3U0XA 3E25A 3SXGA 3Q4SA 2YC5A 5CQPA 1VH1A 4EEAA 1W55A 4CJCA 2YCMA 1H5TB 3CKVA 3I0FA 2OI5A 3I0JA 2RJ8A 4NANA 1NWGB 1GX4A 1H7TA 2JCJA 3IOHA 1WT3A 2BO7A 4B2XA 4MNDA 4LW6A 5CMFX 3I0KA 2WVLA 2FFUA 1VZTA 3I0LA 1VICA 5C1LA 1TW1A 2PMPA 4JD0A 1WVCA 3USQA 1GX1A 3JUKA 1ZIZA 3T7OA 4EE4A 2P6WA 1VGZA 2A8WA 3SX8A 1LL2A 2YC3A 4K6RA 3V0MA 2RIXA 4E1KA 3ELCA 4FRDA 1S4OA 2Y7AA 4HO6A 3SX7A 4Y7TA 2ICYA 4D0TA 2O1HA 2YQSA 1Z90A 2GZLA 1H5RB 4C81A 3B6NA 1KNJA 1ZCYA 3OH4A 1PZYB 4Y7VA 3MBMA 1JVDA 1S4NA 5FTSA 4HG6A 1INJA 5FYEA 1LZJA 5BXCA 4G3QA 5JQQA 5C3BA 4C8GA 4B2WA 1G0RA 5CQMX 4KC4A 2X60A 4B42A 2RIYA 5CQNX 1LZ0A 2PA4A 4M2AA 5I1FA 2OEGA 3T7MA 2GGOA 1VH3A 4KNXA 4G3SA 1JYLA 2VXMA 3V0LA 2RIZA 4FRBA 2DPWA 1INIA 1TZFA 1ON6A 5CQOA 3D98A 2V0IA 2W0VA 4HO9A 5IFYA 1V83A 2OI6A 1YP2A 1YP3A 3I0GA 3FOQA 4Y9XA 3V8ZA 1H4CA 1G23A 2VS3A 4AYLA 5C49A 3DJ4A 4Y63A 1O7QA 1ZI4A 4IRQA 3POLA 3BCVA 1H7GA 3O3PA 5FTVA 2ZU8A 1FG5N 2RJ1A 1H7HA 2V0LA 3K14A 5IDTA 3IOIA 2XMHA 1LL3A 3SXEA 1FGGA 1VH8A 4DDZA 5C3DA 1NQIB 1VPAA 2RJ9A 1ZHJA 3IEWA 2QKXA 1NHEB 2OI7A 2FFVA 4Y6NA 1G3LA 3OKRA 4CJ8A 5C4FA 2JCLA 1O23B 5C4EA 1IV1A 3I0CA 4EEOA 2CU2A 2VD4A 1MC3A 1VZXA 4C82A 1PZTA 1WSZA 2BO6A 4B4GA 2I5KA
chains in the Genus database with same CATH superfamily
1ZCTA 3CKQA 1J7HA 3JATB 3CKJA 4O4JA 2BO4A 2OZBA 2R751 1V82A 4I4TA 4C4WC 3KIAA 2X5ZA 4D11A 1GZ0A 3Q80A 1W40A 1QVGF 2Q1YA 4WBNB 3KJJA 2UYKA 1QU9A 1R7UA 1HM0A 1TW5A 3TD4A 1FFXB 4B3UA 4ZHVA 3SXDA 4X3LA 1H3MA 4EE3A 2XMEA 4FREA 2WE9A 1H5SA 3JALB 1ZCUA 5CMGX 1LL0A 1ONIA 2I6DA 3USRA 3ERNA 5AJPA 1QGQA 1JYKA 3MCAB 1S72F 3RYHA 1QAHA 2ZVZA 4B45A 3D5NA 1ZJ2A 2Y4KA 4I50B 1M1KH 2FY7A 2W0WA 3R2WA 2WGZA 1Z5WA 5L6SA 3S0YA 2OTJF 2YQJA 4FCUA 1VQNF 4TUYB 3KJKA 2I7BA 3CCUF 3GHZA 1SDSA 2BO8A 5FJ4C 2WAWA 4Y7GA 1FNJA 2P72A 4EB6B 5FNVB 1ZJOA 5KMGA 3N2KA 5LYJB 4G87A 4HO2A 4DXDA 1TUBA 2MZBA 1JY8A 2Z86A 1JFFA 3LWVC 3G6EF 1IV2A 4HO8A 1ZJ1A 3AGKA 4FCEA 3I0HA 5EZYB 3PAFA 2IG8A 1VHAA 2V0KA 1ZWZA 4D48A 4DECA 1FXJA 3D00A 4Y62A 1W5EA 1G95A 1ZI5A 2Y4LA 2AE7A 4G4WA 2G9IA 2A8UA 2APCA 3SXCA 4BQHA 5HP7A 4YS8A 5BMVB 4HNAA 3SPTA 1ZJPA 4FRLA 2FGYA 1H5TA 3T80A 5LA6B 3J7AR 5EIBC 1V84A 2CHTA 4R40B 2WVKA 5AJNA 1QWJA 5C4CA 3CPQA 4KXOA 1K4VA 1H48A 2X65A 3DK5A 1XZ6A 3CCEF 3FWWA 5EJ1A 2W8BC 2O1GA 5ITZB 3JAWB 4X3MA 2HRUA 1H5RA 1VQLF 3F0GA 3OC9A 2BTOA 4IHJA 4BVTA 3V90A 4CVHA 3I3FA 4BMAA 1R80A 2GGQA 3JAMM 5EIBD 2VAMA 2Q4JA 5CA0A 3VMFB 3HKEA 5C1HA 1RQ7A 4BT5A 2WALA 5IYZA 1GWVA 1ZCVA 3CYQA 3K0TA 1YIJF 5CB4A 1NQ3A 3OGZA 3U2WA 1R7YA 3OH2A 4I55B 4ERHA 3WPWA 1FRWA 2Z1EA 1HM9A 1FSZA 5IJ0A 3WJPA 3U2TA 3M1XA 5EYPB 4PWTA 1JV1A 4ZHYB 3UT5B 3SXBA 3E25A 5EO3A 2YC5A 1VH1A 2BO1A 5JQGB 3CKVA 3I0JA 2RJ8A 3JATA 1H7TA 5FLXM 2BO7A 3TD5A 3ZO8A 5CMFX 4DRXB 3I0KA 1VZTA 3I0LA 1VICA 5C1LA 4JD0A 1VK3A 1VQMF 4EE4A 1VGZA 3SX8A 1LL2A 3ELCA 4WBNA 4HO6A 3E20B 4RHAA 2O1HA 2YQSA 1FFXA 3NK6A 3IR9A 3HAXD 1S4NA 3NK7A 4G3QA 5JQQA 3FD6A 5CQNX 3JALA 5HWEA 2GGOA 1JYLA 1W3EX 2W0VA 4HO9A 1YP3A 3I0GA 5EAZA 3JAKA 5C49A 4FIYA 4Y63A 3CMEF 3CCQF 3O3PA 3U0OA 2YXZA 5IDTA 2XMHA 4I50A 1FGGA 3V3TA 2HX0A 4O2AB 3E22B 3NVKE 1G3LA 2JCLA 1X7PA 5D92A 3G4SF 1IV1A 3I0CA 1VZXA 1WSZA 2BO6A 3RYFB 1U40A 4TUYA 1H7LA 2VXYA 3OH3A 1EYRA 4EB6A 5MN5A 5FNVA 5EJZA 3R3IA 4ZI7B 1OQMB 1GA8A 5C48A 5LYJA 4BT6A 4BVRA 3SX5A 2R6R1 5LOVB 4Y7UA 4ZDQA 1N8RH 2CW4A 1G1LA 5EZYA 4NAKA 2MQEA 2WVMA 4B5BA 1MP4A 4D11C 5GIPC 5CMIA 5L6VA 1W77A 3JTJA 5FU8A 1FR8A 4FRMA 1IV4A 3V8YA 3I0IX 4AYJA 4C8EA 3OBWA 2HS3A 1RA4A 1QVFF 3TD3A 2AECA 2GLZA 5BMVA 2FYCB 2J0BA 4L41C 3VCZA 3JVHA 5LA6A 3IOJA 4XWIA 2ALEA 1H5SC 2ZU7A 4UEGA 2FYBA 4G4VA 1CN7A 1NKHB 5FV9A 3S03A 1LZIA 1XV2A 2CVLA 1H4EA 3RYCB 2RHLA 3PNNA 4KT7A 3L7QA 2ZAUA 4NAIA 2RB9A 2P6YA 5AVMA 3ZGFA 4KPZA 5ITZA 1ZJ0A 2AM3A 3JAWA 4D0ZA 2RJ6A 2AIZP 4Q7CA 3VYUC 1FO8A 1QD9A 2JCOA 2PHNA 2HRYA 2H6LA 3I0EA 3ZGGA 2VS5A 3U2XA 4FRAA 3CCVF 4KWEA 3G71F 1H5SD 3RA5A 1XHBA 4O4IB 3RYIB 4X20B 5C8YB 2Z87A 3N2GB 3K12A 3FFMA 4ZHQB 4I55A 3D8VA 4ZK7A 1VGUA 2VSIA 4TZZA 5EYPA 3S06A 1T0AA 3UT5A 1K9MH 3WGJA 2QI2A 4P02A 4KC2A 2QH5A 1R7XA 3PKPA 1QG8A 5JQGA 5C47A 1TVYA 3OH1A 1ON8A 3LYBA 3V7EA 3SXAA 5J2TB 3V0NA 5MN6A 2JNBA 1QGSA 3TZTA 4DRXA 1WT0A 3VTIC 3S0WA 2D7RA 2VXLA 2NMUA 1TVKB 1GQCA 4G4XA 2ZU9A 1GWWA 3DDNA 2YQCA 1VQ9F 1VQ6F 3WGKA 4FRQA 3CG6A 5EB0A 3SX3A 2FYAA 4G3PA 3F1YA 1Q7YH 5IDSA 3CMAF 4AAWA 1RQ2A 3LFOA 3VIUA 1EZIA 4TV9B 3CXCF 3IKFA 2L26A 5DDVA 1JN1A 1RLGA 4EI9A 1VGTA 1OMXA 2VGNA 4J18A 1LZ7A 3CCLF 2AIFA 3CB2A 2Z01A 4BVQA 3ZLLA 4M4KA 3N9WA 3S0HA 1G8OA 1O7OA 1FGXA 3MQWA 5C36A 4CJBA 4ZOLB 2O1FA 3U0YA 3KHNA 4O2AA 3E22A 3CD6F 3K8EA 3SXGA 5HY1A 5GINC 3RYFA 4CJCA 2YCMA 5HXZA 4ZHWA 2HS0A 