1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
1H7FA 3I0DA 2D7RA 2UX8A 2I5EA 1NHEB 4MNDA 1NMMB 3U0YA 4HO3A 1R7XA 4HO4A 1MC3A 2GZLA 1INIA 1NQIB 3CU0A 3T7NA 3T7MA 3V90A 3OAMA 3SXDA 1O0RA 2GGOA 3V8ZA 3U0XA 1GA8A 4LW3A 4FRMA 4K6RA 5L6SA 1HJJA 1NF5B 2VSHA 2P6WA 3O3PA 3SXGA 4BQHA 1R7UA 4NAKA 4C2SA 5C1LA 4M2AA 2RJ1A 4FQWA 4EEGA 1H7QA 5C3DA 1ZDFA 1KWSA 2OI6A 4KPZA 5DDTA 2ZU8A 3SXAA 5IDSA 4P00A 1ON6A 4D11C 4BMAA 2I7BA 1ZJ1A 1VH1A 1ZCTA 3V0LA 1O7QA 1TZFA 3OC9A 4DE7A 1VH8A 4ASYA 3JVHA 2AECA 4Y7UA 2RJ7A 1IV2A 1YP3A 2I5KA 1LZJA 1JY8A 3P0ZA 2AMTA 1S4OA 2QH5A 4KQLA 2JCKA 3FWWA 4CJBA 1H4CA 4Y9XA 1VGTA 5C38A 2WVLA 1FOAA 2V0LA 4M2BA 4B2WA 4DDZA 4IRQA 1H48A 1ZJPA 1LL0A 4XWIA 2OI7A 2Q4JA 4C8IA 4FRAA 3QVBA 1EYRA 1H47A 1VGWA 2VFZA 2Y4LA 1R7TA 4HCQA 2FFUA 1ZJ3A 2ZU9A 2FFVA 3U2VA 5I1FA 3SX3A 5B8FA 3E26A 5C1HA 1H4EA 4KPXA 4HOCA 2V0IA 1ZI1A 2YESA 4KNRA 4C8GA 1VHAA 4AC3A 1H7TA 1OMZA 3TQDA 4FCUA 4FCEA 1V82A 1IV3A 2Y4JA 4CJ8A 4FREA 2RJ8A 4G3SA 4Y6NA 1H5RB 5CQOA 3FOQA 3ZLLA 3V0OA 2PA4A 1VZUA 3PKPA 5IDTA 3ESJA 1IINA 2E3DA 2RJ9A 4D0TA 3EORA 5CQMX 1LL2A 4EE3A 4FRQA 1XHBA 3T80A 3OKRA 4KNXA 4J18A 1FR9A 1IIMA 4P02A 4CVHA 1LVWA 1FO9A 1JVGA 1FRWA 1FXOA 2VS5A 3RSBA 4HO8A 4FROA 2WVKA 1NKHB 2PGVA 1ZI5A 4HG6A 2XMEA 3CKVA 2AM5A 4Y7VA 1H4DA 3V0QA 1NWGB 1IV4A 1G95A 2Y6PA 3F1YA 2APCA 3I0KA 2O1FA 2RJ6A 3SX7A 1JYKA 1INJA 2VXLA 3IKFA 1GX0A 2RJ5A 3OH0A 2Y7AA 3DK5A 5EJ1A 1VPAA 4D11A 1EZIA 3IEWA 1G93A 4Y7FA 2GGQA 1LZ7A 3ST8A 1HV9A 4ECMA 4HO6A 1WT1A 3ZGGA 2QKXA 1FR8A 1MP5A 2FY7A 1GQCA 2W0VA 2YQHA 2X60A 4ARWA 4CJCA 4EE4A 4B2XA 1FXJA 4HO9A 2RITA 2RIXA 4NANA 4B4BA 4HO0A 4AYJA 5BXCA 3F6MA 3EE5A 1G97A 1U3PA 3SXCA 1YP4A 2OEFA 1PZYB 4NAIA 5FTSA 2OEGA 5CQLX 1JV3A 1G9RA 5EIYA 3IOHA 1VICA 2JCJA 3N9WA 5C3AA 2MZBA 1FZWA 2AGDA 2WE9A 1QG8A 1WT2A 1WVCA 5C1GA 4KC1A 1ZDGA 1IV1A 4C8EA 2AH9A 4KRVA 4JISA 2PX7A 3OH1A 1GWWA 2XWLA 3Q4SA 1ZCVA 4YS8A 1VZXA 5CMGX 5C47A 1GWVA 1G2VA 5FU0A 1R81A 1ZJOA 5FU8A 3BCVA 1G23A 5AJPA 5C48A 3ZLKA 4G3PA 3K14A 4EVWA 2FYAA 3K2XA 4HO5A 3U2XA 1ZCYA 2BO7A 2AESA 2YC3A 2FYDB 2CU2A 2ICXA 5C3BA 1ZJ0A 3I0EA 4EEAA 1H5SB 3OH3A 3IEQA 1G3LA 1VGUA 2XWNA 2YC5A 4KXOA 1ZI4A 3U2TA 1O7OA 4EEMA 4G87A 1MP3A 4C81A 2RIYA 2AM3A 4FRDA 1MP4A 3CKNA 1R80A 2V0KA 3JUKA 5FTVA 2WGZA 1TVYA 3Q8HA 2JCLA 5C8RA 2BO8A 4B3UA 4G3QA 2V0JA 3Q80A 4B5BA 3PKQA 1H5RA 1H7EA 3ZF8A 4GBPA 1K4VA 2O1HA 1ZJ2A 4NALA 3P10A 5CMJA 1H5SD 3ERNA 3SXEA 4B4MA 1HM0A 2YQCA 1H7LA 2A8WA 4Y7TA 2OI5A 1H7HA 1FO8A 2ZU7A 3R3IA 5CQPA 3ZGFA 5JQQA 1H5SC 3I0CA 4Y64A 4Y7GA 3K8DA 2QGIA 4DECA 4Y63A 2P72A 2WEEA 2D0JA 3IKEA 3R2WA 5FUHA 3GHZA 2V0HA 3ELCA 4AAWA 3CKQA 4E1KA 4AYLA 3RMWA 3NGWA 4M4KA 1HM8A 3FBAA 4ZDQA 3F1CA 5AJNA 3KIAA 1FGXA 3U2UA 3RE3A 5J49A 4R7PA 2ICYA 2Y4KA 3D98A 3F0DA 1E5KA 1VH3A 2YCMA 1WT3A 4B42A 1KNJA 3SX8A 1GX4A 3TZTA 5C4BA 2FYBA 2X5SA 1VZTA 5CMHA 3T7OA 1SS9A 1JVDA 3E25A 4Y6UA 1V84A 3V8YA 1G1LA 1YP2A 1YQNA 4FRLA 3IOJA 1H5TB 3OGZA 2VD4A 1H3MA 5C36A 4C82A 5FV9A 2D7IA 2E8BA 4M28A 3F0FA 1ZCUA 2RIZA 1ZIZA 1PZTA 2PMPA 5C49A 2VS3A 2VXMA 3SXBA 4D48A 1ON8A 1QGQA 4FRBA 3U2WA 1H5TA 3POLA 5C4EA 2X5ZA 1LZIA 3SX5A 2AM4A 2XMHA 2YQSA 3CGXA 2RJ0A 4KT7A 1T0AA 2O1GA 5CQNX 1VGZA 3B6NA 3BRKX 1ZI3A 3DUVA 2A8UA 4D0ZA 3SPTA 1KNKA 2P73A 4IRPA 2FYCB 1LL3A 4FRPA 3CKOA 1FWYA 1HM9A 3USRA 5IFYA 2VSIA 1OMXA 3V0PA 3V0NA 2AE7A 4EE5A 2UZHA 2Z86A 3I0HA 5HS2A 1TW1A 3LW6A 3F0GA 1JYLA 2JCOA 2X65A 2Z87A 5FYEA 3F0EA 2WVMA 5C4CA 1G8OA 3HL3A 3OH2A 1LZ0A 5EJZA 1S4PA 3I0LA 1H5SA 1GQ9A 2BO6A 1R7VA 1YROB 3K8EA 1H7GA 1QGSA 2BO4A 1WSZA 1XZ6A 2NXVA 3FPIA 1JV1A 1R82A 1S4NA 4MYBA 5C4FA 1TW5A 2PGYA 3V91A 4JD0A 4L41C 3OH4A 5AJOA 5C4DA 3JTJA 1FG5N 4LW6A 3I0GA 1U43A 3D8VA 3DJ4A 1QWJA 2DPWA 2XWMA 4UEGA 2VS4A 5L6VA 1HJLA 3I0FA 2RJ4A 3USQA 1ZHJA 1U3LA 3JUJA 5DDVA 1VM8A 1W57A 1G0RA 3V0MA 1OQMB 1W55A 3Q7UA 3RMVA 4ASJA 4KC4A 1I52A 1WT0A 3IOIA 1JN1A 4Y62A 4B4GA 4EEOA 4HO2A 1GX1A 3D5NA 4FRHA 3KE1A 3I0JA 5CMIA 2WAWA 2YQJA 1W77A 1O23B 3PNNA 1Z90A 1R7YA 3I0IX 1V83A 2W0WA 5CMFX 3GUEA 3CKJA 3QHDA 4KC2A 2Y4MA 1FGGA 1U40A 3MBMA
chains in the Genus database with same CATH superfamily
2L26A 4HO4A 1MC3A 2GZLA 1INIA 3T7MA 2GGOA 4K6RA 1HJJA 4Q7CA 3SXGA 1TVKA 2RJ1A 4FQWA 1W2BF 1W5EA 1ZDFA 4KPZA 1ON6A 4D11C 1ZCTA 3E1YA 2AECA 3CD6F 5J2UB 1X25A 4PWTA 4BT4A 4CJBA 3VOAA 5EZYB 1FOAA 2V0LA 4M2BA 2Z01A 4XWIA 5FJ4C 1EYRA 4HCQA 1R7TA 3M4SA 1RQ7A 2FFVA 2EWCA 3SX3A 3E26A 1KC8H 4C8GA 1H7TA 1OMZA 3I3FA 4FCUA 3L7QA 4CJ8A 2H6LA 3HWUA 1Q82H 4G3SA 3E20B 2PA4A 3PKPA 3K0TA 4EB6A 3CCLF 1N8RH 1IINA 2RJ9A 4I55A 4EE3A 3OKRA 4KNXA 1KD1H 4TV8B 1IIMA 5KMGB 4X1IA 1JVGA 3JATA 5CA0A 1NKHB 2PGVA 3V0QA 5IJ9B 3BYQA 1JYKA 1INJA 4IIJB 2Q1XA 1VQVA 2VXLA 1GX0A 3D01A 3IEWA 2GGQA 3ST8A 1HV9A 4HO6A 3ZGGA 2QKXA 1FR8A 2H8CA 3VYSC 5LXTB 3CCSF 4O4IB 3RYCB 4O2BB 3SXCA 1PZYB 2BTUA 5CQLX 1VICA 2HP3A 2B33A 3FFMA 3N9WA 2RHHA 2MZBA 2AGDA 3SIUA 4X1YA 3K12A 1WVCA 5KX5B 4C8EA 4KRVA 4JISA 2CHSA 3CB2A 5C47A 5FU0A 2WALA 1YITF 5FU8A 1TUBB 1G23A 2ZAUA 4ZHVA 3ZLKA 1YI2F 4HO5A 3U2XA 