1W55A

Structure of the bifunctional ispdf from campylobacter jejuni
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
369
structure length
369
Chain Sequence
SEMSLIMLAAGNSTRFNTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFTKNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREKIKLIQTPQISKTKLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTPSFEIFTGNGFDVHEFGENRPLLLAGVQIHPTMGLKAHSDGDVLAHSLTDAILGAAGLGDIGELYPDTDMKFKNANSMELLKQAYDKVREIGFELINIDICVMAQSPKLKDFKQAMQSNIAHTLDLDEFRINVKATTTEKLGFIGRKEGMAVLSSVNLKYFDWTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexameric Assembly of the Bifunctional Methylerythritol 2,4-Cyclodiphosphate Synthase and Protein-Protein Associations in the Deoxy-Xylulose-Dependent Pathway of Isoprenoid Precursor Biosynthesis
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords ISPD/ISPF BIFUNCTIONAL ENZYME
total genus 114
structure length 369
sequence length 369
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1w55A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1w55A01
1LL2A 3I0HA 1O7OA 4EEOA 1NQIB 1HV9A 1IIMA 1IV4A 4CJ8A 5C36A 1VGTA 2W0WA 4P00A 4B2XA 4AYJA 4C8GA 2OI7A 3CGXA 3T7MA 1H7HA 1WT2A 1H7FA 5C4BA 2X60A 2YQSA 1ZJPA 3DJ4A 1V84A 4CJBA 1ZJ2A 2RIXA 1VGWA 4KPXA 1G8OA 1FGGA 1JVDA 1ZCUA 1V82A 2D7IA 3JUKA 4HO8A 4ASYA 5C48A 3CKVA 1H7GA 4B4MA 3OKRA 1R7UA 1OQMB 1YQNA 3POLA 1GA8A 2X5SA 3RE3A 1GQCA 2Y7AA 1H7EA 4L41C 4AAWA 1QGQA 5IDSA 1JN1A 2I7BA 1H5RB 4FRMA 5CMIA 4AYLA 2GZLA 1YROB 1QGSA 5CMFX 3SX7A 2VS3A 3E26A 3I0EA 4Y7TA 1FG5N 2Y4LA 4MYBA 1VZTA 3I0CA 1NF5B 3F0FA 2CU2A 4BMAA 2I5KA 3U2TA 5C1LA 2BO7A 2XWMA 3I0KA 1LZJA 2WEEA 4XWIA 4YS8A 2OEFA 2FYCB 2VS5A 2Y6PA 5I1FA 3DUVA 3QHDA 3K8DA 2YCMA 