2LBTA 2QEXF 4M8IA 3NMUC 4MNDA 3C9SA 4ZI7A 1W42A 3V7QA 1Q81H 2CWJA 1WVCA 3USQA 1GX1A 3T7OA 2P6WA 4X1IB 5LOVA 2A8WA 2YC3A 3J81M 4K6RA 2RIXA 4FRDA 1S4OA 4Y7TA 1X7OA 4C81A 1OAPA 3WGLA 5FTSA 3V4DA 1INJA 5IJ9B 1G0RA 5CQMX 4B42A 2RIYA 2Z1UA 4BT4A 5HY2A 2OEGA 5GONB 1VH3A 3V0LA 2HP0B 3I56F 2DPWA 4NUTA 1INIA 3OBYA 2V0IA 2VGMA 2UYJA 3FOQA 3RA6A 5JVDB 1ZI4A 4IRQA 1VQVA 1W5AA 2ZU8A 1CK2A 2RJ1A 2V0LA 3K14A 1SA0B 3RYCA 4DDZA 5C3DA 4G4YA 1ZHJA 3IEWA 2UYPA 1GO1A 4CJ8A 2OTMA 3OKRA 4O4JB 4B4GA 1MC3A 4C82A 2I5KA 3P10A 1NMUB 3WJRA 1GO0A 2CZWA 5FUHA 4JISA 3KIZA 1H7QA 4O4LB 3F0FA 1R82A 1CLIA 1HJJA 4O4IA 3RYIA 4X20A 5C8YA 2UX8A 2ZVYA 3K2XA 3N2GA 4ZHQA 3OW2F 1UFYA 2EWCA 2HQSC 3F0DA 1K73H 2DT4A 3RMVA 1VQPF 3DUVA 4HOCA 3CGXA 5J2UB 3VYTC 1KWSA 3CKOA 1VQ8F 3V0PA 4G88A 1JV3A 1SS9A 1ZI1A 2RJ0A 4O2BB 4X1YB 1R7TA 4EI7A 2AM4A 3ESJA 4ASJA 5LP6B 2RJ5A 2PGVA 2IQQA 2I6RA 5J2TA 3CU0A 4BW0B 2RJ7A 1U43A 4KNRA 1FZWA 2VS4A 1R1MA 2AESA 1JVGA 1O0RA 3RE3A 2V9YA 4FQWA 1TVKA 1H7EA 1RLUA 2Y6PA 3Q7UA 3JUJA 2P73A 1SZQA 4EVWA 2AM5A 2Z1TA 2XWLA 3F6MA 5DDTA 4IRPA 3FPIA 3LWPC 2PX7A 3LDTA 2V0JA 4EEMA 5G4VC 5HY4A 3C8LA 3ZF8A 3K8DA 4B4BA 2KG4A 2KTUA 4BVSA 3CC7F 5MN4A 3VYSC 2KGWA 1ZJ3A 4C2SA 4TV9A 2OEFA 1VM8A 5J49A 1FWYA 3HKCB 3RMWA 4Y7FA 1S4PA 1KNKA 4TV8B 1K8AH 5HXUA 4ECMA 1H4DA 3OONA 1GX0A 1R81A 4FFBB 3LWQC 5AJOA 1U3PA 4ZOLA 2F9ZC 1OFUA 1R7VA 1FO9A 4FRPA 4C8IA 5GANK 4LCKA 1NF5B 1FXOA 4YJ2B 3M4SA 4X1KB 2E8BA 1YROB 1YQNA 1KC8H 2QA4F 1YI2F 5EB1B 2QGIA 4U39A 5GIOC 4ASYA 3CCJF 5C38A 3EORA 4KPXA 1IIMA 5CQLX 4B62A 1H7FA 3IKEA 1X52A 3E26A 1XRGA 3PLAC 4NWOB 2NXVA 4X1IA 1IPAA 4U3JB 3WPXA 4R7PA 4O6NA 2HS4A 3OH0A 3S02A 1HM8A 2Y4JA 4HO3A 4LW3A 2YESA 3RSBA 5DCVA 2XWNA 1I52A 5IJ9A 3BRKX 5GONA 2HP0A 1KD1H 2OHWA 4BT7A 2OTLF 3LW6A 4KQLA 1W5BA 3ZLKA 1IINA 5JVDA 1VZUA 4KC1A 4FRHA 4YJ3B 5JCOA 2AH9A 1SA0A 2RJ4A 1U3LA 2AGDA 5EIYA 1DBFA 3LWOC 1G9RA 2J0AA 2V0HA 2VK9A 3Q4SA 2IAFA 3NVIB 3DC2A 2N48A 3D54A 3ZP4A 2OI5A 4NANA 1NWGB 1GX4A 3VOAA 2JCJA 4LW6A 1YHQF 2YYEA 4NQ3A 2FFUA 3MDOA 3CYPB 1TW1A 3P4EA 4O4LA 3JUKA 1ZIZA 5HP8A 3SX7A 2GZLA 5KX5B 3N4YA 3B6NA 5HY0A 1ZCYA 4FIXA 4Y7VA 1JVDA 3CCSF 3D01A 3BYQA 5FYEA 5J2UA 5C3BA 4KC4A 2X60A 1LZ0A 3JAKB 2PA4A 4M2AA 5I1FA 4O2BA 4X1YA 4IIJB 4G3SA 4LNUB 2DYYA 2RIZA 1ON6A 5CQOA 4BT2A 1PF5A 1V83A 5LP6A 1Q8RA 3LMEA 2ZOVA 4Y9XA 3V8ZA 2VS3A 2UYNB 3CCRF 4F6RB 3DJ4A 1VQ5F 1PXWA 3POLA 5FTVA 1FG5N 1H7HA 4O4HB 3C9UA 4EI8A 3IOIA 2C0NA 1FNKA 1NQIB 1VPAA 2QKXA 2LCAA 1NHEB 2OI7A 2LBXA 2FFVA 4G4ZA 5C4FA 5JH7B 1KQSF 2CU2A 1Q86H 1H7MA 3E1YA 4HO0A 3HKBB 3CPWF 3QTYA 3JASB 4P00A 2JCKA 1X25A 3VO8A 5LXTB 1YJWF 2HVYD 3U2VA 3P0ZA 2PGYA 2UZHA 1YP4A 4ARWA 5CA1B 3OAMA 2X5SA 3HKCA 2XWMA 4TV8A 3VI6A 1VQOF 3EE5A 4FFBA 3HL3A 2Z1FA 2D0JA 4Y64A 1G2VA 5C1GA 2BTUA 4YJ2A 2Y4MA 4X1KA 2RHOA 4GBPA 3F0EA 1GQ9A 1G97A 4HCQA 2FC3A 2WEEA 5HS2A 1XHOA 2GVIA 3ZOPA 5C8RA 3HJWC 3HKDB 4AC3A 2ZODA 1ZI3A 1NMMB 3NGWA 2FYDB 3JARB 3SIUA 2I5EA 3KE1A 5FU0A 3WGNA 4B5CA 2VAPA 4U3JA 3CC4F 3U2UA 1M90H 1W41A 4NALA 1VQKF 3VOBA 1WT1A 3WGMA 3C9TA 1IV3A 1YGYA 4EEGA 3TQDA 1HJLA 4I4TB 1ODEA 5A2QM 1W581 4XCQA 1OMZA 4DE7A 3QUWA 3LWRC 5GAPK 4HO4A 4YJ3A 2ICXA 5D91A 5EWRA 1MP5A 3GUEA 4MYBA 4HO5A 2B33A 2YQHA 3CKNA 2H8CA 1H5SB 4EE5A 3FBAA 1LVWA 3V91A 4FROA 1HV9A 3IEQA 3QVBA 3RYHB 1YJ9F 4O6MA 5CMJA 1VQ7F 1MP3A 1W5FA 3I0DA 1ZDFA 2RITA 1YITF 1FR9A 2VAWA 2H8EA 3V0QA 2AMTA 3WJQA 4E6EA 4M2BA 3C9RA 5KX5A 3V0OA 5CMHA 3PKQA 3WXMB 4B4MA 2VFZA 3Q8HA 1YJNF 5KMGB 4M28A 3O85A 3N2KB 4IIJA 4LNUA 1E7KA 1TUBB 1JJ2F 3JCMM 1JFFB 2LBWA 1FOAA 5C4BA 1VGWA 3QHDA 2VSHA 5C4DA 2K1SA 2UYNA 3F1CA 2E3DA 3GYQA 4F6RA 1W57A 5B8FA 1WT2A 4Y6UA 1G93A 4O4HA 1E5KA 1ZDGA 2RHHA 1H47A 3T7NA 3ZP7A 4KRVA 4B46A 3ST8A 2D7IA 3J80M 3MCQA 5C3AA 3U0XA 5JH7A 5JCOC 1NJIH 5CQPA 4EEAA 1W55A 4HNAB 4BT3A 1H5TB 1Z5VA 3HKBA 3R0PA 3JASA 3I0FA 3CC2F 3N4ZA 3I55F 2HP3A 3IOHA 5LXTA 1WT3A 4B2XA 2WVLA 1COMA 2PMPA 3CCMF 1XBIA 5CA1A 2KTVA 3FD5A 3V0MA 4E1KA 4RQOA 1W2BF 2Y7AA 1UI9A 2ICYA 4D0TA 3IMPA 1Z90A 1H5RB 1W59A 2BTQB 1KNJA 2CHSA 3OH4A 4IHJB 1PZYB 3MBMA 2ZF8A 4HG6A 3I7TA 1LZJA 5BXCA 4C8GA 4B2WA 5G4UC 3ON1A 3T7MA 4KNXA 5CA0B 3HKEB 1Q82H 2VXMA 4FRBA 1TZFA 3HTNA 2CSLA 3D98A 1DT9A 5IYZB 5IFYA 2OI6A 1YP2A 2RHJA 3GTZA 1H4CA 1G23A 4AYLA 5CB4B 1JD1A 1O7QA 1VQ4F 3BCVA 1H7GA 3HKDA 3SIVA 5LP6C 2QTPA 5IT9M 5IJ0B 3JARA 1LL3A 3SXEA 1VH8A 2RJ9A 4MIXA 2Q1XA 4Y6NA 1O23B 5C4EA 1T0KB 4BY9D 3HWUA 4EEOA 2VD4A 1PZTA 3M84A
chains in the Genus database with same CATH topology