4I50A 1VQNF 4DRXB 4EEAA 3OH3A 2YYEA 3D54A 4EI8A 5G4VC 3WJRA 4KXOA 1ZI4A 3UT5B 4C81A 2AM3A 1W40A 1MP4A 2QA4F 3R0PA 4X1KB 4ZHQA 2JCLA 2UYKA 3O85A 4B5BA 5JCOC 4BT7A 1ZJ2A 3MDOA 3P10A 1QD9A 1H5SD 3ERNA 3SXEA 1HM0A 5BMVA 2A8WA 4Y7TA 2ZU7A 3R3IA 4ZOLB 4Y64A 5HY4A 3S02A 2P72A 1W5FA 4TUYA 3GHZA 5FUHA 3SIVA 4TV9B 4M4KA 4G4YA 5LYJB 3RE3A 3D98A 1E5KA 1VH3A 1WT3A 2FYBA 2HRUA 5JVDA 4ZHWA 3RYIA 2KG4A 3LWQC 1JVDA 5IYZB 4O6MA 3V8YA 2QEXF 1YQNA 5IJ0B 1H5TB 4TZZA 2D7IA 2E8BA 3HKEA 3VCZA 5C8YB 5LA6B 5C49A 2VS3A 3SXBA 1SA0B 4B62A 3POLA 5C4EA 3NVIB 2W8BC 3LWVC 4LNUA 3TD4A 5FNVA 1GZ0A 1JFFA 3SPTA 1FFXA 1HM9A 2VSIA 1OMXA 4EE5A 2UZHA 2YXZA 2Z86A 3VYTC 1TW1A 5FYEA 5C4CA 2AIZP 2VK9A 1S4PA 3I0LA 1UI9A 1H5SA 1H7GA 3J81M 2NXVA 1JV1A 1R82A 1S4NA 3NK7A 4X20A 5LP6C 1VQMF 4JD0A 4L41C 5AJOA 5C4DA 3JTJA 3I0GA 1U43A 3MCQA 1HJLA 5DDVA 3LYBA 3CMEF 3HKBA 1W55A 1VQ6F 4KC4A 3WPWA 2ZVZA 4FFBA 4Y62A 4HO2A 5CMIA 3CYPB 2BTQB 2IQQA 2LCAA 3CC2F 1R7YA 3GUEA 4XCQA 3CCVF 1FGGA 1H7FA 3I0DA 2D7RA 2UX8A 1K73H 1NMMB 3U0YA 5EWRA 2ZVYA 5GIPC 1X7PA 4U3JB 3IMPA 2R751 3SXDA 3V8ZA 3U0XA 2VSHA 2OHWA 2P6WA 3O3PA 5C1LA 5EIBD 5CB4B 1NJIH 3OW2F 4BVQA 5IDSA 2CHTA 2I7BA 1ZJ1A 1O7QA 1VH8A 4ASYA 3JVHA 1Z5VA 2RJ7A 1YP3A 3VYUC 5MN4A 1LZJA 2JCKA 3FWWA 4Y9XA 1FNJA 5C38A 1YHQF 2WVLA 5J2UA 3S03A 4B2WA 4DDZA 1ZJPA 2CWJA 3QVBA 1QU9A 1ZJ3A 4ZHYB 5I1FA 5EZYA 5B8FA 5GAPK 1H4EA 4KPXA 1V82A 2GVIA 5CA1B 1W41A 5CQOA 5HP7A 3V0OA 1VZUA 3ESJA 2HRYA 3C9TA 5ITZB 1FR9A 3VTIC 4CVHA 1FXOA 2VS5A 2HP0B 2WVKA 1ZI5A 2XMEA 1CN7A 1H4DA 4TV8A 3F1YA 2Y6PA 3I0KA 2APCA 5HY0A 3IKFA 2Y7AA 3DK5A 1NQ3A 2HS0A 4DXDA 1VPAA 3JAWB 3CXCF 1XRGA 5IJ9A 4IIJA 2FY7A 1MP5A 1GQCA 2X60A 2ZOVA 3OONA 4HO9A 2RITA 5AVMA 4HO0A 3AGKA 1G97A 3G6EF 4O4IA 3RYCA 1YP4A 4NAIA 3C9UA 2VXYA 5EIYA 2LBWA 2JCJA 1FZWA 4O2AB 4O2BA 1QG8A 5C1GA 4KC1A 1ZDGA 1IV1A 2IAFA 1X52A 3HKCB 1VQOF 2XWLA 3Q4SA 4YS8A 1VZXA 1GWVA 4BT3A 5EB0A 1R81A 4O4JA 3BCVA 5AJPA 4X3MA 5KX5A 4EVWA 3MCAB 2BO7A 2AESA 2I6RA 3I7TA 2RHLA 5J2TA 1TUBA 2XWNA 4O4LB 2GLZA 3U2TA 5JQGB 4EEMA 1K9MH 1VQ9F 1VQ5F 2MQEA 5FTVA 2VAMA 4DRXA 1TVYA 3LWOC 3PAFA 2V0JA 3PKQA 1H5RA 3JARB 3ZF8A 2OTMA 2DYYA 1K4VA 2V9YA 4NALA 4X1KA 5CMJA 1XHOA 4B4MA 1H7LA 4F6RB 1Q8RA 3RYFA 2KGWA 3ON1A 4BT6A 1JD1A 3I0CA 5G4UC 4I4TA 3J80M 4O6NA 4Y7GA 3S0WA 3K8DA 1RA4A 4Y63A 2D0JA 3R2WA 2V0HA 3ELCA 3KJKA 3CKQA 3RMWA 4ZOLA 4NUTA 1VQKF 3FBAA 3M1XA 1GO1A 4R7PA 1H7MA 5JH7A 4B42A 1KNJA 4TV9A 1GX4A 5C4BA 5LYJA 2X5SA 4HNAB 3T7OA 5HY2A 1SS9A 3E25A 4Y6UA 2FC3A 4LCKA 1YP2A 3QUWA 3FD5A 3N2GB 3PLAC 2HX0A 4NWOB 4C82A 1COMA 1ZCUA 1ZIZA 5IYZA 2PMPA 2NMUA 1XV2A 4D48A 5IJ0A 3U2WA 1H5TA 4ZK7A 5EIBC 4KT7A 2YQSA 2RJ0A 1T0AA 2O1GA 5CQNX 5C8YA 1VGZA 3B6NA 3BRKX 1E7KA 5LA6A 1SA0A 1KNKA 2P73A 4IRPA 5GONA 1LL3A 3CKOA 3N2KA 5IFYA 1X7OA 3ZOPA 5HXUA 5HS2A 2OZBA 1JYLA 2JCOA 2Z87A 4G4WA 3F0EA 1G8OA 1YJNF 5IT9M 2CZWA 5MN5A 4BW0B 4YJ2A 2BO4A 4EB6B 4I55B 1TW5A 3V91A 3OH4A 2VAPA 4LW6A 3CYQA 1QWJA 2XWMA 4M8IA 5EAZA 2RJ4A 3USQA 3CCMF 1OQMB 3RMVA 4BT2A 2UYNB 3D00A 3WGJA 4EEOA 1M90H 3KE1A 3V3TA 2IG8A 2YQJA 1CK2A 1O23B 3PNNA 3CCQF 3I0IX 1R1MA 3QHDA 1U40A 3MBMA 2RHOA 2I5EA 1NHEB 4MNDA 3E22B 2LBTA 1NQIB 3RYHA 5MN6A 3CU0A 3V90A 1O0RA 1W59A 3NVKE 4FRMA 5L6SA 1NF5B 4BQHA 1R7UA 4NAKA 4C2SA 2I6DA 4B45A 2HQSC 1W3EX 3ZO8A 4EEGA 1H7QA 5C3DA 1KWSA 2OI6A 1FSZA 4X1YB 3GYQA 4BMAA 5LP6B 1VH1A 3V0LA 1TZFA 3OC9A 3TD3A 5CB4A 2UYPA 3CCUF 3J7AR 1JY8A 3V4DA 3P0ZA 3WJPA 1LL0A 5GANK 1K8AH 4ZI7B 3JASA 4FRAA 1VGWA 1SDSA 2ZF8A 2FFUA 5FLXM 2P6YA 3WXMB 4RHAA 3C8LA 1VHAA 3KJJA 3TQDA 4ZHQB 4BVSA 4FCEA 3FD6A 3LWPC 4YJ3B 3S06A 1VK3A 3FOQA 5EYPB 2E3DA 4D0TA 3EORA 5CQMX 3T80A 4J18A 3JALB 1LVWA 1FO9A 1FRWA 4EI7A 4HG6A 3CKVA 4Y7VA 1IV4A 1G95A 2HP0A 2RJ5A 3OH0A 5EJ1A 5EO3A 4D11A 1G93A 4WBNB 4Y7FA 1LZ7A 5HP8A 2OTLF 1WT1A 4RQOA 3CPWF 4ARWA 4CJCA 4B2XA 3JAWA 4EI9A 5BXCA 3F6MA 3EE5A 3N4YA 3HKEB 4G4ZA 2OEGA 3N4ZA 4G4XA 3V7EA 1JV3A 3IOHA 3VOBA 2Z1TA 1OFUA 2PX7A 3OH1A 3JAKB 1GWWA 1ZCVA 1G2VA 4NQ3A 1RQ2A 3CC7F 1ZJOA 4O2AA 2J0BA 4X3LA 3HKCA 3LWRC 2FYAA 3K2XA 4FIYA 2Q1YA 2CSLA 2YC3A 3JCMM 1PF5A 2FYDB 2CU2A 2R6R1 2ICXA 1NMUB 1ZJ0A 3I0EA 1H5SB 1G3LA 1VGUA 3QTYA 2YC5A 4O4HB 1O7OA 4G87A 4X20B 2PHNA 1XBIA 4IHJB 1R80A 2Z1FA 2V0KA 3VIUA 4KWEA 4G3QA 3Q80A 5JQGA 1KQSF 2O1HA 3HKBB 3CMAF 3WGLA 2J0AA 2OI5A 1H7HA 5KMGA 3WGKA 3RA5A 5JQQA 1H5SC 2UYJA 2OTJF 3HKDB 3IKEA 4AYLA 1ZWZA 3HJWC 3NGWA 1HM8A 4ZDQA 3KIAA 1FGXA 2ICYA 3F0DA 3LFOA 3TZTA 1W5BA 5LXTA 2K1SA 1V84A 2Z1UA 1ODEA 3OGZA 5C36A 4HNAA 5FV9A 1FNKA 1QVFF 5EB1B 1PZTA 2VXMA 1ON8A 1QGQA 1OAPA 3N2GA 2X5ZA 1LZIA 3SX5A 1ZI3A 3DUVA 1Q86H 4BY9D 2A8UA 2CVLA 5JCOA 4FRPA 3USRA 5LOVB 2AE7A 3NMUC 3CCEF 3I0HA 3LW6A 1SZQA 3WGNA 3HL3A 3OH2A 1QAHA 2QI2A 1GQ9A 4BT5A 2BO6A 1R7VA 1YROB 2RB9A 1QGSA 1XZ6A 5C4FA 3UT5A 1FG5N 3D8VA 4ERHA 3DJ4A 2DPWA 3VO8A 3HTNA 3I0FA 1T0KB 3LDTA 2JNBA 1W57A 1G0RA 3V0MA 3WPXA 3VMFB 3I56F 2F9ZC 3I55F 3IOIA 4B4GA 3NK6A 1GX1A 4FRHA 2WAWA 1W77A 1DT9A 2UYNA 1Z90A 4BVRA 3DDNA 2W0WA 5CMFX 3CC4F 5HXZA 4KC2A 2Y4MA 1VQ7F 