3OC9A 3OH3A 1ZCYA 4IRPA 4IRQA 2WVLA 3BRKX 4Y7FA 1MP3A 1GX4A 3FBAA 3CKOA 3RSBA 2W0VA 3B6NA 3F0EA 4E1KA 2ZU8A 4LW3A 5FTSA 4HO2A 1MC3A 3K14A 2OI6A 4FREA 4B42A 5C4EA 1U43A 4Y7GA 3U0XA 5IFYA 4JISA 4Y6NA 1ZJ1A 2P72A 3V0LA 1ON8A 4C8IA 3DK5A 1HJJA 3QVBA 3NGWA 3OH0A 1ON6A 1FO9A 1H7QA 3SXEA 2WGZA 4Y64A 1H3MA 1EYRA 4G3QA 1H5SC 3HL3A 4Y62A 1NKHB 1ZDFA 1QWJA 2VS4A 3SXBA 4ECMA 5CQOA 2BO8A 1IV3A 5C47A 5C3BA 4FRLA 3SX5A 1TZFA 2JCLA 3CU0A 4FRBA 3OGZA 3IEWA 2AGDA 2VD4A 4KC4A 3OH1A 2P6WA 1G0RA 1ZI5A 2FYAA 2VXLA 5CQMX 3TQDA 4DDZA 3ESJA 4M2BA 2Y4KA 4K6RA 1PZYB 2O1GA 4FRDA 1S4OA 1H5SD 1FRWA 2JCKA 2VSIA 4HCQA 4FCUA 1ZJ3A 2V0KA 1W55A 2ICYA 4FQWA 3SXDA 2V0HA 3ZGGA 3R2WA 3Q4SA 3T7OA 2WAWA 2UZHA 3IKFA 2O1FA 3CKNA 2FYBA 5EIYA 3GUEA 3IKEA 1ZHJA 5CQPA 2YC5A 3ELCA 4M4KA 4M2AA 3BCVA 1KWSA 2QGIA 1OMXA 5AJPA 3EE5A 1FXOA 5AJOA 3IEQA 1LZIA 3MBMA 3V0QA 4MNDA 1VHAA 3TZTA 3R3IA 3U2WA 1JV3A 1LZ7A 1FR8A 4EVWA 3ERNA 3USQA 2PGVA 1LL3A 4ZDQA 3P0ZA 3ZGFA 1XZ6A 4KC1A 3RMVA 5DDTA 4J18A 5CMGX 1R82A 1IV2A 3SXGA 2YQJA 3K8EA 1H4CA 1HM9A 3F0GA 5FU8A 4C82A 2NXVA 2XMHA 3E25A 2Z87A 3OH4A 4HO3A 4KNXA 3V0OA 2V0LA 2PX7A 3RMWA 5CQLX 5C3AA 2YQHA 4B4GA 2BO4A 3N9WA 1T0AA 2E8BA 1FOAA 3KE1A 1GWWA 5JQQA 3SX3A 3V90A 3EORA 1VICA 1FXJA 4D11C 2A8UA 3SPTA 5CQNX 2YESA 1ZI1A 1VZXA 4KC2A 1HM0A 5AJNA 4JD0A 2Q4JA 4CVHA 1MP4A 1FGXA 4NANA 2WE9A 3ZF8A 3I0DA 3V0MA 1IINA 4EEAA 1VPAA 4P02A 1ZCTA 2MZBA 3K2XA 2RJ7A 2APCA 3I0IX 3SXAA 1VZUA 1H4DA 3F1YA 1ZJOA 2A8WA 1KNKA 1S4NA 5CMJA 1GX1A 4EE5A 4C81A 3PKQA 5L6VA 3D8VA 2FFUA 4FRAA 2PA4A 4DE7A 4D0ZA 2RIYA 4EEGA 1VH1A 2XMEA 1JVGA 1G3LA 1HM8A 1XHBA 2FYDB 3I0FA 1TW1A 2YQCA 2WVKA 1R7YA 1H5SB 1U3PA 3I0LA 4EE4A 2VFZA 3ZLKA 3IOIA 1FZWA 1ZI3A 2JCOA 1H47A 4HO4A 2RJ5A 1NWGB 4D48A 