1ZCTA 4HO0A 3CKQA 3P10A 1U40A 4P00A 3CKJA 1H7LA 2BO4A 2JCKA 3OH3A 5FUHA 1EYRA 4JISA 5EJZA 3U2VA 3P0ZA 1V82A 2PGYA 3R3IA 1OQMB 1H7QA 1GA8A 5C48A 3KIAA 2UZHA 3F0FA 2X5ZA 3SX5A 4D11A 1YP4A 3Q80A 4ARWA 1R82A 3OAMA 2X5SA 1HJJA 4Y7UA 4ZDQA 2XWMA 1G1LA 2UX8A 4NAKA 1R7UA 2WVMA 3K2XA 1HM0A 4B5BA 1TW5A 1MP4A 4D11C 4B3UA 5CMIA 3F0DA 3EE5A 3HL3A 3SXDA 3RMVA 5L6VA 1H3MA 1W77A 3DUVA 3JTJA 4EE3A 4HOCA 2XMEA 3CGXA 2D0JA 4Y64A 1G2VA 2WE9A 1KWSA 4FREA 5C1GA 5FU8A 1FR8A 3CKOA 4FRMA 3V0PA 1IV4A 3V8YA 3I0IX 1H5SA 4AYJA 1ZCUA 1JV3A 5CMGX 2Y4MA 1SS9A 1LL0A 4C8EA 1ZI1A 2RJ0A 1R7TA 2AECA 3USRA 3ERNA 2AM4A 3ESJA 2FYCB 4ASJA 2J0BA 5AJPA 1QGQA 4L41C 1JYKA 4GBPA 3JVHA 3F0EA 1GQ9A 1G97A 4HCQA 3IOJA 4XWIA 2WEEA 2RJ5A 2PGVA 5HS2A 1H5SC 5C8RA 3CU0A 2ZU7A 4UEGA 2FYBA 2RJ7A 1NKHB 5FV9A 1U43A 3D5NA 4KNRA 1LZIA 4AC3A 1FZWA 1ZI3A 1ZJ2A 1NMMB 2VS4A 2Y4KA 2FYDB 3NGWA 1H4EA 3PNNA 2AESA 4KT7A 1JVGA 1O0RA 3RE3A 2FY7A 4FQWA 2I5EA 3KE1A 5FU0A 4NAIA 1H7EA 2Y6PA 2W0WA 3Q7UA 3R2WA 3ZGFA 3JUJA 3U2UA 2WGZA 4KPZA 1ZJ0A 2AM3A 2P73A 4D0ZA 4EVWA 2AM5A 2RJ6A 4Q7CA 5L6SA 2XWLA 3F6MA 1FO8A 5DDTA 4IRPA 4NALA 3FPIA 2JCOA 2YQJA 1WT1A 4FCUA 2PX7A 2V0JA 2I7BA 3I0EA 3GHZA 4EEMA 3ZF8A 3ZGGA 4B4BA 3K8DA 2VS5A 2BO8A 3U2XA 4FRAA 2WAWA 4Y7GA 2P72A 1IV3A 1ZJ3A 1ZJOA 4EEGA 3TQDA 1HJLA 4C2SA 1H5SD 4G87A 4HO2A 2OEFA 1VM8A 1XHBA 2MZBA 5J49A 1FWYA 1JY8A 2Z86A 3RMWA 1IV2A 4HO8A 4Y7FA 1ZJ1A 1OMZA 1S4PA 4DE7A 2Z87A 1KNKA 4FCEA 3I0HA 1VHAA 2V0KA 4HO4A 4ECMA 1H4DA 4D48A 1GX0A 1R81A 3D8VA 1VGUA 2VSIA 4DECA 1FXJA 2ICXA 1U3PA 5AJOA 5D91A 1MP5A 4Y62A 3GUEA 4MYBA 1G95A 1ZI5A 4HO5A 2Y4LA 1R7VA 2AE7A 1FO9A 4FRPA 4C8IA 2YQHA 3CKNA 2A8UA 1T0AA 1NF5B 1FXOA 1H5SB 2APCA 3SXCA 4BQHA 4EE5A 3FBAA 1LVWA 3V91A 4P02A 4KC2A 2QH5A 4FROA 1R7XA 1YROB 2E8BA 3PKPA 4YS8A 1QG8A 1ZJPA 3SPTA 4FRLA 1H5TA 3T80A 1HV9A 5C47A 1YQNA 1TVYA 3IEQA 3QVBA 3OH1A 1V84A 1ON8A 2QGIA 4O6MA 3SXAA 2WVKA 3V0NA 5CMJA 5AJNA 1MP3A 1QGSA 3I0DA 1ZDFA 1QWJA 4ASYA 5C4CA 2RITA 3TZTA 4KXOA 5C38A 1K4VA 3EORA 4KPXA 1H48A 1IIMA 5CQLX 1H7FA 1WT0A 3IKEA 2X65A 3E26A 2D7RA 1FR9A 3DK5A 2VXLA 1XZ6A 2NXVA 1GQCA 3FWWA 3V0QA 5EJ1A 2AMTA 2O1GA 2ZU9A 4M2BA 1GWWA 2YQCA 4R7PA 4O6NA 4FRQA 1H5RA 3V0OA 3F0GA 3OH0A 5CMHA 3OC9A 1HM8A 3PKQA 2Y4JA 4HO3A 3V90A 4LW3A 2YESA 2FYAA 3SX3A 4CVHA 4G3PA 3F1YA 5IDSA 3RSBA 2XWNA 4BMAA 1R80A 4B4MA 1I52A 2VFZA 3Q8HA 2GGQA 4AAWA 3BRKX 4M28A 1EZIA 2Q4JA 3IKFA 5DDVA 5C1HA 1JN1A 1VGTA 1OMXA 1FOAA 1GWVA 4J18A 1ZCVA 5C4BA 1LZ7A 3LW6A 4KQLA 1VGWA 3QHDA 2VSHA 5C4DA 3ZLKA 1IINA 3F1CA 2E3DA 3OGZA 3U2WA 1VZUA 4KC1A 3ZLLA 4M4KA 1W57A 3N9WA 1G8OA 5B8FA 1WT2A 1O7OA 1R7YA 3OH2A 1FGXA 4FRHA 4Y6UA 1FRWA 2AH9A 1G93A 1HM9A 1E5KA 1ZDGA 5C36A 2RJ4A 4CJBA 1H47A 2O1FA 1U3LA 2AGDA 3T7NA 3U2TA 5EIYA 4KRVA 3ST8A 2D7IA 3U0YA 1JV1A 1G9RA 2J0AA 3K8EA 2V0HA 3SXBA 2VK9A 5C3AA 3U0XA 3E25A 3SXGA 3Q4SA 2YC5A 5CQPA 1VH1A 4EEAA 1W55A 4CJCA 2YCMA 1H5TB 3CKVA 3I0FA 2OI5A 3I0JA 2RJ8A 4NANA 1NWGB 1GX4A 1H7TA 2JCJA 3IOHA 1WT3A 2BO7A 4B2XA 4MNDA 4LW6A 5CMFX 3I0KA 2WVLA 2FFUA 1VZTA 3I0LA 1VICA 5C1LA 1TW1A 2PMPA 4JD0A 1WVCA 3USQA 1GX1A 3JUKA 1ZIZA 3T7OA 4EE4A 2P6WA 1VGZA 2A8WA 3SX8A 1LL2A 2YC3A 4K6RA 3V0MA 2RIXA 4E1KA 3ELCA 4FRDA 1S4OA 2Y7AA 4HO6A 3SX7A 4Y7TA 2ICYA 4D0TA 2O1HA 2YQSA 1Z90A 2GZLA 1H5RB 4C81A 3B6NA 1KNJA 1ZCYA 4FIXA 3OH4A 1PZYB 4Y7VA 3MBMA 1JVDA 1S4NA 5FTSA 4HG6A 1INJA 5FYEA 1LZJA 5BXCA 4G3QA 5JQQA 5C3BA 4C8GA 4B2WA 1G0RA 5CQMX 4KC4A 2X60A 4B42A 2RIYA 5CQNX 1LZ0A 2PA4A 4M2AA 5I1FA 2OEGA 3T7MA 2GGOA 1VH3A 4KNXA 4G3SA 1JYLA 2VXMA 3V0LA 2RIZA 4FRBA 2DPWA 1INIA 1TZFA 1ON6A 5CQOA 3D98A 2V0IA 2W0VA 4HO9A 5IFYA 1V83A 2OI6A 1YP2A 1YP3A 3I0GA 3FOQA 4Y9XA 3V8ZA 1H4CA 1G23A 2VS3A 4AYLA 5C49A 3DJ4A 4FIYA 4Y63A 1O7QA 1ZI4A 4IRQA 3POLA 3BCVA 1H7GA 3O3PA 5FTVA 2ZU8A 1FG5N 2RJ1A 1H7HA 2V0LA 3K14A 5IDTA 3IOIA 2C0NA 2XMHA 1LL3A 3SXEA 1FGGA 1VH8A 4DDZA 5C3DA 1NQIB 1VPAA 2RJ9A 1ZHJA 3IEWA 2QKXA 1NHEB 2OI7A 4MIXA 2FFVA 4Y6NA 1G3LA 3OKRA 4CJ8A 5C4FA 2JCLA 1O23B 5D92A 5C4EA 1IV1A 3I0CA 4EEOA 2CU2A 1MC3A 1VZXA 1WSZA 4C82A 1PZTA 2BO6A 2VD4A 4B4GA 2I5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCT A;  4HO0 A;  3CKQ A;  3P10 A;  1U40 A;  4P00 A;  3CKJ A;  1H7L A;  2BO4 A;  2JCK A;  3OH3 A;  5FUH A;  1EYR A;  4JIS A;  5EJZ A;  3U2V A;  3P0Z A;  1V82 A;  2PGY A;  3R3I A;  1OQM B;  1H7Q A;  1GA8 A;  5C48 A;  3KIA A;  2UZH A;  3F0F A;  2X5Z A;  3SX5 A;  4D11 A;  1YP4 A;  3Q80 A;  4ARW A;  1R82 A;  3OAM A;  2X5S A;  1HJJ A;  4Y7U A;  4ZDQ A;  2XWM A;  1G1L A;  2UX8 A;  4NAK A;  1R7U A;  2WVM A;  3K2X A;  1HM0 A;  4B5B A;  1TW5 A;  1MP4 A;  4D11 C;  4B3U A;  5CMI A;  3F0D A;  3EE5 A;  3HL3 A;  3SXD A;  3RMV A;  5L6V A;  1H3M A;  1W77 A;  3DUV A;  3JTJ A;  4EE3 A;  4HOC A;  2XME A;  3CGX A;  2D0J A;  4Y64 A;  1G2V A;  2WE9 A;  1KWS A;  4FRE A;  5C1G A;  