1TVKB 4HO3A 1R7XA 2VGNA 3T7NA 2KTUA 3OBWA 3OAMA 4G4VA 3C9RA 3LMEA 1GA8A 4LW3A 2Z1EA 4FIXA 1QVGF 3E22A 3CCRF 4M2AA 5DDTA 2ZU8A 3SXAA 4P00A 3VI6A 4C4WC 4DE7A 3MQWA 1CLIA 4Y7UA 1IV2A 2I5KA 1J7HA 4O4JB 2BO1A 2AMTA 1S4OA 2QH5A 4KQLA 3WGMA 1H4CA 5LP6A 1VGTA 3OBYA 4IRQA 1H48A 5J2TB 2OI7A 2Q4JA 4C8IA 1H47A 2VFZA 2Y4LA 2VGMA 2ZU9A 1YJWF 1UFYA 3U2VA 5C1HA 1Z5WA 4HOCA 2V0IA 1ZI1A 2LBXA 2YESA 2ZODA 4KNRA 4AC3A 4ZI7A 2DT4A 1IV3A 1DBFA 2Y4JA 4FREA 3ZP7A 2RJ8A 4Y6NA 1H5RB 2ALEA 3ZLLA 2C0NA 4X1IB 5IDTA 3RA6A 3JATB 5CA0B 1LL2A 4FRQA 4YJ3A 1XHBA 3RYFB 2HS3A 4P02A 1RLUA 3RSBA 4HO8A 5EYPA 4FROA 4I4TB 1Q81H 2AM5A 1NWGB 3SX7A 3JALA 2O1FA 2RJ6A 3CPQA 1M1KH 1EZIA 2H8EA 5JH7B 4ECMA 3S0YA 2W0VA 2YQHA 4EE4A 5A2QM 2RHJA 1FXJA 2HS4A 3P4EA 4WBNA 2RIXA 4NANA 4B4BA 4AYJA 4U3JA 2BTOA 4E6EA 1U3PA 2OEFA 5FTSA 2QTPA 1G9RA 1W581 1VQ4F 5C3AA 1VQPF 2WE9A 1WT2A 5GINC 2AH9A 2VAWA 3JAMM 5GONB 4I50B 5CMGX 3C9SA 2G9IA 3N2KB 5HY1A 5C48A 4G3PA 2N48A 3K14A 3JAKA 1ZCYA 3ZP4A 1W42A 1ONIA 5C3BA 2AIFA 3IEQA 4YJ2B 3U0OA 1MP3A 2RIYA 4FRDA 3CKNA 3JUKA 1S72F 2WGZA 3Q8HA 5C8RA 2BO8A 4B3UA 1Q7YH 5BMVB 4O4HA 3KHNA 5CA1A 1YGYA 1H7EA 5GIOC 4GBPA 4IHJA 2YQCA 1IPAA 5ITZA 3TD5A 4TUYB 1FO8A 5CQPA 4G88A 3ZGFA 4MIXA 2QGIA 4DECA 1PXWA 4BVTA 2WEEA 1JJ2F 4AAWA 1W5AA 4E1KA 3F1CA 5AJNA 5JVDB 3U2UA 3HKDA 3RYIB 3RYHB 5J49A 2Y4KA 2YCMA 3SX8A 4B5CA 3GTZA 1VZTA 5CMHA 1G1LA 4FRLA 3IOJA 2VD4A 1H3MA 1GO0A 3HAXD 4M28A 3F0FA 4LNUB 5FNVB 2RIZA 1JFFB 4FRBA 1FFXB 3M84A 2AM4A 4R40B 2XMHA 3CGXA 5D92A 2CW4A 2KTVA 5D91A 3CCJF 4D0ZA 3JASB 2HVYD 2FYCB 3KIZA 1FWYA 3V0PA 3V0NA 3F0GA 1RLGA 2X65A 4U39A 2WVMA 1YJ9F 5LOVA 1LZ0A 5EJZA 1VQ8F 3DC2A 3K8EA 3IR9A 4O4LA 5DCVA 1WSZA 3FPIA 4MYBA 2PGYA 5HWEA 4UEGA 2VS4A 4FFBB 5L6VA 1ZHJA 2FGYA 1U3LA 3G4SF 3JARA 3JUJA 1VM8A 3V7QA 4B46A 1YIJF 3Q7UA 4ASJA 1I52A 1WT0A 4F6RA 1JN1A 3D5NA 3I0JA 1VQLF 3CG6A 3S0HA 1V83A 3WJQA 3G71F 3CKJA
chains in the Genus database with same CATH topology
1H7FA 3I0DA 2D7RA 2UX8A 2I5EA 1NHEB 4MNDA 1NMMB 3U0YA 4HO3A 1R7XA 4HO4A 1MC3A 2GZLA 1INIA 1NQIB 3CU0A 3T7NA 3T7MA 3V90A 3OAMA 3SXDA 1O0RA 2GGOA 3V8ZA 3U0XA 1GA8A 4LW3A 4FRMA 4K6RA 5L6SA 4FIXA 1HJJA 1NF5B 2VSHA 2P6WA 3O3PA 4Q7CA 3SXGA 4BQHA 1R7UA 4NAKA 4C2SA 5C1LA 4M2AA 2RJ1A 4FQWA 4EEGA 1H7QA 5C3DA 1ZDFA 1KWSA 2OI6A 4KPZA 5DDTA 2ZU8A 3SXAA 5IDSA 4P00A 1ON6A 4D11C 4BMAA 2I7BA 1ZJ1A 1VH1A 1ZCTA 3V0LA 1O7QA 1TZFA 3OC9A 4DE7A 1VH8A 4ASYA 3JVHA 2AECA 4Y7UA 2RJ7A 1IV2A 1YP3A 2I5KA 1LZJA 1JY8A 3P0ZA 2AMTA 1S4OA 2QH5A 4KQLA 2JCKA 3FWWA 4CJBA 1H4CA 4Y9XA 1VGTA 5C38A 2WVLA 1FOAA 2V0LA 4M2BA 4B2WA 4DDZA 4IRQA 1H48A 1ZJPA 1LL0A 4XWIA 2OI7A 2Q4JA 4C8IA 4FRAA 3QVBA 1EYRA 1H47A 1VGWA 2VFZA 2Y4LA 1R7TA 4HCQA 2FFUA 1ZJ3A 2ZU9A 2FFVA 3U2VA 5I1FA 3SX3A 5B8FA 3E26A 5C1HA 1H4EA 4KPXA 4HOCA 2V0IA 1ZI1A 2YESA 4KNRA 4C8GA 1VHAA 4AC3A 1H7TA 1OMZA 3TQDA 4FCUA 4FCEA 1V82A 1IV3A 2Y4JA 4CJ8A 4FREA 2RJ8A 4G3SA 4Y6NA 1H5RB 5CQOA 3FOQA 3ZLLA 3V0OA 2PA4A 2C0NA 1VZUA 3PKPA 5IDTA 3ESJA 1IINA 2E3DA 2RJ9A 4D0TA 3EORA 5CQMX 1LL2A 4EE3A 4FRQA 1XHBA 3T80A 3OKRA 4KNXA 4J18A 1FR9A 1IIMA 4P02A 4CVHA 1LVWA 1FO9A 1JVGA 1FRWA 1FXOA 2VS5A 3RSBA 4HO8A 4FROA 2WVKA 1NKHB 2PGVA 1ZI5A 4HG6A 2XMEA 3CKVA 2AM5A 4Y7VA 1H4DA 3V0QA 1NWGB 1IV4A 1G95A 2Y6PA 3F1YA 2APCA 3I0KA 2O1FA 2RJ6A 3SX7A 1JYKA 1INJA 2VXLA 3IKFA 1GX0A 2RJ5A 3OH0A 2Y7AA 3DK5A 5EJ1A 1VPAA 4D11A 1EZIA 3IEWA 1G93A 4Y7FA 2GGQA 1LZ7A 3ST8A 1HV9A 4ECMA 4HO6A 1WT1A 3ZGGA 2QKXA 1FR8A 1MP5A 2FY7A 1GQCA 2W0VA 2YQHA 2X60A 4ARWA 4CJCA 4EE4A 4B2XA 1FXJA 4HO9A 2RITA 2RIXA 4NANA 4B4BA 4HO0A 4AYJA 5BXCA 3F6MA 3EE5A 1G97A 1U3PA 3SXCA 1YP4A 2OEFA 1PZYB 4NAIA 5FTSA 2OEGA 5CQLX 1JV3A 1G9RA 5EIYA 3IOHA 1VICA 2JCJA 3N9WA 5C3AA 2MZBA 1FZWA 2AGDA 2WE9A 1QG8A 1WT2A 1WVCA 5C1GA 4KC1A 1ZDGA 1IV1A 4C8EA 2AH9A 4KRVA 4JISA 2PX7A 3OH1A 1GWWA 2XWLA 3Q4SA 1ZCVA 4YS8A 1VZXA 5CMGX 5C47A 1GWVA 1G2VA 5FU0A 1R81A 1ZJOA 5FU8A 2J0BA 3BCVA 1G23A 5AJPA 5C48A 3ZLKA 4G3PA 3K14A 4EVWA 2FYAA 3K2XA 4FIYA 4HO5A 3U2XA 1ZCYA 2BO7A 2AESA 2YC3A 2FYDB 2CU2A 2ICXA 5C3BA 1ZJ0A 3I0EA 4EEAA 1H5SB 3OH3A 3IEQA 1G3LA 1VGUA 2XWNA 2YC5A 4KXOA 1ZI4A 3U2TA 1O7OA 4EEMA 4G87A 1MP3A 4C81A 2RIYA 2AM3A 4FRDA 1MP4A 3CKNA 1R80A 2V0KA 3JUKA 5FTVA 2WGZA 1TVYA 3Q8HA 2JCLA 5C8RA 2BO8A 4B3UA 4G3QA 2V0JA 3Q80A 4B5BA 3PKQA 1H5RA 1H7EA 3ZF8A 4GBPA 1K4VA 2O1HA 1ZJ2A 4NALA 3P10A 5CMJA 1H5SD 3ERNA 3SXEA 4B4MA 1HM0A 2YQCA 1H7LA 2A8WA 2J0AA 4Y7TA 2OI5A 1H7HA 1FO8A 2ZU7A 3R3IA 5CQPA 3ZGFA 5JQQA 1H5SC 3I0CA 4Y64A 4O6NA 4Y7GA 3K8DA 4MIXA 2QGIA 4DECA 4Y63A 2P72A 2WEEA 2D0JA 3IKEA 3R2WA 5FUHA 3GHZA 2V0HA 3ELCA 4AAWA 3CKQA 4E1KA 4AYLA 3RMWA 3NGWA 4M4KA 1HM8A 3FBAA 4ZDQA 3F1CA 5AJNA 3KIAA 1FGXA 3U2UA 3RE3A 5J49A 4R7PA 2ICYA 2Y4KA 3D98A 3F0DA 1E5KA 1VH3A 2YCMA 1WT3A 4B42A 1KNJA 3SX8A 1GX4A 3TZTA 5C4BA 2FYBA 2X5SA 1VZTA 5CMHA 3T7OA 1SS9A 1JVDA 3E25A 4Y6UA 1V84A 4O6MA 3V8YA 1G1LA 1YP2A 1YQNA 4FRLA 3IOJA 1H5TB 3OGZA 2VD4A 1H3MA 5C36A 4C82A 5FV9A 2D7IA 2E8BA 4M28A 3F0FA 1ZCUA 2RIZA 1ZIZA 1PZTA 2PMPA 5C49A 2VS3A 2VXMA 