1INJA 1FO8A 4FRQA 1R7XA 1WT1A 2GGQA 4KQLA 1W77A 2AESA 1YP2A 1H7LA 3ZLLA 1G1LA 3CKJA 1ZJ0A 4C2SA 2ICXA 2XWNA 2ZU7A 4Y6UA 3Q7UA 4FCEA 1I52A 2X65A 4NAKA 2V0JA 5EJZA 2VXMA 2QH5A 4HG6A 4Y7UA 3U0YA 5IDTA 4HO0A 4BQHA 1R80A 1H5RA 1QG8A 1LL0A 3PNNA 2ZU9A 4NALA 2WVMA 1WSZA 2GGOA 3SX8A 2OEGA 1R7TA 4G3PA 1VGUA 1VGZA 2RJ1A 4Y63A 4CJCA 4AC3A 4M28A 5C1GA 2X5ZA 2RJ9A 1H4EA 2AM3A 2OI5A 5C49A 1H5TB 2AH9A 4G3SA 5C38A 5C8RA 2FY7A 5FYEA 3GHZA 5FTVA 2PGYA 1G9RA 3ST8A 2RJ8A 1E5KA 3U2UA 3LW6A 3F1CA 3F6MA 3FWWA 4KPZA 3V8ZA 3Q80A 1R7VA 5C4FA 1INIA 2AM4A 2RJ6A 3FOQA 1GX0A 2I5EA 1NHEB 4B4BA 3T80A 5B8FA 5CMHA 2RITA 2D0JA 2UX8A 1H7TA 3OAMA 3I0GA 4FROA 3JTJA 1FR9A 1NMMB 1H5SA 4UEGA 1YP3A 4LW6A 1G93A 5C1HA 1R81A 1IV1A 2E3DA 1VM8A 1U3LA 1WVCA 4HO5A 2VSHA 3JUJA 3JVHA 5C4CA 4GBPA 2RIZA 1PZTA 2D7RA 4NAIA 4KXOA 2AMTA 4FRPA 2PMPA 2QKXA 3IOHA 4G87A 3CKQA 3OH2A 4B3UA 2V0IA 2RJ4A 4KNRA 1O0RA 3Q8HA 3F0DA 1GQ9A 3P10A 1G95A 1ZDGA 4D11A 2AM5A 3D5NA 1LVWA 1EZIA 3U2XA 1G23A 1TVYA 3O3PA 3PKPA 3FPIA 4HO6A 2Y4JA 3V0PA 5J49A 4DECA 2Z86A 4ASJA 1S4PA 3IOJA 4KRVA 4Y7VA 5DDVA 3SXCA 2Y4MA 1H5TA 1VH8A 1OMZA 3KIAA 4Y9XA 3USRA 3V8YA 4EE3A 5BXCA 1JYLA 2RJ0A 2XWLA 1U40A 1HJLA 1O7QA 2JCJA 5FU0A 1MP5A 4KT7A 4C8EA 2AECA 5EJ1A 5FUHA 3T7NA 4ARWA 1G2VA 2DPWA 1JYKA 1ZIZA 5L6SA 1G97A 3I0JA 2P73A 1VH3A 1H48A 4HOCA 4HO9A 3U2VA 1YP4A 2O1HA 1KNJA 1ZCVA 1WT0A 1Z90A 4EEMA 1LZ0A 1SS9A 3V0NA 2BO6A 5C3DA 4D0TA 3D98A 2AE7A 1JV1A 2FFVA 4B2WA 3V91A 1O23B 1TW5A 1FWYA 2YC3A 1JY8A 1ZI4A 5HS2A 1W57A 4FRHA 1GWVA 1V83A 5C4DA 4R7PA 4B5BA 5FV9A 1WT3A 1K4VA
chains in the Genus database with same CATH superfamily
3CCQF 4BT7A 4X20A 3LYBA 5GIPC 1LL2A 4FROA 2OHWA 2Z1UA 3E20B 2H6LA 4O4LA 5HXUA 1JJ2F 3CPWF 3I0HA 1O7OA 2RHLA 4EEOA 1PF5A 4ZI7B 1NQIB 1HV9A 1IIMA 1IV4A 4CJ8A 3OBYA 1VK3A 3N4YA 3CYPB 5C36A 1VGTA 2W0WA 4ZHWA 4P00A 4B2XA 2VXYA 4AYJA 4I4TB 2CHSA 4C8GA 3JAMM 1K8AH 2OI7A 4O4IB 3CGXA 4XCQA 1H7HA 1WT2A 4IIJA 1H7FA 3T7MA 5C4BA 2X60A 2LBXA 3WPWA 1ZJPA 2YQSA 3HKDB 4BVSA 3DJ4A 3CMEF 2HVYD 1VQ7F 3WGJA 1E7KA 1V84A 3LWQC 4B62A 4CJBA 1ZJ2A 4O4HB 4G4XA 2RIXA 4X1IA 5GONA 2HQSC 2HX0A 2ZODA 1VGWA 4IRQA 5J2TB 1G8OA 1FGGA 1JVDA 1ZCUA 2KTUA 4KPXA 3C9SA 2YYEA 4TV8B 3WXMB 1V82A 2D7IA 3JUKA 4HO8A 4ASYA 5GANK 5C48A 4G4VA 3CKVA 3WJPA 1H7GA 2N48A 2KTVA 3E22A 2GVIA 2Z1EA 4F6RA 4B4MA 3PAFA 1NQ3A 3HKBA 3D01A 3OKRA 5MN5A 1R7UA 1RA4A 2OTLF 1OQMB 3D54A 1YQNA 5C8YB 1GA8A 1Q7YH 2X5SA 3POLA 3HKEA 3RE3A 3S0YA 4C4WC 3N4ZA 5FNVA 1GQCA 2Y7AA 2PHNA 1W5BA 1H7EA 5JQGA 4L41C 4AAWA 1QGQA 2I6DA 5IDSA 1JN1A 1XBIA 2I7BA 1H5RB 4FRMA 5CMIA 4AYLA 3TD4A 3MQWA 1YGYA 5CA0B 2ZAUA 2GZLA 3U0OA 5FLXM 5D91A 1YROB 1W581 1QGSA 5CMFX 1W5FA 2VS3A 3E26A 3I0EA 4Y7TA 3SX7A 5LYJA 2VK9A 1FG5N 1RLGA 5LP6A 5LXTB 3OONA 4DXDA 2Y4LA 1T0KB 4MYBA 1VZTA 3I0CA 1NF5B 2DT4A 3F0FA 2CU2A 5G4VC 4BMAA 3C9TA 2I5KA 1UI9A 3U2TA 5IDTA 5C1LA 2BO7A 2UYNA 2XWMA 5EB1B 3I0KA 2BTUA 2CSLA 1VQNF 1LZJA 5JVDA 3NMUC 2WEEA 4XWIA 4BVQA 3N2GA 4O2BA 4PWTA 2OEFA 2FYCB 2VS5A 2Y6PA 4YS8A 5I1FA 1FNJA 3DUVA 1FNKA 2HP3A 3QHDA 2YCMA 3K8DA 1ZCYA 3OC9A 3OH3A 2WVLA 3BRKX 4IRPA 1MP3A 4Y7FA 3E1YA 5LOVB 1GX4A 2QA4F 3JALA 5G4UC 3FBAA 3CKOA 4O6NA 3RSBA 3WGLA 1X25A 3B6NA 3F0EA 4E6EA 1SA0A 2W0VA 4E1KA 2ZU8A 5IYZB 4LW3A 2MQEA 1VQMF 3C8LA 5FTSA 3I3FA 5HWEA 1MC3A 4HO2A 3K14A 2OI6A 4I50A 4YJ2B 3LFOA 4BVTA 4FREA 1JFFB 3BYQA 4X1YA 2VAPA 3GYQA 4R40B 4B42A 5C4EA 1U43A 4Y7GA 3V7EA 3HKDA 3GTZA 3U0XA 5IFYA 4KWEA 3RA6A 2I6RA 1ZJ1A 2P72A 2HS0A 1COMA 3C9UA 4JISA 1ON8A 4Y6NA 