5FU8 A;  1FR8 A;  3CKO A;  4FRM A;  3V0P A;  1IV4 A;  3V8Y A;  3I0I X;  1H5S A;  4AYJ A;  1ZCU A;  1JV3 A;  5CMG X;  2Y4M A;  1SS9 A;  1LL0 A;  4C8E A;  1ZI1 A;  2RJ0 A;  1R7T A;  2AEC A;  3USR A;  3ERN A;  2AM4 A;  3ESJ A;  2FYC B;  4ASJ A;  5AJP A;  1QGQ A;  4L41 C;  1JYK A;  4GBP A;  3JVH A;  3F0E A;  1GQ9 A;  1G97 A;  4HCQ A;  3IOJ A;  4XWI A;  2WEE A;  2RJ5 A;  2PGV A;  5HS2 A;  1H5S C;  5C8R A;  3CU0 A;  2ZU7 A;  4UEG A;  2FYB A;  2RJ7 A;  1NKH B;  5FV9 A;  1U43 A;  3D5N A;  4KNR A;  1LZI A;  4AC3 A;  1FZW A;  1ZI3 A;  1ZJ2 A;  1NMM B;  2VS4 A;  2Y4K A;  2FYD B;  3NGW A;  1H4E A;  3PNN A;  2AES A;  4KT7 A;  1JVG A;  1O0R A;  3RE3 A;  2FY7 A;  4FQW A;  2I5E A;  3KE1 A;  5FU0 A;  4NAI A;  1H7E A;  2Y6P A;  2W0W A;  3Q7U A;  3R2W A;  3ZGF A;  3JUJ A;  3U2U A;  2WGZ A;  4KPZ A;  1ZJ0 A;  2AM3 A;  2P73 A;  4D0Z A;  4EVW A;  2AM5 A;  2RJ6 A;  5L6S A;  2XWL A;  3F6M A;  1FO8 A;  5DDT A;  4IRP A;  4NAL A;  3FPI A;  2JCO A;  2YQJ A;  1WT1 A;  4FCU A;  2PX7 A;  2V0J A;  2I7B A;  3I0E A;  3GHZ A;  4EEM A;  3ZF8 A;  3ZGG A;  4B4B A;  3K8D A;  2VS5 A;  2BO8 A;  3U2X A;  4FRA A;  2WAW A;  4Y7G A;  2P72 A;  1IV3 A;  1ZJ3 A;  1ZJO A;  4EEG A;  3TQD A;  1HJL A;  4C2S A;  1H5S D;  4G87 A;  4HO2 A;  2OEF A;  1VM8 A;  1XHB A;  2MZB A;  5J49 A;  1FWY A;  1JY8 A;  2Z86 A;  3RMW A;  1IV2 A;  4HO8 A;  4Y7F A;  1ZJ1 A;  1OMZ A;  1S4P A;  4DE7 A;  2Z87 A;  1KNK A;  4FCE A;  3I0H A;  1VHA A;  2V0K A;  4HO4 A;  4ECM A;  1H4D A;  4D48 A;  1GX0 A;  1R81 A;  3D8V A;  1VGU A;  2VSI A;  4DEC A;  1FXJ A;  2ICX A;  1U3P A;  5AJO A;  1MP5 A;  4Y62 A;  3GUE A;  4MYB A;  1G95 A;  1ZI5 A;  4HO5 A;  2Y4L A;  1R7V A;  2AE7 A;  1FO9 A;  4FRP A;  4C8I A;  2YQH A;  3CKN A;  2A8U A;  1T0A A;  1NF5 B;  1FXO A;  1H5S B;  2APC A;  3SXC A;  4BQH A;  4EE5 A;  3FBA A;  1LVW A;  3V91 A;  4P02 A;  4KC2 A;  2QH5 A;  4FRO A;  1R7X A;  1YRO B;  2E8B A;  3PKP A;  4YS8 A;  1QG8 A;  1ZJP A;  3SPT A;  4FRL A;  1H5T A;  3T80 A;  1HV9 A;  5C47 A;  1YQN A;  1TVY A;  3IEQ A;  3QVB A;  3OH1 A;  1V84 A;  1ON8 A;  2QGI A;  3SXA A;  2WVK A;  3V0N A;  5CMJ A;  5AJN A;  1MP3 A;  1QGS A;  3I0D A;  1ZDF A;  1QWJ A;  4ASY A;  5C4C A;  2RIT A;  3TZT A;  4KXO A;  5C38 A;  1K4V A;  3EOR A;  4KPX A;  1H48 A;  1IIM A;  5CQL X;  1H7F A;  1WT0 A;  3IKE A;  2X65 A;  3E26 A;  2D7R A;  1FR9 A;  3DK5 A;  2VXL A;  1XZ6 A;  2NXV A;  1GQC A;  3FWW A;  3V0Q A;  5EJ1 A;  2AMT A;  2O1G A;  2ZU9 A;  4M2B A;  1GWW A;  2YQC A;  4R7P A;  4FRQ A;  1H5R A;  3V0O A;  3F0G A;  3OH0 A;  5CMH A;  3OC9 A;  1HM8 A;  3PKQ A;  2Y4J A;  4HO3 A;  3V90 A;  4LW3 A;  2YES A;  2FYA A;  3SX3 A;  4CVH A;  4G3P A;  3F1Y A;  5IDS A;  3RSB A;  2XWN A;  4BMA A;  1R80 A;  4B4M A;  1I52 A;  2VFZ A;  3Q8H A;  2GGQ A;  4AAW A;  3BRK X;  4M28 A;  1EZI A;  2Q4J A;  3IKF A;  5DDV A;  5C1H A;  1JN1 A;  1VGT A;  1OMX A;  1FOA A;  1GWV A;  4J18 A;  1ZCV A;  5C4B A;  1LZ7 A;  3LW6 A;  4KQL A;  1VGW A;  3QHD A;  2VSH A;  5C4D A;  3ZLK A;  1IIN A;  3F1C A;  2E3D A;  3OGZ A;  3U2W A;  1VZU A;  4KC1 A;  3ZLL A;  4M4K A;  1W57 A;  3N9W A;  1G8O A;  5B8F A;  1WT2 A;  1O7O A;  1R7Y A;  3OH2 A;  1FGX A;  4FRH A;  4Y6U A;  1FRW A;  2AH9 A;  1G93 A;  1HM9 A;  1E5K A;  1ZDG A;  5C36 A;  2RJ4 A;  4CJB A;  1H47 A;  2O1F A;  1U3L A;  2AGD A;  3T7N A;  3U2T A;  5EIY A;  4KRV A;  3ST8 A;  2D7I A;  3U0Y A;  1JV1 A;  1G9R A;  3K8E A;  2V0H A;  3SXB A;  5C3A A;  3U0X A;  3E25 A;  3SXG A;  3Q4S A;  2YC5 A;  5CQP A;  1VH1 A;  4EEA A;  1W55 A;  4CJC A;  2YCM A;  1H5T B;  3CKV A;  3I0F A;  2OI5 A;  3I0J A;  2RJ8 A;  4NAN A;  1NWG B;  1GX4 A;  1H7T A;  2JCJ A;  3IOH A;  1WT3 A;  2BO7 A;  4B2X A;  4MND A;  4LW6 A;  5CMF X;  3I0K A;  2WVL A;  2FFU A;  1VZT A;  3I0L A;  1VIC A;  5C1L A;  1TW1 A;  2PMP A;  4JD0 A;  1WVC A;  3USQ A;  1GX1 A;  3JUK A;  1ZIZ A;  3T7O A;  4EE4 A;  2P6W A;  1VGZ A;  2A8W A;  3SX8 A;  1LL2 A;  2YC3 A;  4K6R A;  3V0M A;  2RIX A;  4E1K A;  3ELC A;  4FRD A;  1S4O A;  2Y7A A;  4HO6 A;  3SX7 A;  4Y7T A;  2ICY A;  4D0T A;  2O1H A;  2YQS A;  1Z90 A;  2GZL A;  1H5R B;  4C81 A;  3B6N A;  1KNJ A;  1ZCY A;  3OH4 A;  1PZY B;  4Y7V A;  3MBM A;  1JVD A;  1S4N A;  5FTS A;  4HG6 A;  1INJ A;  5FYE A;  1LZJ A;  5BXC A;  4G3Q A;  5JQQ A;  5C3B A;  4C8G A;  4B2W A;  1G0R A;  5CQM X;  4KC4 A;  2X60 A;  4B42 A;  2RIY A;  5CQN X;  1LZ0 A;  2PA4 A;  4M2A A;  5I1F A;  2OEG A;  3T7M A;  2GGO A;  1VH3 A;  4KNX A;  4G3S A;  1JYL A;  2VXM A;  3V0L A;  2RIZ A;  4FRB A;  2DPW A;  1INI A;  1TZF A;  1ON6 A;  5CQO A;  3D98 A;  2V0I A;  2W0V A;  4HO9 A;  5IFY A;  1V83 A;  2OI6 A;  1YP2 A;  1YP3 A;  3I0G A;  3FOQ A;  4Y9X A;  3V8Z A;  1H4C A;  1G23 A;  2VS3 A;  4AYL A;  5C49 A;  3DJ4 A;  4Y63 A;  1O7Q A;  1ZI4 A;  4IRQ A;  3POL A;  3BCV A;  1H7G A;  3O3P A;  5FTV A;  2ZU8 A;  1FG5 N;  2RJ1 A;  1H7H A;  2V0L A;  3K14 A;  5IDT A;  3IOI A;  2XMH A;  1LL3 A;  3SXE A;  1FGG A;  1VH8 A;  4DDZ A;  5C3D A;  1NQI B;  1VPA A;  2RJ9 A;  1ZHJ A;  3IEW A;  2QKX A;  1NHE B;  2OI7 A;  2FFV A;  4Y6N A;  1G3L A;  3OKR A;  4CJ8 A;  5C4F A;  2JCL A;  1O23 B;  5C4E A;  1IV1 A;  3I0C A;  4EEO A;  2CU2 A;  2VD4 A;  1MC3 A;  1VZX A;  4C82 A;  1PZT A;  1WSZ A;  2BO6 A;  4B4G A;  2I5K A; 