3SXBA 4D48A 1ON8A 1QGQA 4FRBA 3U2WA 1H5TA 3POLA 5C4EA 2X5ZA 1LZIA 3SX5A 2AM4A 2XMHA 2YQSA 3CGXA 2RJ0A 4KT7A 5D92A 1T0AA 2O1GA 5CQNX 1VGZA 3B6NA 3BRKX 1ZI3A 3DUVA 5D91A 2A8UA 4D0ZA 3SPTA 1KNKA 2P73A 4IRPA 2FYCB 1LL3A 4FRPA 3CKOA 1FWYA 1HM9A 3USRA 5IFYA 2VSIA 1OMXA 3V0PA 3V0NA 2AE7A 4EE5A 2UZHA 2Z86A 3I0HA 5HS2A 1TW1A 3LW6A 3F0GA 1JYLA 2JCOA 2X65A 2Z87A 5FYEA 3F0EA 2WVMA 5C4CA 1G8OA 2VK9A 3HL3A 3OH2A 1LZ0A 5EJZA 1S4PA 3I0LA 1H5SA 1GQ9A 2BO6A 1R7VA 1YROB 3K8EA 1H7GA 1QGSA 2BO4A 1WSZA 1XZ6A 2NXVA 3FPIA 1JV1A 1R82A 1S4NA 4MYBA 5C4FA 1TW5A 2PGYA 3V91A 4JD0A 4L41C 3OH4A 5AJOA 5C4DA 3JTJA 1FG5N 4LW6A 3I0GA 1U43A 3D8VA 3DJ4A 1QWJA 2DPWA 2XWMA 4UEGA 2VS4A 5L6VA 1HJLA 3I0FA 2RJ4A 3USQA 1ZHJA 1U3LA 3JUJA 5DDVA 1VM8A 1W57A 1G0RA 3V0MA 1OQMB 1W55A 3Q7UA 3RMVA 4ASJA 4KC4A 1I52A 1WT0A 3IOIA 1JN1A 4Y62A 4B4GA 4EEOA 4HO2A 1GX1A 3D5NA 4FRHA 3KE1A 3I0JA 5CMIA 2WAWA 2YQJA 1W77A 1O23B 3PNNA 1Z90A 1R7YA 3I0IX 1V83A 2W0WA 5CMFX 3GUEA 3CKJA 3QHDA 4KC2A 2Y4MA 1FGGA 1U40A 3MBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7F A;  3I0D A;  2D7R A;  2UX8 A;  2I5E A;  1NHE B;  4MND A;  1NMM B;  3U0Y A;  4HO3 A;  1R7X A;  4HO4 A;  1MC3 A;  2GZL A;  1INI A;  1NQI B;  3CU0 A;  3T7N A;  3T7M A;  3V90 A;  3OAM A;  3SXD A;  1O0R A;  2GGO A;  3V8Z A;  3U0X A;  1GA8 A;  4LW3 A;  4FRM A;  4K6R A;  5L6S A;  1HJJ A;  1NF5 B;  2VSH A;  2P6W A;  3O3P A;  3SXG A;  4BQH A;  1R7U A;  4NAK A;  4C2S A;  5C1L A;  4M2A A;  2RJ1 A;  4FQW A;  4EEG A;  1H7Q A;  5C3D A;  1ZDF A;  1KWS A;  2OI6 A;  4KPZ A;  5DDT A;  2ZU8 A;  3SXA A;  5IDS A;  4P00 A;  1ON6 A;  4D11 C;  4BMA A;  2I7B A;  1ZJ1 A;  1VH1 A;  1ZCT A;  3V0L A;  1O7Q A;  1TZF A;  3OC9 A;  4DE7 A;  1VH8 A;  4ASY A;  3JVH A;  2AEC A;  4Y7U A;  2RJ7 A;  1IV2 A;  1YP3 A;  2I5K A;  1LZJ A;  1JY8 A;  3P0Z A;  2AMT A;  1S4O A;  2QH5 A;  4KQL A;  2JCK A;  3FWW A;  4CJB A;  1H4C A;  4Y9X A;  1VGT A;  5C38 A;  2WVL A;  1FOA A;  2V0L A;  4M2B A;  4B2W A;  4DDZ A;  4IRQ A;  1H48 A;  1ZJP A;  1LL0 A;  4XWI A;  2OI7 A;  2Q4J A;  4C8I A;  4FRA A;  3QVB A;  1EYR A;  1H47 A;  1VGW A;  2VFZ A;  2Y4L A;  1R7T A;  4HCQ A;  2FFU A;  1ZJ3 A;  2ZU9 A;  2FFV A;  3U2V A;  5I1F A;  3SX3 A;  5B8F A;  3E26 A;  5C1H A;  1H4E A;  4KPX A;  4HOC A;  2V0I A;  1ZI1 A;  2YES A;  4KNR A;  4C8G A;  1VHA A;  4AC3 A;  1H7T A;  1OMZ A;  3TQD A;  4FCU A;  4FCE A;  1V82 A;  1IV3 A;  2Y4J A;  4CJ8 A;  4FRE A;  2RJ8 A;  4G3S A;  4Y6N A;  1H5R B;  5CQO A;  3FOQ A;  3ZLL A;  3V0O A;  2PA4 A;  1VZU A;  3PKP A;  5IDT A;  3ESJ A;  1IIN A;  2E3D A;  2RJ9 A;  4D0T A;  3EOR A;  5CQM X;  1LL2 A;  4EE3 A;  4FRQ A;  1XHB A;  3T80 A;  3OKR A;  4KNX A;  4J18 A;  1FR9 A;  1IIM A;  4P02 A;  4CVH A;  1LVW A;  1FO9 A;  1JVG A;  1FRW A;  1FXO A;  2VS5 A;  3RSB A;  4HO8 A;  4FRO A;  2WVK A;  1NKH B;  2PGV A;  1ZI5 A;  4HG6 A;  2XME A;  3CKV A;  2AM5 A;  4Y7V A;  1H4D A;  3V0Q A;  1NWG B;  1IV4 A;  1G95 A;  2Y6P A;  3F1Y A;  2APC A;  3I0K A;  2O1F A;  2RJ6 A;  3SX7 A;  1JYK A;  1INJ A;  2VXL A;  3IKF A;  1GX0 A;  2RJ5 A;  3OH0 A;  2Y7A A;  3DK5 A;  5EJ1 A;  1VPA A;  4D11 A;  1EZI A;  3IEW A;  1G93 A;  4Y7F A;  2GGQ A;  1LZ7 A;  3ST8 A;  1HV9 A;  4ECM A;  4HO6 A;  1WT1 A;  3ZGG A;  2QKX A;  1FR8 A;  1MP5 A;  2FY7 A;  1GQC A;  2W0V A;  2YQH A;  2X60 A;  4ARW A;  4CJC A;  4EE4 A;  4B2X A;  1FXJ A;  4HO9 A;  2RIT A;  2RIX A;  4NAN A;  4B4B A;  4HO0 A;  4AYJ A;  5BXC A;  3F6M A;  3EE5 A;  1G97 A;  1U3P A;  3SXC A;  1YP4 A;  2OEF A;  1PZY B;  4NAI A;  5FTS A;  2OEG A;  5CQL X;  1JV3 A;  1G9R A;  5EIY A;  3IOH A;  1VIC A;  2JCJ A;  3N9W A;  5C3A A;  2MZB A;  1FZW A;  2AGD A;  2WE9 A;  1QG8 A;  1WT2 A;  1WVC A;  5C1G A;  4KC1 A;  1ZDG A;  1IV1 A;  4C8E A;  2AH9 A;  4KRV A;  4JIS A;  2PX7 A;  3OH1 A;  1GWW A;  2XWL A;  3Q4S A;  1ZCV A;  4YS8 A;  1VZX A;  5CMG X;  5C47 A;  1GWV A;  1G2V A;  5FU0 A;  1R81 A;  1ZJO A;  5FU8 A;  3BCV A;  1G23 A;  5AJP A;  5C48 A;  3ZLK A;  4G3P A;  3K14 A;  4EVW A;  2FYA A;  3K2X A;  4HO5 A;  3U2X A;  1ZCY A;  2BO7 A;  2AES A;  2YC3 A;  2FYD B;  2CU2 A;  2ICX A;  5C3B A;  1ZJ0 A;  3I0E A;  4EEA A;  1H5S B;  3OH3 A;  3IEQ A;  1G3L A;  1VGU A;  2XWN A;  2YC5 A;  4KXO A;  1ZI4 A;  3U2T A;  1O7O A;  4EEM A;  4G87 A;  1MP3 A;  4C81 A;  2RIY A;  2AM3 A;  4FRD A;  1MP4 A;  3CKN A;  1R80 A;  2V0K A;  3JUK A;  5FTV A;  2WGZ A;  1TVY A;  3Q8H A;  2JCL A;  5C8R A;  2BO8 A;  4B3U A;  4G3Q A;  2V0J A;  3Q80 A;  4B5B A;  3PKQ A;  1H5R A;  1H7E A;  3ZF8 A;  4GBP A;  1K4V A;  2O1H A;  1ZJ2 A;  4NAL A;  3P10 A;  5CMJ A;  1H5S D;  3ERN A;  3SXE A;  4B4M A;  1HM0 A;  2YQC A;  1H7L A;  2A8W A;  4Y7T A;  2OI5 A;  1H7H A;  1FO8 A;  2ZU7 A;  3R3I A;  5CQP A;  3ZGF A;  5JQQ A;  1H5S C;  3I0C A;  4Y64 A;  4Y7G A;  3K8D A;  2QGI A;  4DEC A;  4Y63 A;  2P72 A;  2WEE A;  2D0J A;  3IKE A;  3R2W A;  5FUH A;  3GHZ A;  2V0H A;  3ELC A;  4AAW A;  3CKQ A;  4E1K A;  4AYL A;  3RMW A;  3NGW A;  4M4K A;  1HM8 A;  3FBA A;  4ZDQ A;  3F1C A;  5AJN A;  3KIA A;  1FGX A;  3U2U A;  3RE3 A;  5J49 A;  4R7P A;  2ICY A;  2Y4K A;  3D98 A;  3F0D A;  1E5K A;  1VH3 A;  2YCM A;  1WT3 A;  4B42 A;  1KNJ A;  3SX8 A;  1GX4 A;  3TZT A;  5C4B A;  2FYB A;  2X5S A;  1VZT A;  5CMH A;  3T7O A;  1SS9 A;  1JVD A;  3E25 A;  4Y6U A;  1V84 A;  3V8Y A;  1G1L A;  1YP2 A;  1YQN A;  4FRL A;  3IOJ A;  1H5T B;  3OGZ A;  2VD4 A;  1H3M A;  5C36 A;  4C82 A;  5FV9 A;  2D7I A;  2E8B A;  4M28 A;  3F0F A;  1ZCU A;  2RIZ A;  1ZIZ A;  1PZT A;  2PMP A;  5C49 A;  2VS3 A;  2VXM A;  3SXB A;  4D48 A;  1ON8 A;  1QGQ A;  4FRB A;  3U2W A;  1H5T A;  3POL A;  5C4E A;  2X5Z A;  1LZI A;  3SX5 A;  2AM4 A;  2XMH A;  2YQS A;  3CGX A;  2RJ0 A;  4KT7 A;  1T0A A;  2O1G A;  5CQN X;  1VGZ A;  3B6N A;  3BRK X;  1ZI3 A;  3DUV A;  2A8U A;  4D0Z A;  3SPT A;  1KNK A;  2P73 A;  4IRP A;  2FYC B;  1LL3 A;  4FRP A;  3CKO A;  1FWY A;  1HM9 A;  3USR A;  5IFY A;  2VSI A;  1OMX A;  3V0P A;  3V0N A;  2AE7 A;  4EE5 A;  2UZH A;  2Z86 A;  3I0H A;  5HS2 A;  1TW1 A;  3LW6 A;  3F0G A;  1JYL A;  2JCO A;  2X65 A;  2Z87 A;  5FYE A;  3F0E A;  2WVM A;  5C4C A;  1G8O A;  3HL3 A;  3OH2 A;  1LZ0 A;  5EJZ A;  1S4P A;  3I0L A;  1H5S A;  1GQ9 A;  2BO6 A;  1R7V A;  1YRO B;  3K8E A;  1H7G A;  1QGS A;  2BO4 A;  1WSZ A;  1XZ6 A;  2NXV A;  3FPI A;  1JV1 A;  1R82 A;  1S4N A;  4MYB A;  5C4F A;  1TW5 A;  2PGY A;  3V91 A;  4JD0 A;  4L41 C;  3OH4 A;  5AJO A;  5C4D A;  3JTJ A;  1FG5 N;  4LW6 A;  3I0G A;  1U43 A;  3D8V A;  3DJ4 A;  1QWJ A;  2DPW A;  2XWM A;  4UEG A;  2VS4 A;  5L6V A;  1HJL A;  3I0F A;  2RJ4 A;  3USQ A;  1ZHJ A;  1U3L A;  3JUJ A;  5DDV A;  1VM8 A;  1W57 A;  1G0R A;  3V0M A;  1OQM B;  1W55 A;  3Q7U A;  3RMV A;  4ASJ A;  4KC4 A;  1I52 A;  1WT0 A;  3IOI A;  1JN1 A;  4Y62 A;  4B4G A;  4EEO A;  4HO2 A;  1GX1 A;  3D5N A;  4FRH A;  3KE1 A;  3I0J A;  5CMI A;  2WAW A;  2YQJ A;  1W77 A;  1O23 B;  3PNN A;  1Z90 A;  1R7Y A;  3I0I X;  1V83 A;  2W0W A;  5CMF X;  3GUE A;  3CKJ A;  3QHD A;  4KC2 A;  2Y4M A;  1FGG A;  1U40 A;  3MBM A; 
#chains in the Genus database with same CATH topology
 2L26 A;  4HO4 A;  1MC3 A;  2GZL A;  1INI A;  3T7M A;  2GGO A;  4K6R A;  1HJJ A;  4Q7C A;  3SXG A;  1TVK A;  2RJ1 A;  4FQW A;  1W2B F;  1W5E A;  1ZDF A;  4KPZ A;  1ON6 A;  4D11 C;  1ZCT A;  3E1Y A;  2AEC A;  3CD6 F;  5J2U B;  1X25 A;  4PWT A;  4BT4 A;  4CJB A;  3VOA A;  5EZY B;  1FOA A;  2V0L A;  4M2B A;  2Z01 A;  4XWI A;  5FJ4 C;  1EYR A;  4HCQ A;  1R7T A;  3M4S A;  1RQ7 A;  2FFV A;  2EWC A;  3SX3 A;  3E26 A;  1KC8 H;  4C8G A;  1H7T A;  1OMZ A;  3I3F A;  4FCU A;  3L7Q A;  4CJ8 A;  2H6L A;  3HWU A;  1Q82 H;  4G3S A;  3E20 B;  2PA4 A;  3PKP A;  3K0T A;  4EB6 A;  3CCL F;  1N8R H;  1IIN A;  2RJ9 A;  4I55 A;  4EE3 A;  3OKR A;  4KNX A;  1KD1 H;  4TV8 B;  1IIM A;  5KMG B;  4X1I A;  1JVG A;  3JAT A;  5CA0 A;  1NKH B;  2PGV A;  3V0Q A;  5IJ9 B;  3BYQ A;  1JYK A;  1INJ A;  4IIJ B;  2Q1X A;  1VQV A;  2VXL A;  1GX0 A;  3D01 A;  3IEW A;  2GGQ A;  3ST8 A;  1HV9 A;  4HO6 A;  3ZGG A;  2QKX A;  1FR8 A;  2H8C A;  3VYS C;  5LXT B;  3CCS F;  4O4I B;  3RYC B;  4O2B B;  3SXC A;  1PZY B;  2BTU A;  5CQL X;  1VIC A;  2HP3 A;  2B33 A;  3FFM A;  3N9W A;  2RHH A;  2MZB A;  2AGD A;  3SIU A;  4X1Y A;  3K12 A;  1WVC A;  5KX5 B;  4C8E A;  4KRV A;  4JIS A;  2CHS A;  3CB2 A;  5C47 A;  5FU0 A;  2WAL A;  1YIT F;  5FU8 A;  1TUB B;  1G23 A;  2ZAU A;  4ZHV A;  3ZLK A;  1YI2 F;  4HO5 A;  3U2X A;  4I50 A;  1VQN F;  4DRX B;  4EEA A;  3OH3 A;  2YYE A;  3D54 A;  4EI8 A;  5G4V C;  3WJR A;  4KXO A;  1ZI4 A;  3UT5 B;  4C81 A;  2AM3 A;  1W40 A;  1MP4 A;  2QA4 F;  3R0P A;  4X1K B;  4ZHQ A;  2JCL A;  2UYK A;  3O85 A;  4B5B A;  5JCO C;  4BT7 A;  1ZJ2 A;  3MDO A;  3P10 A;  1QD9 A;  1H5S D;  3ERN A;  3SXE A;  1HM0 A;  5BMV A;  2A8W A;  4Y7T A;  2ZU7 A;  3R3I A;  4ZOL B;  4Y64 A;  5HY4 A;  3S02 A;  2P72 A;  1W5F A;  4TUY A;  3GHZ A;  5FUH A;  3SIV A;  4TV9 B;  4M4K A;  4G4Y A;  5LYJ B;  3RE3 A;  3D98 A;  1E5K A;  1VH3 A;  1WT3 A;  2FYB A;  2HRU A;  5JVD A;  4ZHW A;  3RYI A;  2KG4 A;  3LWQ C;  1JVD A;  5IYZ B;  4O6M A;  3V8Y A;  2QEX F;  1YQN A;  5IJ0 B;  1H5T B;  4TZZ A;  2D7I A;  2E8B A;  3HKE A;  3VCZ A;  5C8Y B;  5LA6 B;  5C49 A;  2VS3 A;  3SXB A;  1SA0 B;  4B62 A;  3POL A;  5C4E A;  3NVI B;  2W8B C;  3LWV C;  4LNU A;  3TD4 A;  5FNV A;  1GZ0 A;  1JFF A;  3SPT A;  1FFX A;  1HM9 A;  2VSI A;  1OMX A;  4EE5 A;  2UZH A;  2YXZ A;  2Z86 A;  3VYT C;  1TW1 A;  5FYE A;  5C4C A;  2AIZ P;  2VK9 A;  1S4P A;  3I0L A;  1UI9 A;  1H5S A;  1H7G A;  3J81 M;  2NXV A;  1JV1 A;  1R82 A;  1S4N A;  3NK7 A;  4X20 A;  5LP6 C;  1VQM F;  4JD0 A;  4L41 C;  5AJO A;  5C4D A;  3JTJ A;  3I0G A;  1U43 A;  3MCQ A;  1HJL A;  5DDV A;  3LYB A;  3CME F;  3HKB A;  1W55 A;  1VQ6 F;  4KC4 A;  3WPW A;  2ZVZ A;  4FFB A;  4Y62 A;  4HO2 A;  5CMI A;  3CYP B;  2BTQ B;  2IQQ A;  2LCA A;  3CC2 F;  1R7Y A;  3GUE A;  4XCQ A;  3CCV F;  1FGG A;  1H7F A;  3I0D A;  2D7R A;  2UX8 A;  1K73 H;  1NMM B;  3U0Y A;  