3V0LA 3NK6A 3JAWB 4C8IA 3DK5A 4X1IB 5GONB 1HJJA 5LA6B 3QVBA 5CB4A 3NGWA 3OH0A 4X1KB 1ON6A 1FO9A 1H7QA 3SXEA 4TZZA 2WGZA 4Y64A 1DT9A 3RYHB 2ZF8A 1EYRA 1H3MA 4G3QA 4FFBA 3RYIA 1H5SC 3HL3A 2RHOA 4BVRA 1NKHB 1QWJA 1ZDFA 2VS4A 4F6RB 3SXBA 3JCMM 5CQOA 4ECMA 3HKBB 2BO8A 1IV3A 3G4SF 3LWOC 3MCQA 4FRLA 1TZFA 2HP0A 5C47A 3SX5A 5C3BA 2JCLA 3CU0A 3M1XA 5C8YA 4X20B 3IEWA 1JD1A 3OGZA 4FRBA 2AGDA 3UT5A 2VD4A 2LCAA 4WBNB 2CW4A 4ZHQB 1GO0A 2P6WA 3OH1A 4KC4A 5EO3A 1G0RA 1ZI5A 2FYAA 1QD9A 4ZOLB 2VXLA 3VOAA 5CQMX 5J2UB 3CMAF 3TQDA 1M1KH 3ESJA 4DDZA 3FD6A 2Y4KA 5GIOC 2L26A 4M2BA 3LWRC 4K6RA 3ZP7A 1PZYB 2O1GA 4FRDA 4NUTA 1S4OA 4O4IA 1YHQF 1DBFA 1H5SD 1FRWA 1KD1H 1K9MH 1KQSF 2JCKA 1W59A 2VSIA 4U3JB 4HCQA 3FD5A 4FCUA 1FFXB 1ZJ3A 2V0KA 1W55A 1QVGF 2ICYA 4FQWA 3SXDA 5JVDB 2V0HA 2HRYA 2JNBA 3M84A 3ZGGA 3HKCA 3G71F 3JATA 3R2WA 3WGNA 4Q7CA 3Q4SA 3T7OA 1W41A 2FC3A 2WAWA 5JH7A 2UZHA 3HTNA 3IKFA 2O1FA 3CKNA 2FYBA 5EIYA 3GUEA 4Y6UA 3IKEA 2LBWA 1ZHJA 2YC5A 5CQPA 3CCVF 3ELCA 4M4KA 4M2AA 1SA0B 5IJ0B 2UYJA 3HKEB 1CLIA 1W40A 1KWSA 3BCVA 4RQOA 3JASB 3LWPC 2QGIA 4DRXA 1XHOA 5HP7A 1OMXA 5AJPA 3EE5A 1FXOA 5AJOA 3IEQA 5IJ9B 5ITZB 1LZIA 2C0NA 1TUBB 3MBMA 3V0QA 1FSZA 3SIVA 4MNDA 3V3TA 1VHAA 3KIZA 3S03A 3TZTA 3R3IA 4O4JB 3U2WA 5DCVA 1R1MA 5EAZA 1JV3A 1LZ7A 1FR8A 4EVWA 3ERNA 3USQA 3JARA 2PGVA 2P6YA 1LL3A 4ZDQA 3P0ZA 4M8IA 3ZGFA 2BO1A 3NVKE 1XZ6A 4KC1A 3RMVA 5DDTA 4G4ZA 4J18A 5CMGX 3VYSC 1VQVA 3OW2F 3RYFB 1R82A 1IV2A 3N2GB 3SXGA 3RA5A 1UFYA 5KX5A 2YQJA 2G9IA 3K8EA 1H4CA 1HM9A 3F0GA 5FU8A 3VI6A 4C82A 1YIJF 3E22B 2NXVA 1ODEA 2XMHA 5JCOC 3RYCB 3K12A 2Z87A 3E25A 3LDTA 3OH4A 3LMEA 4HO3A 4KNXA 3V0OA 2V0LA 2PX7A 2AIZP 5CQLX 3RMWA 5C3AA 4O4LB 2YQHA 3C9RA 4B4GA 2BO4A 1Q86H 3NVIB 1T0AA 2E8BA 