#chains in the Genus database with same CATH topology
 1ZCT A;  3CKQ A;  1J7H A;  3JAT B;  3CKJ A;  4O4J A;  2BO4 A;  2OZB A;  2R75 1;  1V82 A;  4I4T A;  4C4W C;  3KIA A;  2X5Z A;  4D11 A;  1GZ0 A;  3Q80 A;  1W40 A;  1QVG F;  2Q1Y A;  4WBN B;  3KJJ A;  2UYK A;  1QU9 A;  1R7U A;  1HM0 A;  1TW5 A;  3TD4 A;  1FFX B;  4B3U A;  4ZHV A;  3SXD A;  4X3L A;  1H3M A;  4EE3 A;  2XME A;  4FRE A;  2WE9 A;  1H5S A;  3JAL B;  1ZCU A;  5CMG X;  1LL0 A;  1ONI A;  2I6D A;  3USR A;  3ERN A;  5AJP A;  1QGQ A;  1JYK A;  3MCA B;  1S72 F;  3RYH A;  1QAH A;  2ZVZ A;  4B45 A;  3D5N A;  1ZJ2 A;  2Y4K A;  4I50 B;  1M1K H;  2FY7 A;  2W0W A;  3R2W A;  2WGZ A;  1Z5W A;  5L6S A;  3S0Y A;  2OTJ F;  2YQJ A;  4FCU A;  1VQN F;  4TUY B;  3KJK A;  2I7B A;  3CCU F;  3GHZ A;  1SDS A;  2BO8 A;  5FJ4 C;  2WAW A;  4Y7G A;  1FNJ A;  2P72 A;  4EB6 B;  5FNV B;  1ZJO A;  5KMG A;  3N2K A;  5LYJ B;  4G87 A;  4HO2 A;  4DXD A;  1TUB A;  2MZB A;  1JY8 A;  2Z86 A;  1JFF A;  3LWV C;  3G6E F;  1IV2 A;  4HO8 A;  1ZJ1 A;  3AGK A;  4FCE A;  3I0H A;  5EZY B;  3PAF A;  2IG8 A;  1VHA A;  2V0K A;  1ZWZ A;  4D48 A;  4DEC A;  1FXJ A;  3D00 A;  4Y62 A;  1W5E A;  1G95 A;  1ZI5 A;  2Y4L A;  2AE7 A;  4G4W A;  2G9I A;  2A8U A;  2APC A;  3SXC A;  4BQH A;  5HP7 A;  4YS8 A;  5BMV B;  4HNA A;  3SPT A;  1ZJP A;  4FRL A;  2FGY A;  1H5T A;  3T80 A;  5LA6 B;  3J7A R;  5EIB C;  1V84 A;  2CHT A;  4R40 B;  2WVK A;  5AJN A;  1QWJ A;  5C4C A;  3CPQ A;  4KXO A;  1K4V A;  1H48 A;  2X65 A;  3DK5 A;  1XZ6 A;  3CCE F;  3FWW A;  5EJ1 A;  2W8B C;  2O1G A;  5ITZ B;  3JAW B;  4X3M A;  2HRU A;  1H5R A;  1VQL F;  3F0G A;  3OC9 A;  2BTO A;  4IHJ A;  4BVT A;  3V90 A;  4CVH A;  3I3F A;  4BMA A;  1R80 A;  2GGQ A;  3JAM M;  5EIB D;  2VAM A;  2Q4J A;  5CA0 A;  3VMF B;  3HKE A;  5C1H A;  1RQ7 A;  4BT5 A;  2WAL A;  5IYZ A;  1GWV A;  1ZCV A;  3CYQ A;  3K0T A;  1YIJ F;  5CB4 A;  1NQ3 A;  3OGZ A;  3U2W A;  1R7Y A;  3OH2 A;  4I55 B;  4ERH A;  3WPW A;  1FRW A;  2Z1E A;  1HM9 A;  1FSZ A;  5IJ0 A;  3WJP A;  3U2T A;  3M1X A;  5EYP B;  4PWT A;  1JV1 A;  4ZHY B;  3UT5 B;  3SXB A;  3E25 A;  5EO3 A;  2YC5 A;  1VH1 A;  2BO1 A;  5JQG B;  3CKV A;  3I0J A;  2RJ8 A;  3JAT A;  1H7T A;  5FLX M;  2BO7 A;  3TD5 A;  3ZO8 A;  5CMF X;  4DRX B;  3I0K A;  1VZT A;  3I0L A;  1VIC A;  5C1L A;  4JD0 A;  1VK3 A;  1VQM F;  4EE4 A;  1VGZ A;  3SX8 A;  1LL2 A;  3ELC A;  4WBN A;  4HO6 A;  3E20 B;  4RHA A;  2O1H A;  2YQS A;  1FFX A;  3NK6 A;  3IR9 A;  3HAX D;  1S4N A;  3NK7 A;  4G3Q A;  5JQQ A;  3FD6 A;  5CQN X;  3JAL A;  5HWE A;  2GGO A;  1JYL A;  1W3E X;  2W0V A;  4HO9 A;  1YP3 A;  3I0G A;  5EAZ A;  3JAK A;  5C49 A;  4FIY A;  4Y63 A;  3CME F;  3CCQ F;  3O3P A;  3U0O A;  2YXZ A;  5IDT A;  2XMH A;  4I50 A;  1FGG A;  3V3T A;  2HX0 A;  4O2A B;  3E22 B;  3NVK E;  1G3L A;  2JCL A;  1X7P A;  5D92 A;  3G4S F;  1IV1 A;  3I0C A;  1VZX A;  1WSZ A;  2BO6 A;  3RYF B;  1U40 A;  4TUY A;  1H7L A;  2VXY A;  3OH3 A;  1EYR A;  4EB6 A;  5MN5 A;  5FNV A;  5EJZ A;  3R3I A;  4ZI7 B;  1OQM B;  1GA8 A;  5C48 A;  5LYJ A;  4BT6 A;  4BVR A;  3SX5 A;  2R6R 1;  5LOV B;  4Y7U A;  4ZDQ A;  1N8R H;  2CW4 A;  1G1L A;  5EZY A;  4NAK A;  2MQE A;  2WVM A;  4B5B A;  1MP4 A;  4D11 C;  5GIP C;  5CMI A;  5L6V A;  1W77 A;  3JTJ A;  5FU8 A;  1FR8 A;  4FRM A;  1IV4 A;  3V8Y A;  3I0I X;  4AYJ A;  4C8E A;  3OBW A;  2HS3 A;  1RA4 A;  1QVF F;  3TD3 A;  2AEC A;  2GLZ A;  5BMV A;  2FYC B;  2J0B A;  4L41 C;  3VCZ A;  3JVH A;  5LA6 A;  3IOJ A;  4XWI A;  2ALE A;  1H5S C;  2ZU7 A;  4UEG A;  2FYB A;  4G4V A;  1CN7 A;  1NKH B;  5FV9 A;  3S03 A;  1LZI A;  1XV2 A;  2CVL A;  1H4E A;  3RYC B;  2RHL A;  3PNN A;  4KT7 A;  3L7Q A;  2ZAU A;  4NAI A;  2RB9 A;  2P6Y A;  5AVM A;  3ZGF A;  4KPZ A;  5ITZ A;  1ZJ0 A;  2AM3 A;  3JAW A;  4D0Z A;  2RJ6 A;  2AIZ P;  4Q7C A;  3VYU C;  1FO8 A;  1QD9 A;  2JCO A;  2PHN A;  2HRY A;  2H6L A;  3I0E A;  3ZGG A;  2VS5 A;  3U2X A;  4FRA A;  3CCV F;  4KWE A;  3G71 F;  1H5S D;  3RA5 A;  1XHB A;  4O4I B;  3RYI B;  