5EWR A;  2ZVY A;  5GIP C;  1X7P A;  4U3J B;  3IMP A;  2R75 1;  3SXD A;  3V8Z A;  3U0X A;  2VSH A;  2OHW A;  2P6W A;  3O3P A;  5C1L A;  5EIB D;  5CB4 B;  1NJI H;  3OW2 F;  4BVQ A;  5IDS A;  2CHT A;  2I7B A;  1ZJ1 A;  1O7Q A;  1VH8 A;  4ASY A;  3JVH A;  1Z5V A;  2RJ7 A;  1YP3 A;  3VYU C;  5MN4 A;  1LZJ A;  2JCK A;  3FWW A;  4Y9X A;  1FNJ A;  5C38 A;  1YHQ F;  2WVL A;  5J2U A;  3S03 A;  4B2W A;  4DDZ A;  1ZJP A;  2CWJ A;  3QVB A;  1QU9 A;  1ZJ3 A;  4ZHY B;  5I1F A;  5EZY A;  5B8F A;  5GAP K;  1H4E A;  4KPX A;  1V82 A;  2GVI A;  5CA1 B;  1W41 A;  5CQO A;  5HP7 A;  3V0O A;  1VZU A;  3ESJ A;  2HRY A;  3C9T A;  5ITZ B;  1FR9 A;  3VTI C;  4CVH A;  1FXO A;  2VS5 A;  2HP0 B;  2WVK A;  1ZI5 A;  2XME A;  1CN7 A;  1H4D A;  4TV8 A;  3F1Y A;  2Y6P A;  3I0K A;  2APC A;  5HY0 A;  3IKF A;  2Y7A A;  3DK5 A;  1NQ3 A;  2HS0 A;  4DXD A;  1VPA A;  3JAW B;  3CXC F;  1XRG A;  5IJ9 A;  4IIJ A;  2FY7 A;  1MP5 A;  1GQC A;  2X60 A;  2ZOV A;  3OON A;  4HO9 A;  2RIT A;  5AVM A;  4HO0 A;  3AGK A;  1G97 A;  3G6E F;  4O4I A;  3RYC A;  1YP4 A;  4NAI A;  3C9U A;  2VXY A;  5EIY A;  2LBW A;  2JCJ A;  1FZW A;  4O2A B;  4O2B A;  1QG8 A;  5C1G A;  4KC1 A;  1ZDG A;  1IV1 A;  2IAF A;  1X52 A;  3HKC B;  1VQO F;  2XWL A;  3Q4S A;  4YS8 A;  1VZX A;  1GWV A;  4BT3 A;  5EB0 A;  1R81 A;  4O4J A;  3BCV A;  5AJP A;  4X3M A;  5KX5 A;  4EVW A;  3MCA B;  2BO7 A;  2AES A;  2I6R A;  3I7T A;  2RHL A;  5J2T A;  1TUB A;  2XWN A;  4O4L B;  2GLZ A;  3U2T A;  5JQG B;  4EEM A;  1K9M H;  1VQ9 F;  1VQ5 F;  2MQE A;  5FTV A;  2VAM A;  4DRX A;  1TVY A;  3LWO C;  3PAF A;  2V0J A;  3PKQ A;  1H5R A;  3JAR B;  3ZF8 A;  2OTM A;  2DYY A;  1K4V A;  2V9Y A;  4NAL A;  4X1K A;  5CMJ A;  1XHO A;  4B4M A;  1H7L A;  4F6R B;  1Q8R A;  3RYF A;  2KGW A;  3ON1 A;  4BT6 A;  1JD1 A;  3I0C A;  5G4U C;  4I4T A;  3J80 M;  4O6N A;  4Y7G A;  3S0W A;  3K8D A;  1RA4 A;  4Y63 A;  2D0J A;  3R2W A;  2V0H A;  3ELC A;  3KJK A;  3CKQ A;  3RMW A;  4ZOL A;  4NUT A;  1VQK F;  3FBA A;  3M1X A;  1GO1 A;  4R7P A;  1H7M A;  5JH7 A;  4B42 A;  1KNJ A;  4TV9 A;  1GX4 A;  5C4B A;  5LYJ A;  2X5S A;  4HNA B;  3T7O A;  5HY2 A;  1SS9 A;  3E25 A;  4Y6U A;  2FC3 A;  4LCK A;  1YP2 A;  3QUW A;  3FD5 A;  3N2G B;  3PLA C;  2HX0 A;  4NWO B;  4C82 A;  1COM A;  1ZCU A;  1ZIZ A;  5IYZ A;  2PMP A;  2NMU A;  1XV2 A;  4D48 A;  5IJ0 A;  3U2W A;  1H5T A;  4ZK7 A;  5EIB C;  4KT7 A;  2YQS A;  2RJ0 A;  1T0A A;  2O1G A;  5CQN X;  5C8Y A;  1VGZ A;  3B6N A;  3BRK X;  1E7K A;  5LA6 A;  1SA0 A;  1KNK A;  2P73 A;  4IRP A;  5GON A;  1LL3 A;  3CKO A;  3N2K A;  5IFY A;  1X7O A;  3ZOP A;  5HXU A;  5HS2 A;  2OZB A;  1JYL A;  2JCO A;  2Z87 A;  4G4W A;  3F0E A;  1G8O A;  1YJN F;  5IT9 M;  2CZW A;  5MN5 A;  4BW0 B;  4YJ2 A;  2BO4 A;  4EB6 B;  4I55 B;  1TW5 A;  3V91 A;  3OH4 A;  2VAP A;  4LW6 A;  3CYQ A;  1QWJ A;  2XWM A;  4M8I A;  5EAZ A;  2RJ4 A;  3USQ A;  3CCM F;  1OQM B;  3RMV A;  4BT2 A;  2UYN B;  3D00 A;  3WGJ A;  4EEO A;  1M90 H;  3KE1 A;  3V3T A;  2IG8 A;  2YQJ A;  1CK2 A;  1O23 B;  3PNN A;  3CCQ F;  3I0I X;  1R1M A;  3QHD A;  1U40 A;  3MBM A;  2RHO A;  2I5E A;  1NHE B;  4MND A;  3E22 B;  2LBT A;  1NQI B;  3RYH A;  5MN6 A;  3CU0 A;  3V90 A;  1O0R A;  1W59 A;  3NVK E;  4FRM A;  5L6S A;  1NF5 B;  4BQH A;  1R7U A;  4NAK A;  4C2S A;  2I6D A;  4B45 A;  2HQS C;  1W3E X;  3ZO8 A;  4EEG A;  1H7Q A;  5C3D A;  1KWS A;  2OI6 A;  1FSZ A;  4X1Y B;  3GYQ A;  4BMA A;  5LP6 B;  1VH1 A;  3V0L A;  1TZF A;  3OC9 A;  3TD3 A;  5CB4 A;  2UYP A;  3CCU F;  3J7A R;  1JY8 A;  3V4D A;  3P0Z A;  3WJP A;  1LL0 A;  5GAN K;  1K8A H;  4ZI7 B;  3JAS A;  4FRA A;  1VGW A;  1SDS A;  2ZF8 A;  2FFU A;  5FLX M;  2P6Y A;  3WXM B;  4RHA A;  3C8L A;  1VHA A;  3KJJ A;  3TQD A;  4ZHQ B;  4BVS A;  4FCE A;  3FD6 A;  3LWP C;  4YJ3 B;  3S06 A;  1VK3 A;  3FOQ A;  5EYP B;  2E3D A;  4D0T A;  3EOR A;  5CQM X;  3T80 A;  4J18 A;  3JAL B;  1LVW A;  1FO9 A;  1FRW A;  4EI7 A;  4HG6 A;  3CKV A;  4Y7V A;  1IV4 A;  1G95 A;  2HP0 A;  2RJ5 A;  3OH0 A;  5EJ1 A;  5EO3 A;  4D11 A;  1G93 A;  4WBN B;  4Y7F A;  1LZ7 A;  5HP8 A;  2OTL F;  1WT1 A;  4RQO A;  3CPW F;  4ARW A;  4CJC A;  4B2X A;  3JAW A;  4EI9 A;  5BXC A;  3F6M A;  3EE5 A;  3N4Y A;  3HKE B;  4G4Z A;  2OEG A;  3N4Z A;  4G4X A;  3V7E A;  1JV3 A;  3IOH A;  3VOB A;  2Z1T A;  1OFU A;  2PX7 A;  3OH1 A;  3JAK B;  1GWW A;  1ZCV A;  1G2V A;  4NQ3 A;  1RQ2 A;  3CC7 F;  1ZJO A;  4O2A A;  2J0B A;  4X3L A;  3HKC A;  3LWR C;  2FYA A;  3K2X A;  4FIY A;  2Q1Y A;  2CSL A;  2YC3 A;  3JCM M;  1PF5 A;  2FYD B;  2CU2 A;  2R6R 1;  2ICX A;  1NMU B;  1ZJ0 A;  3I0E A;  1H5S B;  1G3L A;  1VGU A;  3QTY A;  2YC5 A;  4O4H B;  1O7O A;  4G87 A;  4X20 B;  2PHN A;  1XBI A;  4IHJ B;  1R80 A;  2Z1F A;  2V0K A;  3VIU A;  4KWE A;  4G3Q A;  3Q80 A;  5JQG A;  1KQS F;  2O1H A;  3HKB B;  3CMA F;  3WGL A;  2J0A A;  2OI5 A;  1H7H A;  5KMG A;  3WGK A;  3RA5 A;  5JQQ A;  1H5S C;  2UYJ A;  2OTJ F;  3HKD B;  3IKE A;  4AYL A;  1ZWZ A;  3HJW C;  