3VMFB 2ZOVA 1FOAA 3N9WA 3PLAC 1X7OA 2QTPA 1GO1A 1RQ2A 4ERHA 3KE1A 1GWWA 5JQQA 3SX3A 4ZHYB 2IAFA 3JAKB 3V90A 3EORA 5EIBC 4U3JA 1QU9A 3ZO8A 4TV9A 2ZVZA 5IT9M 1FXJA 1VICA 1FFXA 2QEXF 4IHJA 2Z1FA 4D11C 2A8UA 3SPTA 5CQNX 4B45A 5HP8A 1X52A 3WGMA 4X1KA 1ZI1A 2YESA 3VO8A 1VZXA 4KC2A 1HM0A 3MDOA 4HNAA 5BMVA 5AJNA 5A2QM 1Z5VA 3CCSF 4JD0A 2EWCA 2Q4JA 4CVHA 1MP4A 1Q81H 1FGXA 1SZQA 1ZWZA 2WE9A 4NANA 4TV8A 2RHJA 4O2BB 1K73H 3ZF8A 5FJ4C 3CCEF 3I0DA 5CA1B 3V0MA 1IINA 4EEAA 3SIUA 1VPAA 3CCRF 1ZCTA 2MZBA 3AGKA 4NWOB 3K2XA 2RJ7A 2APCA 2RHHA 3I0IX 5EYPA 4BT5A 3SXAA 1VZUA 1H4DA 3F1YA 4LNUA 1ZJOA 1QVFF 2A8WA 1KNKA 1S4NA 5CMJA 1M90H 2J0AA 1GX1A 4EE5A 4C81A 5JQGB 1GZ0A 3PKQA 5L6VA 3WJQA 3D8VA 2FFUA 5KMGB 1KC8H 4FRAA 2PA4A 4BT4A 4DE7A 2WALA 4D0ZA 4ZI7A 2RIYA 5JCOA 3D00A 4I55B 2K1SA 3S0WA 4BT3A 1VH1A 4EEGA 4P02A 1TVKB 2ALEA 2W8BC 2VGNA 1JVGA 2XMEA 1G3LA 1VQLF 1HM8A 1XHBA 2FYDB 3I0FA 4EI7A 2DYYA 2J0BA 1TW1A 2YQCA 3CYQA 3QTYA 2WVKA 1R7YA 2B33A 4B46A 5MN6A 1H5SB 2CZWA 1U3PA 4TUYA 3I0LA 2UYNB 4EE4A 2VFZA 4FIYA 1W42A 3ZLKA 3IOIA 1FZWA 1ZI3A 2JCOA 1H47A 4HO4A 1OAPA 1NWGB 2RJ5A 4D48A 1INJA 3CCUF 1FO8A 3IMPA 4FRQA 1R7XA 4G4YA 1WT1A 3N2KA 2GGQA 4KQLA 1W77A 4EB6A 2AESA 1YP2A 2F9ZC 1H7LA 3ZLLA 4ZOLA 3VCZA 5EWRA 5J2UA 2KG4A 1G1LA 3CKJA 1ZJ0A 4C2SA 2ICXA 2XWNA 2HS4A 2ZU7A 3Q7UA 4FCEA 2Z01A 3WJRA 1I52A 2X65A 4NAKA 4TV9B 2V0JA 5EJZA 2VXMA 2QH5A 4HG6A 2RB9A 2OTJF 5GAPK 4Y7UA 4EI9A 3J7AR 3VOBA 3JARB 3CC7F 1YI2F 3FFMA 4O2AB 4HO0A 3U0YA 4BQHA 1R80A 1H5RA 1XV2A 3CXCF 4HNAB 5BMVB 3ZP4A 1LL0A 1QG8A 2ZU9A 3PNNA 5CA0A 3I56F 2WVMA 4NALA 3TD5A 2ZVYA 1WSZA 1W5AA 2VAMA 3CB2A 1J7HA 5LA6A 1R7TA 2GGOA 2OEGA 4G3PA 3SX8A 2BTQB 5LYJB 1VGUA 1VGZA 1IPAA 5AVMA 3V7QA 2RJ1A 3ZOPA 4Y63A 4CJCA 