4X20 B;  5C8Y B;  2Z87 A;  3N2G B;  3K12 A;  3FFM A;  4ZHQ B;  4I55 A;  3D8V A;  4ZK7 A;  1VGU A;  2VSI A;  4TZZ A;  5EYP A;  3S06 A;  1T0A A;  3UT5 A;  1K9M H;  3WGJ A;  2QI2 A;  4P02 A;  4KC2 A;  2QH5 A;  1R7X A;  3PKP A;  1QG8 A;  5JQG A;  5C47 A;  1TVY A;  3OH1 A;  1ON8 A;  3LYB A;  3V7E A;  3SXA A;  5J2T B;  3V0N A;  5MN6 A;  2JNB A;  1QGS A;  3TZT A;  4DRX A;  1WT0 A;  3VTI C;  3S0W A;  2D7R A;  2VXL A;  2NMU A;  1TVK B;  1GQC A;  4G4X A;  2ZU9 A;  1GWW A;  3DDN A;  2YQC A;  1VQ9 F;  1VQ6 F;  3WGK A;  4FRQ A;  3CG6 A;  5EB0 A;  3SX3 A;  2FYA A;  4G3P A;  3F1Y A;  1Q7Y H;  5IDS A;  3CMA F;  4AAW A;  1RQ2 A;  3LFO A;  3VIU A;  1EZI A;  4TV9 B;  3CXC F;  3IKF A;  2L26 A;  5DDV A;  1JN1 A;  1RLG A;  4EI9 A;  1VGT A;  1OMX A;  2VGN A;  4J18 A;  1LZ7 A;  3CCL F;  2AIF A;  3CB2 A;  2Z01 A;  4BVQ A;  3ZLL A;  4M4K A;  3N9W A;  3S0H A;  1G8O A;  1O7O A;  1FGX A;  3MQW A;  5C36 A;  4CJB A;  4ZOL B;  2O1F A;  3U0Y A;  3KHN A;  4O2A A;  3E22 A;  3CD6 F;  3K8E A;  3SXG A;  5HY1 A;  5GIN C;  3RYF A;  4CJC A;  2YCM A;  5HXZ A;  4ZHW A;  2HS0 A;  2LBT A;  2QEX F;  4M8I A;  3NMU C;  4MND A;  3C9S A;  4ZI7 A;  1W42 A;  3V7Q A;  1Q81 H;  2CWJ A;  1WVC A;  3USQ A;  1GX1 A;  3T7O A;  2P6W A;  4X1I B;  5LOV A;  2A8W A;  2YC3 A;  3J81 M;  4K6R A;  2RIX A;  4FRD A;  1S4O A;  4Y7T A;  1X7O A;  4C81 A;  1OAP A;  3WGL A;  5FTS A;  3V4D A;  1INJ A;  5IJ9 B;  1G0R A;  5CQM X;  4B42 A;  2RIY A;  2Z1U A;  4BT4 A;  5HY2 A;  2OEG A;  5GON B;  1VH3 A;  3V0L A;  2HP0 B;  3I56 F;  2DPW A;  4NUT A;  1INI A;  3OBY A;  2V0I A;  2VGM A;  2UYJ A;  3FOQ A;  3RA6 A;  5JVD B;  1ZI4 A;  4IRQ A;  1VQV A;  1W5A A;  2ZU8 A;  1CK2 A;  2RJ1 A;  2V0L A;  3K14 A;  1SA0 B;  3RYC A;  4DDZ A;  5C3D A;  4G4Y A;  1ZHJ A;  3IEW A;  2UYP A;  1GO1 A;  4CJ8 A;  2OTM A;  3OKR A;  4O4J B;  4B4G A;  1MC3 A;  4C82 A;  2I5K A;  3P10 A;  1NMU B;  3WJR A;  1GO0 A;  2CZW A;  5FUH A;  4JIS A;  3KIZ A;  1H7Q A;  4O4L B;  3F0F A;  1R82 A;  1CLI A;  1HJJ A;  4O4I A;  3RYI A;  4X20 A;  5C8Y A;  2UX8 A;  2ZVY A;  3K2X A;  3N2G A;  4ZHQ A;  3OW2 F;  1UFY A;  2EWC A;  2HQS C;  3F0D A;  1K73 H;  2DT4 A;  3RMV A;  1VQP F;  3DUV A;  4HOC A;  3CGX A;  5J2U B;  3VYT C;  1KWS A;  3CKO A;  1VQ8 F;  3V0P A;  4G88 A;  1JV3 A;  1SS9 A;  1ZI1 A;  2RJ0 A;  4O2B B;  4X1Y B;  1R7T A;  4EI7 A;  2AM4 A;  3ESJ A;  4ASJ A;  5LP6 B;  2RJ5 A;  2PGV A;  2IQQ A;  2I6R A;  5J2T A;  3CU0 A;  4BW0 B;  2RJ7 A;  1U43 A;  4KNR A;  1FZW A;  2VS4 A;  1R1M A;  2AES A;  1JVG A;  1O0R A;  3RE3 A;  2V9Y A;  4FQW A;  1TVK A;  1H7E A;  1RLU A;  2Y6P A;  3Q7U A;  3JUJ A;  2P73 A;  1SZQ A;  4EVW A;  2AM5 A;  2Z1T A;  2XWL A;  3F6M A;  5DDT A;  4IRP A;  3FPI A;  3LWP C;  2PX7 A;  3LDT A;  2V0J A;  4EEM A;  5G4V C;  5HY4 A;  3C8L A;  3ZF8 A;  3K8D A;  4B4B A;  2KG4 A;  2KTU A;  4BVS A;  3CC7 F;  5MN4 A;  3VYS C;  2KGW A;  1ZJ3 A;  4C2S A;  4TV9 A;  2OEF A;  1VM8 A;  5J49 A;  1FWY A;  3HKC B;  3RMW A;  4Y7F A;  1S4P A;  1KNK A;  4TV8 B;  1K8A H;  5HXU A;  4ECM A;  1H4D A;  3OON A;  1GX0 A;  1R81 A;  4FFB B;  3LWQ C;  5AJO A;  1U3P A;  4ZOL A;  2F9Z C;  1OFU A;  1R7V A;  1FO9 A;  4FRP A;  4C8I A;  5GAN K;  4LCK A;  1NF5 B;  1FXO A;  4YJ2 B;  3M4S A;  4X1K B;  2E8B A;  1YRO B;  1YQN A;  1KC8 H;  2QA4 F;  1YI2 F;  5EB1 B;  2QGI A;  4U39 A;  5GIO C;  4ASY A;  3CCJ F;  5C38 A;  3EOR A;  4KPX A;  1IIM A;  5CQL X;  4B62 A;  1H7F A;  3IKE A;  1X52 A;  3E26 A;  1XRG A;  3PLA C;  4NWO B;  2NXV A;  4X1I A;  1IPA A;  4U3J B;  3WPX A;  4R7P A;  4O6N A;  2HS4 A;  3OH0 A;  3S02 A;  1HM8 A;  2Y4J A;  4HO3 A;  4LW3 A;  2YES A;  3RSB A;  5DCV A;  2XWN A;  1I52 A;  5IJ9 A;  3BRK X;  5GON A;  2HP0 A;  1KD1 H;  2OHW A;  4BT7 A;  2OTL F;  3LW6 A;  4KQL A;  1W5B A;  3ZLK A;  1IIN A;  5JVD A;  1VZU A;  4KC1 A;  4FRH A;  4YJ3 B;  5JCO A;  2AH9 A;  1SA0 A;  2RJ4 A;  1U3L A;  2AGD A;  5EIY A;  1DBF A;  3LWO C;  1G9R A;  2J0A A;  2V0H A;  2VK9 A;  3Q4S A;  2IAF A;  3NVI B;  3DC2 A;  2N48 A;  3D54 A;  3ZP4 A;  2OI5 A;  4NAN A;  1NWG B;  1GX4 A;  3VOA A;  2JCJ A;  4LW6 A;  1YHQ F;  2YYE A;  4NQ3 A;  2FFU A;  3MDO A;  3CYP B;  1TW1 A;  3P4E A;  4O4L A;  3JUK A;  1ZIZ A;  5HP8 A;  3SX7 A;  2GZL A;  5KX5 B;  3N4Y A;  3B6N A;  5HY0 A;  1ZCY A;  4FIX A;  4Y7V A;  1JVD A;  3CCS F;  3D01 A;  3BYQ A;  5FYE A;  5J2U A;  5C3B A;  4KC4 A;  2X60 A;  1LZ0 A;  3JAK B;  2PA4 A;  4M2A A;  5I1F A;  4O2B A;  4X1Y A;  4IIJ B;  4G3S A;  4LNU B;  2DYY A;  2RIZ A;  1ON6 A;  5CQO A;  4BT2 A;  1PF5 A;  1V83 A;  5LP6 A;  1Q8R A;  3LME A;  2ZOV A;  4Y9X A;  3V8Z A;  2VS3 A;  2UYN B;  3CCR F;  