3NGW A;  1HM8 A;  4ZDQ A;  3KIA A;  1FGX A;  2ICY A;  3F0D A;  3LFO A;  3TZT A;  1W5B A;  5LXT A;  2K1S A;  1V84 A;  2Z1U A;  1ODE A;  3OGZ A;  5C36 A;  4HNA A;  5FV9 A;  1FNK A;  1QVF F;  5EB1 B;  1PZT A;  2VXM A;  1ON8 A;  1QGQ A;  1OAP A;  3N2G A;  2X5Z A;  1LZI A;  3SX5 A;  1ZI3 A;  3DUV A;  1Q86 H;  4BY9 D;  2A8U A;  2CVL A;  5JCO A;  4FRP A;  3USR A;  5LOV B;  2AE7 A;  3NMU C;  3CCE F;  3I0H A;  3LW6 A;  1SZQ A;  3WGN A;  3HL3 A;  3OH2 A;  1QAH A;  2QI2 A;  1GQ9 A;  4BT5 A;  2BO6 A;  1R7V A;  1YRO B;  2RB9 A;  1QGS A;  1XZ6 A;  5C4F A;  3UT5 A;  1FG5 N;  3D8V A;  4ERH A;  3DJ4 A;  2DPW A;  3VO8 A;  3HTN A;  3I0F A;  1T0K B;  3LDT A;  2JNB A;  1W57 A;  1G0R A;  3V0M A;  3WPX A;  3VMF B;  3I56 F;  2F9Z C;  3I55 F;  3IOI A;  4B4G A;  3NK6 A;  1GX1 A;  4FRH A;  2WAW A;  1W77 A;  1DT9 A;  2UYN A;  1Z90 A;  4BVR A;  3DDN A;  2W0W A;  5CMF X;  3CC4 F;  5HXZ A;  4KC2 A;  2Y4M A;  1VQ7 F;  1TVK B;  4HO3 A;  1R7X A;  2VGN A;  3T7N A;  2KTU A;  3OBW A;  3OAM A;  4G4V A;  3C9R A;  3LME A;  1GA8 A;  4LW3 A;  2Z1E A;  4FIX A;  1QVG F;  3E22 A;  3CCR F;  4M2A A;  5DDT A;  2ZU8 A;  3SXA A;  4P00 A;  3VI6 A;  4C4W C;  4DE7 A;  3MQW A;  1CLI A;  4Y7U A;  1IV2 A;  2I5K A;  1J7H A;  4O4J B;  2BO1 A;  2AMT A;  1S4O A;  2QH5 A;  4KQL A;  3WGM A;  1H4C A;  5LP6 A;  1VGT A;  3OBY A;  4IRQ A;  1H48 A;  5J2T B;  2OI7 A;  2Q4J A;  4C8I A;  1H47 A;  2VFZ A;  2Y4L A;  2VGM A;  2ZU9 A;  1YJW F;  1UFY A;  3U2V A;  5C1H A;  1Z5W A;  4HOC A;  2V0I A;  1ZI1 A;  2LBX A;  2YES A;  2ZOD A;  4KNR A;  4AC3 A;  4ZI7 A;  2DT4 A;  1IV3 A;  1DBF A;  2Y4J A;  4FRE A;  3ZP7 A;  2RJ8 A;  4Y6N A;  1H5R B;  2ALE A;  3ZLL A;  2C0N A;  4X1I B;  5IDT A;  3RA6 A;  3JAT B;  5CA0 B;  1LL2 A;  4FRQ A;  4YJ3 A;  1XHB A;  3RYF B;  2HS3 A;  4P02 A;  1RLU A;  3RSB A;  4HO8 A;  5EYP A;  4FRO A;  4I4T B;  1Q81 H;  2AM5 A;  1NWG B;  3SX7 A;  3JAL A;  2O1F A;  2RJ6 A;  3CPQ A;  1M1K H;  1EZI A;  2H8E A;  5JH7 B;  4ECM A;  3S0Y A;  2W0V A;  2YQH A;  4EE4 A;  5A2Q M;  2RHJ A;  1FXJ A;  2HS4 A;  3P4E A;  4WBN A;  2RIX A;  4NAN A;  4B4B A;  4AYJ A;  4U3J A;  2BTO A;  4E6E A;  1U3P A;  2OEF A;  5FTS A;  2QTP A;  1G9R A;  1W58 1;  1VQ4 F;  5C3A A;  1VQP F;  2WE9 A;  1WT2 A;  5GIN C;  2AH9 A;  2VAW A;  3JAM M;  5GON B;  4I50 B;  5CMG X;  3C9S A;  2G9I A;  3N2K B;  5HY1 A;  5C48 A;  4G3P A;  2N48 A;  3K14 A;  3JAK A;  1ZCY A;  3ZP4 A;  1W42 A;  1ONI A;  5C3B A;  2AIF A;  3IEQ A;  4YJ2 B;  3U0O A;  1MP3 A;  2RIY A;  4FRD A;  3CKN A;  3JUK A;  1S72 F;  2WGZ A;  3Q8H A;  5C8R A;  2BO8 A;  4B3U A;  1Q7Y H;  5BMV B;  4O4H A;  3KHN A;  5CA1 A;  1YGY A;  1H7E A;  5GIO C;  4GBP A;  4IHJ A;  2YQC A;  1IPA A;  5ITZ A;  3TD5 A;  4TUY B;  1FO8 A;  5CQP A;  4G88 A;  3ZGF A;  4MIX A;  2QGI A;  4DEC A;  1PXW A;  4BVT A;  2WEE A;  1JJ2 F;  4AAW A;  1W5A A;  4E1K A;  3F1C A;  5AJN A;  5JVD B;  3U2U A;  3HKD A;  3RYI B;  3RYH B;  5J49 A;  2Y4K A;  2YCM A;  3SX8 A;  4B5C A;  3GTZ A;  1VZT A;  5CMH A;  1G1L A;  4FRL A;  3IOJ A;  2VD4 A;  1H3M A;  1GO0 A;  3HAX D;  4M28 A;  3F0F A;  4LNU B;  5FNV B;  2RIZ A;  1JFF B;  4FRB A;  1FFX B;  3M84 A;  2AM4 A;  4R40 B;  2XMH A;  3CGX A;  5D92 A;  2CW4 A;  2KTV A;  5D91 A;  3CCJ F;  4D0Z A;  3JAS B;  2HVY D;  2FYC B;  3KIZ A;  1FWY A;  3V0P A;  3V0N A;  3F0G A;  1RLG A;  2X65 A;  4U39 A;  2WVM A;  1YJ9 F;  5LOV A;  1LZ0 A;  5EJZ A;  1VQ8 F;  3DC2 A;  3K8E A;  3IR9 A;  4O4L A;  5DCV A;  1WSZ A;  3FPI A;  4MYB A;  2PGY A;  5HWE A;  4UEG A;  2VS4 A;  4FFB B;  5L6V A;  1ZHJ A;  2FGY A;  1U3L A;  3G4S F;  3JAR A;  3JUJ A;  1VM8 A;  3V7Q A;  4B46 A;  1YIJ F;  3Q7U A;  4ASJ A;  1I52 A;  1WT0 A;  4F6R A;  1JN1 A;  3D5N A;  3I0J A;  1VQL F;  3CG6 A;  3S0H A;  1V83 A;  3WJQ A;  3G71 F;  3CKJ A; 
#chains in the Genus database with same CATH homology
 1H7F A;  3I0D A;  2D7R A;  2UX8 A;  2I5E A;  1NHE B;  4MND A;  1NMM B;  3U0Y A;  4HO3 A;  1R7X A;  4HO4 A;  1MC3 A;  2GZL A;  1INI A;  1NQI B;  3CU0 A;  3T7N A;  3T7M A;  3V90 A;  3OAM A;  3SXD A;  1O0R A;  2GGO A;  3V8Z A;  3U0X A;  1GA8 A;  4LW3 A;  4FRM A;  4K6R A;  5L6S A;  4FIX A;  1HJJ A;  1NF5 B;  2VSH A;  2P6W A;  3O3P A;  4Q7C A;  3SXG A;  4BQH A;  1R7U A;  4NAK A;  4C2S A;  5C1L A;  4M2A A;  2RJ1 A;  4FQW A;  4EEG A;  1H7Q A;  5C3D A;  1ZDF A;  1KWS A;  2OI6 A;  4KPZ A;  5DDT A;  2ZU8 A;  3SXA A;  5IDS A;  4P00 A;  1ON6 A;  4D11 C;  4BMA A;  2I7B A;  1ZJ1 A;  1VH1 A;  1ZCT A;  3V0L A;  1O7Q A;  1TZF A;  3OC9 A;  4DE7 A;  1VH8 A;  4ASY A;  3JVH A;  2AEC A;  4Y7U A;  2RJ7 A;  1IV2 A;  1YP3 A;  2I5K A;  1LZJ A;  1JY8 A;  3P0Z A;  2AMT A;  1S4O A;  2QH5 A;  4KQL A;  2JCK A;  3FWW A;  4CJB A;  1H4C A;  4Y9X A;  1VGT A;  5C38 A;  2WVL A;  1FOA A;  2V0L A;  4M2B A;  4B2W A;  4DDZ A;  4IRQ A;  1H48 A;  1ZJP A;  1LL0 A;  4XWI A;  2OI7 A;  2Q4J A;  4C8I A;  4FRA A;  3QVB A;  1EYR A;  1H47 A;  1VGW A;  2VFZ A;  2Y4L A;  1R7T A;  4HCQ A;  2FFU A;  1ZJ3 A;  2ZU9 A;  2FFV