4AC3A 4IIJB 4NQ3A 5JH7B 4M28A 5C1GA 2X5ZA 2RJ9A 1H4EA 2AM3A 2OI5A 5C49A 3RYCA 1H5TB 5EYPB 4B5CA 2UYPA 2AH9A 4G3SA 1PXWA 5C38A 4O4HA 4U39A 2Q1YA 5C8RA 5IJ0A 2VAWA 2FY7A 3GHZA 2FGYA 5FYEA 1X7PA 5FTVA 2PGYA 5EZYA 2OZBA 3KHNA 1G9RA 3ST8A 2RJ8A 1E5KA 3U2UA 1ONIA 4DRXB 3LW6A 3F1CA 1Z5WA 3F6MA 3G6EF 3FWWA 4KPZA 3V8ZA 3TD3A 3Q80A 1R7VA 5C4FA 5IJ9A 5ITZA 1INIA 1TUBA 5LOVA 2R6R1 3WGKA 2AM4A 3KJKA 3JALB 5EB0A 2RJ6A 3FOQA 2KGWA 2Q1XA 4LCKA 4I55A 1GX0A 1NHEB 2I5EA 3S02A 4B4BA 4O4JA 4G88A 3T80A 5B8FA 3HJWC 5CMHA 5IYZA 4IHJB 2RITA 2D0JA 2UX8A 1H7TA 4I50B 4YJ2A 1VQ5F 3I0GA 3CPQA 5GINC 1FR9A 3JTJA 3OAMA 1NMMB 3S06A 1H5SA 3IR9A 1N8RH 5HY0A 4TUYB 3I55F 4UEGA 1YP3A 4LW6A 1G93A 4ZHVA 4X3MA 4YJ3B 5C1HA 4I4TA 1R81A 2HRUA 3ON1A 1IV1A 5LXTA 2E3DA 5CA1A 1U3LA 3DC2A 3HWUA 1VM8A 1S72F 1WVCA 4HO5A 1VQOF 2LBTA 2VSHA 3JUJA 1SDSA 3JVHA 4MIXA 4EB6B 5C4CA 4GBPA 3RYHA 4LNUB 3NK7A 2RIZA 1PZTA 2D7RA 4NAIA 4KXOA 2AMTA 3J81M 1OFUA 5HY4A 3CCMF 4FIXA 3J80M 2PMPA 3QUWA 4FRPA 2QKXA 2BTOA 3IOHA 4G87A 2GLZA 1YITF 3CKQA 3OH2A 4B3UA 3VYUC 2V0IA 3OBWA 2RJ4A 3UT5B 4KNRA 1O0RA 3Q8HA 4RHAA 4BT2A 4ZHQA 5KMGA 1W2BF 3F0DA 3CCLF 3P10A 1G95A 1GQ9A 1ZDGA 4D11A 1VQKF 3JAKA 2AM5A 1W3EX 3D5NA 3CCJF 1LVWA 1EZIA 3U2XA 1TVKA 1W5EA 4ZK7A 1G23A 1TVYA 3O3PA 3PKPA 1RQ7A 3FPIA 3KJJA 4BT6A 2NMUA 4HO6A 2Y4JA 3V0PA 3I7TA 3MCAB 3DDNA 3P4EA 2YXZA 3O85A 4DECA 5J49A 2Z86A 4X1YB 1VQ4F 4ASJA 1S4PA 3IOJA 2QI2A 3VYTC 4KRVA 4Y7VA 5DDVA 3SXCA 1NMUB 1H5TA 1VH8A 1OMZA 2Y4MA 3KIAA 4Y9XA 3USRA 3V8YA 4EE3A 2UYKA 4X3LA 3S0HA 5BXCA 1JYLA 1CN7A 2RJ0A 5LP6B 1Q8RA 2XWLA 1U40A 5LP6C 3HAXD 5EIBD 2VGMA 1HJLA 4O6MA 1H7MA 3N2KB 3WPXA 1O7QA 3JATB 2JCJA 5FU0A 1QAHA 1MP5A 2Z1TA 3L7QA 4C8EA 4KT7A 2AECA 5EJ1A 3VTIC 5FUHA 3T7NA 4EI8A 