4F6R B;  3DJ4 A;  1VQ5 F;  1PXW A;  3POL A;  5FTV A;  1FG5 N;  1H7H A;  4O4H B;  3C9U A;  4EI8 A;  3IOI A;  2C0N A;  1FNK A;  1NQI B;  1VPA A;  2QKX A;  2LCA A;  1NHE B;  2OI7 A;  2LBX A;  2FFV A;  4G4Z A;  5C4F A;  5JH7 B;  1KQS F;  2CU2 A;  1Q86 H;  1H7M A;  3E1Y A;  4HO0 A;  3HKB B;  3CPW F;  3QTY A;  3JAS B;  4P00 A;  2JCK A;  1X25 A;  3VO8 A;  5LXT B;  1YJW F;  2HVY D;  3U2V A;  3P0Z A;  2PGY A;  2UZH A;  1YP4 A;  4ARW A;  5CA1 B;  3OAM A;  2X5S A;  3HKC A;  2XWM A;  4TV8 A;  3VI6 A;  1VQO F;  3EE5 A;  4FFB A;  3HL3 A;  2Z1F A;  2D0J A;  4Y64 A;  1G2V A;  5C1G A;  2BTU A;  4YJ2 A;  2Y4M A;  4X1K A;  2RHO A;  4GBP A;  3F0E A;  1GQ9 A;  1G97 A;  4HCQ A;  2FC3 A;  2WEE A;  5HS2 A;  1XHO A;  2GVI A;  3ZOP A;  5C8R A;  3HJW C;  3HKD B;  4AC3 A;  2ZOD A;  1ZI3 A;  1NMM B;  3NGW A;  2FYD B;  3JAR B;  3SIU A;  2I5E A;  3KE1 A;  5FU0 A;  3WGN A;  4B5C A;  2VAP A;  4U3J A;  3CC4 F;  3U2U A;  1M90 H;  1W41 A;  4NAL A;  1VQK F;  3VOB A;  1WT1 A;  3WGM A;  3C9T A;  1IV3 A;  1YGY A;  4EEG A;  3TQD A;  1HJL A;  4I4T B;  1ODE A;  5A2Q M;  1W58 1;  4XCQ A;  1OMZ A;  4DE7 A;  3QUW A;  3LWR C;  5GAP K;  4HO4 A;  4YJ3 A;  2ICX A;  5D91 A;  5EWR A;  1MP5 A;  3GUE A;  4MYB A;  4HO5 A;  2B33 A;  2YQH A;  3CKN A;  2H8C A;  1H5S B;  4EE5 A;  3FBA A;  1LVW A;  3V91 A;  4FRO A;  1HV9 A;  3IEQ A;  3QVB A;  3RYH B;  1YJ9 F;  4O6M A;  5CMJ A;  1VQ7 F;  1MP3 A;  1W5F A;  3I0D A;  1ZDF A;  2RIT A;  1YIT F;  1FR9 A;  2VAW A;  2H8E A;  3V0Q A;  2AMT A;  3WJQ A;  4E6E A;  4M2B A;  3C9R A;  5KX5 A;  3V0O A;  5CMH A;  3PKQ A;  3WXM B;  4B4M A;  2VFZ A;  3Q8H A;  1YJN F;  5KMG B;  4M28 A;  3O85 A;  3N2K B;  4IIJ A;  4LNU A;  1E7K A;  1TUB B;  1JJ2 F;  3JCM M;  1JFF B;  2LBW A;  1FOA A;  5C4B A;  1VGW A;  3QHD A;  2VSH A;  5C4D A;  2K1S A;  2UYN A;  3F1C A;  2E3D A;  3GYQ A;  4F6R A;  1W57 A;  5B8F A;  1WT2 A;  4Y6U A;  1G93 A;  4O4H A;  1E5K A;  1ZDG A;  2RHH A;  1H47 A;  3T7N A;  3ZP7 A;  4KRV A;  4B46 A;  3ST8 A;  2D7I A;  3J80 M;  3MCQ A;  5C3A A;  3U0X A;  5JH7 A;  5JCO C;  1NJI H;  5CQP A;  4EEA A;  1W55 A;  4HNA B;  4BT3 A;  1H5T B;  1Z5V A;  3HKB A;  3R0P A;  3JAS A;  3I0F A;  3CC2 F;  3N4Z A;  3I55 F;  2HP3 A;  3IOH A;  5LXT A;  1WT3 A;  4B2X A;  2WVL A;  1COM A;  2PMP A;  3CCM F;  1XBI A;  5CA1 A;  2KTV A;  3FD5 A;  3V0M A;  4E1K A;  4RQO A;  1W2B F;  2Y7A A;  1UI9 A;  2ICY A;  4D0T A;  3IMP A;  1Z90 A;  1H5R B;  1W59 A;  2BTQ B;  1KNJ A;  2CHS A;  3OH4 A;  4IHJ B;  1PZY B;  3MBM A;  2ZF8 A;  4HG6 A;  3I7T A;  1LZJ A;  5BXC A;  4C8G A;  4B2W A;  5G4U C;  3ON1 A;  3T7M A;  4KNX A;  5CA0 B;  3HKE B;  1Q82 H;  2VXM A;  4FRB A;  1TZF A;  3HTN A;  2CSL A;  3D98 A;  1DT9 A;  5IYZ B;  5IFY A;  2OI6 A;  1YP2 A;  2RHJ A;  3GTZ A;  1H4C A;  1G23 A;  4AYL A;  5CB4 B;  1JD1 A;  1O7Q A;  1VQ4 F;  3BCV A;  1H7G A;  3HKD A;  3SIV A;  5LP6 C;  2QTP A;  5IT9 M;  5IJ0 B;  3JAR A;  1LL3 A;  3SXE A;  1VH8 A;  2RJ9 A;  4MIX A;  2Q1X A;  4Y6N A;  1O23 B;  5C4E A;  1T0K B;  4BY9 D;  3HWU A;  4EEO A;  2VD4 A;  1PZT A;  3M84 A; 
#chains in the Genus database with same CATH homology
 1ZCT A;  4HO0 A;  3CKQ A;  3P10 A;  1U40 A;  4P00 A;  3CKJ A;  1H7L A;  2BO4 A;  2JCK A;  3OH3 A;  5FUH A;  1EYR A;  4JIS A;  5EJZ A;  3U2V A;  3P0Z A;  1V82 A;  2PGY A;  3R3I A;  1OQM B;  1H7Q A;  1GA8 A;  5C48 A;  3KIA A;  2UZH A;  3F0F A;  2X5Z A;  3SX5 A;  4D11 A;  1YP4 A;  3Q80 A;  4ARW A;  1R82 A;  3OAM A;  2X5S A;  1HJJ A;  4Y7U A;  4ZDQ A;  2XWM A;  1G1L A;  2UX8 A;  4NAK A;  1R7U A;  2WVM A;  3K2X A;  1HM0 A;  4B5B A;  1TW5 A;  1MP4 A;  4D11 C;  4B3U A;  5CMI A;  3F0D A;  3EE5 A;  3HL3 A;  3SXD A;  3RMV A;  5L6V A;  1H3M A;  1W77 A;  3DUV A;  3JTJ A;  4EE3 A;  4HOC A;  2XME A;  3CGX A;  2D0J A;  4Y64 A;  1G2V A;  2WE9 A;  1KWS A;  4FRE A;  5C1G A;  5FU8 A;  1FR8 A;  3CKO A;  4FRM A;  3V0P A;  1IV4 A;  3V8Y A;  3I0I X;  1H5S A;  4AYJ A;  1ZCU A;  1JV3 A;  5CMG X;  2Y4M A;  1SS9 A;  1LL0 A;  4C8E A;  1ZI1 A;  2RJ0 A;  1R7T A;  2AEC A;  3USR A;  3ERN A;  2AM4 A;  3ESJ A;  2FYC B;  4ASJ A;  2J0B A;  5AJP A;  1QGQ A;  4L41 C;  1JYK A;  4GBP A;  3JVH A;  3F0E A;  1GQ9 A;  1G97 A;  4HCQ A;  3IOJ A;  4XWI A;  2WEE A;  2RJ5 A;  2PGV A;  5HS2 A;  1H5S C;  5C8R A;  3CU0 A;  2ZU7 A;  4UEG A;  2FYB A;  2RJ7 A;  1NKH B;  5FV9 A;  1U43 A;  3D5N A;  4KNR A;  1LZI A;  4AC3 A;  1FZW A;  1ZI3 A;  1ZJ2 A;  1NMM B;  2VS4 A;  2Y4K A;  2FYD B;  3NGW A;  1H4E A;  3PNN A;  2AES A;  4KT7 A;  1JVG A;  1O0R A;  3RE3 A;  2FY7 A;  4FQW A;  2I5E A;  3KE1 A;  5FU0 A;  4NAI A;  1H7E A;  2Y6P A;  2W0W A;  3Q7U A;  3R2W