A;  3U2V A;  5I1F A;  3SX3 A;  5B8F A;  3E26 A;  5C1H A;  1H4E A;  4KPX A;  4HOC A;  2V0I A;  1ZI1 A;  2YES A;  4KNR A;  4C8G A;  1VHA A;  4AC3 A;  1H7T A;  1OMZ A;  3TQD A;  4FCU A;  4FCE A;  1V82 A;  1IV3 A;  2Y4J A;  4CJ8 A;  4FRE A;  2RJ8 A;  4G3S A;  4Y6N A;  1H5R B;  5CQO A;  3FOQ A;  3ZLL A;  3V0O A;  2PA4 A;  2C0N A;  1VZU A;  3PKP A;  5IDT A;  3ESJ A;  1IIN A;  2E3D A;  2RJ9 A;  4D0T A;  3EOR A;  5CQM X;  1LL2 A;  4EE3 A;  4FRQ A;  1XHB A;  3T80 A;  3OKR A;  4KNX A;  4J18 A;  1FR9 A;  1IIM A;  4P02 A;  4CVH A;  1LVW A;  1FO9 A;  1JVG A;  1FRW A;  1FXO A;  2VS5 A;  3RSB A;  4HO8 A;  4FRO A;  2WVK A;  1NKH B;  2PGV A;  1ZI5 A;  4HG6 A;  2XME A;  3CKV A;  2AM5 A;  4Y7V A;  1H4D A;  3V0Q A;  1NWG B;  1IV4 A;  1G95 A;  2Y6P A;  3F1Y A;  2APC A;  3I0K A;  2O1F A;  2RJ6 A;  3SX7 A;  1JYK A;  1INJ A;  2VXL A;  3IKF A;  1GX0 A;  2RJ5 A;  3OH0 A;  2Y7A A;  3DK5 A;  5EJ1 A;  1VPA A;  4D11 A;  1EZI A;  3IEW A;  1G93 A;  4Y7F A;  2GGQ A;  1LZ7 A;  3ST8 A;  1HV9 A;  4ECM A;  4HO6 A;  1WT1 A;  3ZGG A;  2QKX A;  1FR8 A;  1MP5 A;  2FY7 A;  1GQC A;  2W0V A;  2YQH A;  2X60 A;  4ARW A;  4CJC A;  4EE4 A;  4B2X A;  1FXJ A;  4HO9 A;  2RIT A;  2RIX A;  4NAN A;  4B4B A;  4HO0 A;  4AYJ A;  5BXC A;  3F6M A;  3EE5 A;  1G97 A;  1U3P A;  3SXC A;  1YP4 A;  2OEF A;  1PZY B;  4NAI A;  5FTS A;  2OEG A;  5CQL X;  1JV3 A;  1G9R A;  5EIY A;  3IOH A;  1VIC A;  2JCJ A;  3N9W A;  5C3A A;  2MZB A;  1FZW A;  2AGD A;  2WE9 A;  1QG8 A;  1WT2 A;  1WVC A;  5C1G A;  4KC1 A;  1ZDG A;  1IV1 A;  4C8E A;  2AH9 A;  4KRV A;  4JIS A;  2PX7 A;  3OH1 A;  1GWW A;  2XWL A;  3Q4S A;  1ZCV A;  4YS8 A;  1VZX A;  5CMG X;  5C47 A;  1GWV A;  1G2V A;  5FU0 A;  1R81 A;  1ZJO A;  5FU8 A;  2J0B A;  3BCV A;  1G23 A;  5AJP A;  5C48 A;  3ZLK A;  4G3P A;  3K14 A;  4EVW A;  2FYA A;  3K2X A;  4FIY A;  4HO5 A;  3U2X A;  1ZCY A;  2BO7 A;  2AES A;  2YC3 A;  2FYD B;  2CU2 A;  2ICX A;  5C3B A;  1ZJ0 A;  3I0E A;  4EEA A;  1H5S B;  3OH3 A;  3IEQ A;  1G3L A;  1VGU A;  2XWN A;  2YC5 A;  4KXO A;  1ZI4 A;  3U2T A;  1O7O A;  4EEM A;  4G87 A;  1MP3 A;  4C81 A;  2RIY A;  2AM3 A;  4FRD A;  1MP4 A;  3CKN A;  1R80 A;  2V0K A;  3JUK A;  5FTV A;  2WGZ A;  1TVY A;  3Q8H A;  2JCL A;  5C8R A;  2BO8 A;  4B3U A;  4G3Q A;  2V0J A;  3Q80 A;  4B5B A;  3PKQ A;  1H5R A;  1H7E A;  3ZF8 A;  4GBP A;  1K4V A;  2O1H A;  1ZJ2 A;  4NAL A;  3P10 A;  5CMJ A;  1H5S D;  3ERN A;  3SXE A;  4B4M A;  1HM0 A;  2YQC A;  1H7L A;  2A8W A;  2J0A A;  4Y7T A;  2OI5 A;  1H7H A;  1FO8 A;  2ZU7 A;  3R3I A;  5CQP A;  3ZGF A;  5JQQ A;  1H5S C;  3I0C A;  4Y64 A;  4O6N A;  4Y7G A;  3K8D A;  4MIX A;  2QGI A;  4DEC A;  4Y63 A;  2P72 A;  2WEE A;  2D0J A;  3IKE A;  3R2W A;  5FUH A;  3GHZ A;  2V0H A;  3ELC A;  4AAW A;  3CKQ A;  4E1K A;  4AYL A;  3RMW A;  3NGW A;  4M4K A;  1HM8 A;  3FBA A;  4ZDQ A;  3F1C A;  5AJN A;  3KIA A;  1FGX A;  3U2U A;  3RE3 A;  5J49 A;  4R7P A;  2ICY A;  2Y4K A;  3D98 A;  3F0D A;  1E5K A;  1VH3 A;  2YCM A;  1WT3 A;  4B42 A;  1KNJ A;  3SX8 A;  1GX4 A;  3TZT A;  5C4B A;  2FYB A;  2X5S A;  1VZT A;  5CMH A;  3T7O A;  1SS9 A;  1JVD A;  3E25 A;  4Y6U A;  1V84 A;  4O6M A;  3V8Y A;  1G1L A;  1YP2 A;  1YQN A;  4FRL A;  3IOJ A;  1H5T B;  3OGZ A;  2VD4 A;  1H3M A;  5C36 A;  4C82 A;  5FV9 A;  2D7I A;  2E8B A;  4M28 A;  3F0F A;  1ZCU A;  2RIZ A;  1ZIZ A;  1PZT A;  2PMP A;  5C49 A;  2VS3 A;  2VXM A;  3SXB A;  4D48 A;  1ON8 A;  1QGQ A;  4FRB A;  3U2W A;  1H5T A;  3POL A;  5C4E A;  2X5Z A;  1LZI A;  3SX5 A;  2AM4 A;  2XMH A;  2YQS A;  3CGX A;  2RJ0 A;  4KT7 A;  5D92 A;  1T0A A;  2O1G A;  5CQN X;  1VGZ A;  3B6N A;  3BRK X;  1ZI3 A;  3DUV A;  5D91 A;  2A8U A;  4D0Z A;  3SPT A;  1KNK A;  2P73 A;  4IRP A;  2FYC B;  1LL3 A;  4FRP A;  3CKO A;  1FWY A;  1HM9 A;  3USR A;  5IFY A;  2VSI A;  1OMX A;  3V0P A;  3V0N A;  2AE7 A;  4EE5 A;  2UZH A;  2Z86 A;  3I0H A;  5HS2 A;  1TW1 A;  3LW6 A;  3F0G A;  1JYL A;  2JCO A;  2X65 A;  2Z87 A;  5FYE A;  3F0E A;  2WVM A;  5C4C A;  1G8O A;  2VK9 A;  3HL3 A;  3OH2 A;  1LZ0 A;  5EJZ A;  1S4P A;  3I0L A;  1H5S A;  1GQ9 A;  2BO6 A;  1R7V A;  1YRO B;  3K8E A;  1H7G A;  1QGS A;  2BO4 A;  1WSZ A;  1XZ6 A;  2NXV A;  3FPI A;  1JV1 A;  1R82 A;  1S4N A;  4MYB A;  5C4F A;  1TW5 A;  2PGY A;  3V91 A;  4JD0 A;  4L41 C;  3OH4 A;  5AJO A;  5C4D A;  3JTJ A;  1FG5 N;  4LW6 A;  3I0G A;  1U43 A;  3D8V A;  3DJ4 A;  1QWJ A;  2DPW A;  2XWM A;  4UEG A;  2VS4 A;  5L6V A;  1HJL A;  3I0F A;  2RJ4 A;  3USQ A;  1ZHJ A;  1U3L A;  3JUJ A;  5DDV A;  1VM8 A;  1W57 A;  1G0R A;  3V0M A;  1OQM B;  1W55 A;  3Q7U A;  3RMV A;  4ASJ A;  4KC4 A;  1I52 A;  1WT0 A;  3IOI A;  1JN1 A;  4Y62 A;  4B4G A;  4EEO A;  4HO2 A;  1GX1 A;  3D5N A;  4FRH A;  3KE1 A;  3I0J A;  5CMI A;  2WAW A;  2YQJ A;  1W77 A;  1O23 B;  3PNN A;  1Z90 A;  1R7Y A;  3I0I X;  1V83 A;  2W0W A;  5CMF X;  3GUE A;  3CKJ A;  3QHD A;  4KC2 A;  2Y4M A;  1FGG A;  1U40 A;  3MBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...