A;  3ZGF A;  3JUJ A;  3U2U A;  2WGZ A;  4KPZ A;  1ZJ0 A;  2AM3 A;  2P73 A;  4D0Z A;  4EVW A;  2AM5 A;  2RJ6 A;  4Q7C A;  5L6S A;  2XWL A;  3F6M A;  1FO8 A;  5DDT A;  4IRP A;  4NAL A;  3FPI A;  2JCO A;  2YQJ A;  1WT1 A;  4FCU A;  2PX7 A;  2V0J A;  2I7B A;  3I0E A;  3GHZ A;  4EEM A;  3ZF8 A;  3ZGG A;  4B4B A;  3K8D A;  2VS5 A;  2BO8 A;  3U2X A;  4FRA A;  2WAW A;  4Y7G A;  2P72 A;  1IV3 A;  1ZJ3 A;  1ZJO A;  4EEG A;  3TQD A;  1HJL A;  4C2S A;  1H5S D;  4G87 A;  4HO2 A;  2OEF A;  1VM8 A;  1XHB A;  2MZB A;  5J49 A;  1FWY A;  1JY8 A;  2Z86 A;  3RMW A;  1IV2 A;  4HO8 A;  4Y7F A;  1ZJ1 A;  1OMZ A;  1S4P A;  4DE7 A;  2Z87 A;  1KNK A;  4FCE A;  3I0H A;  1VHA A;  2V0K A;  4HO4 A;  4ECM A;  1H4D A;  4D48 A;  1GX0 A;  1R81 A;  3D8V A;  1VGU A;  2VSI A;  4DEC A;  1FXJ A;  2ICX A;  1U3P A;  5AJO A;  5D91 A;  1MP5 A;  4Y62 A;  3GUE A;  4MYB A;  1G95 A;  1ZI5 A;  4HO5 A;  2Y4L A;  1R7V A;  2AE7 A;  1FO9 A;  4FRP A;  4C8I A;  2YQH A;  3CKN A;  2A8U A;  1T0A A;  1NF5 B;  1FXO A;  1H5S B;  2APC A;  3SXC A;  4BQH A;  4EE5 A;  3FBA A;  1LVW A;  3V91 A;  4P02 A;  4KC2 A;  2QH5 A;  4FRO A;  1R7X A;  1YRO B;  2E8B A;  3PKP A;  4YS8 A;  1QG8 A;  1ZJP A;  3SPT A;  4FRL A;  1H5T A;  3T80 A;  1HV9 A;  5C47 A;  1YQN A;  1TVY A;  3IEQ A;  3QVB A;  3OH1 A;  1V84 A;  1ON8 A;  2QGI A;  4O6M A;  3SXA A;  2WVK A;  3V0N A;  5CMJ A;  5AJN A;  1MP3 A;  1QGS A;  3I0D A;  1ZDF A;  1QWJ A;  4ASY A;  5C4C A;  2RIT A;  3TZT A;  4KXO A;  5C38 A;  1K4V A;  3EOR A;  4KPX A;  1H48 A;  1IIM A;  5CQL X;  1H7F A;  1WT0 A;  3IKE A;  2X65 A;  3E26 A;  2D7R A;  1FR9 A;  3DK5 A;  2VXL A;  1XZ6 A;  2NXV A;  1GQC A;  3FWW A;  3V0Q A;  5EJ1 A;  2AMT A;  2O1G A;  2ZU9 A;  4M2B A;  1GWW A;  2YQC A;  4R7P A;  4O6N A;  4FRQ A;  1H5R A;  3V0O A;  3F0G A;  3OH0 A;  5CMH A;  3OC9 A;  1HM8 A;  3PKQ A;  2Y4J A;  4HO3 A;  3V90 A;  4LW3 A;  2YES A;  2FYA A;  3SX3 A;  4CVH A;  4G3P A;  3F1Y A;  5IDS A;  3RSB A;  2XWN A;  4BMA A;  1R80 A;  4B4M A;  1I52 A;  2VFZ A;  3Q8H A;  2GGQ A;  4AAW A;  3BRK X;  4M28 A;  1EZI A;  2Q4J A;  3IKF A;  5DDV A;  5C1H A;  1JN1 A;  1VGT A;  1OMX A;  1FOA A;  1GWV A;  4J18 A;  1ZCV A;  5C4B A;  1LZ7 A;  3LW6 A;  4KQL A;  1VGW A;  3QHD A;  2VSH A;  5C4D A;  3ZLK A;  1IIN A;  3F1C A;  2E3D A;  3OGZ A;  3U2W A;  1VZU A;  4KC1 A;  3ZLL A;  4M4K A;  1W57 A;  3N9W A;  1G8O A;  5B8F A;  1WT2 A;  1O7O A;  1R7Y A;  3OH2 A;  1FGX A;  4FRH A;  4Y6U A;  1FRW A;  2AH9 A;  1G93 A;  1HM9 A;  1E5K A;  1ZDG A;  5C36 A;  2RJ4 A;  4CJB A;  1H47 A;  2O1F A;  1U3L A;  2AGD A;  3T7N A;  3U2T A;  5EIY A;  4KRV A;  3ST8 A;  2D7I A;  3U0Y A;  1JV1 A;  1G9R A;  2J0A A;  3K8E A;  2V0H A;  3SXB A;  2VK9 A;  5C3A A;  3U0X A;  3E25 A;  3SXG A;  3Q4S A;  2YC5 A;  5CQP A;  1VH1 A;  4EEA A;  1W55 A;  4CJC A;  2YCM A;  1H5T B;  3CKV A;  3I0F A;  2OI5 A;  3I0J A;  2RJ8 A;  4NAN A;  1NWG B;  1GX4 A;  1H7T A;  2JCJ A;  3IOH A;  1WT3 A;  2BO7 A;  4B2X A;  4MND A;  4LW6 A;  5CMF X;  3I0K A;  2WVL A;  2FFU A;  1VZT A;  3I0L A;  1VIC A;  5C1L A;  1TW1 A;  2PMP A;  4JD0 A;  1WVC A;  3USQ A;  1GX1 A;  3JUK A;  1ZIZ A;  3T7O A;  4EE4 A;  2P6W A;  1VGZ A;  2A8W A;  3SX8 A;  1LL2 A;  2YC3 A;  4K6R A;  3V0M A;  2RIX A;  4E1K A;  3ELC A;  4FRD A;  1S4O A;  2Y7A A;  4HO6 A;  3SX7 A;  4Y7T A;  2ICY A;  4D0T A;  2O1H A;  2YQS A;  1Z90 A;  2GZL A;  1H5R B;  4C81 A;  3B6N A;  1KNJ A;  1ZCY A;  4FIX A;  3OH4 A;  1PZY B;  4Y7V A;  3MBM A;  1JVD A;  1S4N A;  5FTS A;  4HG6 A;  1INJ A;  5FYE A;  1LZJ A;  5BXC A;  4G3Q A;  5JQQ A;  5C3B A;  4C8G A;  4B2W A;  1G0R A;  5CQM X;  4KC4 A;  2X60 A;  4B42 A;  2RIY A;  5CQN X;  1LZ0 A;  2PA4 A;  4M2A A;  5I1F A;  2OEG A;  3T7M A;  2GGO A;  1VH3 A;  4KNX A;  4G3S A;  1JYL A;  2VXM A;  3V0L A;  2RIZ A;  4FRB A;  2DPW A;  1INI A;  1TZF A;  1ON6 A;  5CQO A;  3D98 A;  2V0I A;  2W0V A;  4HO9 A;  5IFY A;  1V83 A;  2OI6 A;  1YP2 A;  1YP3 A;  3I0G A;  3FOQ A;  4Y9X A;  3V8Z A;  1H4C A;  1G23 A;  2VS3 A;  4AYL A;  5C49 A;  3DJ4 A;  4FIY A;  4Y63 A;  1O7Q A;  1ZI4 A;  4IRQ A;  3POL A;  3BCV A;  1H7G A;  3O3P A;  5FTV A;  2ZU8 A;  1FG5 N;  2RJ1 A;  1H7H A;  2V0L A;  3K14 A;  5IDT A;  3IOI A;  2C0N A;  2XMH A;  1LL3 A;  3SXE A;  1FGG A;  1VH8 A;  4DDZ A;  5C3D A;  1NQI B;  1VPA A;  2RJ9 A;  1ZHJ A;  3IEW A;  2QKX A;  1NHE B;  2OI7 A;  4MIX A;  2FFV A;  4Y6N A;  1G3L A;  3OKR A;  4CJ8 A;  5C4F A;  2JCL A;  1O23 B;  5D92 A;  5C4E A;  1IV1 A;  3I0C A;  4EEO A;  2CU2 A;  1MC3 A;  1VZX A;  1WSZ A;  4C82 A;  1PZT A;  2BO6 A;  2VD4 A;  4B4G A;  2I5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...