2H8EA 4ARWA 5J2TA 1G2VA 1YJ9F 2DPWA 2HP0B 4Y62A 1JYKA 3K0TA 1ZIZA 4WBNA 5L6SA 3JASA 2R751 5HY1A 1VQ9F 1G97A 3I0JA 3CG6A 2H8CA 1VH3A 2P73A 2IQQA 4O2AA 1YJWF 5D92A 1H48A 4HOCA 2V9YA 4G4WA 1XRGA 4HO9A 1RLUA 3U2VA 2AIFA 2CHTA 1YP4A 3CC2F 2O1HA 5HY2A 1VQPF 1KNJA 5FNVB 1ZCVA 1WT0A 1VQ6F 2OTMA 4YJ3A 1Z90A 4BY9D 4EEMA 1CK2A 1NJIH 1LZ0A 1SS9A 3V0NA 1JFFA 2CWJA 1YJNF 1Q82H 2BO6A 4D0TA 3D98A 5C3DA 2AE7A 1JV1A 2FFVA 4B2WA 3V91A 1VQ8F 5MN4A 4BW0B 3LWVC 3V4DA 1FWYA 1O23B 1TW5A 2IG8A 2YC3A 1JY8A 3JAWA 2HS3A 1ZI4A 3RYFA 5HS2A 1W57A 3CC4F 4FRHA 5CB4B 5EZYB 3HKCB 5KX5B 2CVLA 3M4SA 3VIUA 3R0PA 5HXZA 1GWVA 1V83A 4FFBB 3RYIB 5C4DA 3CD6F 4R7PA 4B5BA 5FV9A 1WT3A 1K4VA
chains in the Genus database with same CATH topology
1LL2A 3I0HA 1O7OA 4EEOA 1NQIB 1HV9A 1IIMA 1IV4A 4CJ8A 5C36A 1VGTA 2W0WA 4P00A 4B2XA 4AYJA 4C8GA 2OI7A 3CGXA 3T7MA 1H7HA 1WT2A 1H7FA 5C4BA 2X60A 2YQSA 1ZJPA 3DJ4A 1V84A 4CJBA 1ZJ2A 2RIXA 1VGWA 4KPXA 1G8OA 1FGGA 1JVDA 1ZCUA 1V82A 2D7IA 3JUKA 4HO8A 4ASYA 5C48A 3CKVA 1H7GA 4B4MA 3OKRA 1R7UA 1OQMB 1YQNA 3POLA 1GA8A 2X5SA 3RE3A 1GQCA 2Y7AA 1H7EA 4L41C 4AAWA 1QGQA 5IDSA 1JN1A 2I7BA 1H5RB 4FRMA 5CMIA 4AYLA 2GZLA 5D91A 1YROB 1QGSA 5CMFX 3SX7A 2VS3A 3E26A 3I0EA 4Y7TA 2VK9A 1FG5N 2Y4LA 4MYBA 1VZTA 3I0CA 1NF5B 3F0FA 2CU2A 4BMAA 2I5KA 3U2TA 5C1LA 2BO7A 2XWMA 3I0KA 1LZJA 2WEEA 4XWIA 4YS8A 2OEFA 2FYCB 2VS5A 2Y6PA 5I1FA 3DUVA 3QHDA 3K8DA 2YCMA 3OC9A 3OH3A 1ZCYA 4IRPA 4IRQA 2WVLA 3BRKX 4Y7FA 1MP3A 1GX4A 3FBAA 3CKOA 4O6NA 3RSBA 2W0VA 3B6NA 3F0EA 4E1KA 2ZU8A 4LW3A 5FTSA 4HO2A 1MC3A 3K14A 2OI6A 4FREA 4B42A 5C4EA 1U43A 4Y7GA 3U0XA 5IFYA 4JISA 4Y6NA 1ZJ1A 2P72A 3V0LA 1ON8A 4C8IA 3DK5A 1HJJA 3QVBA 3NGWA 3OH0A 1ON6A 1FO9A 1H7QA 3SXEA 2WGZA 4Y64A 1H3MA 1EYRA 4G3QA 1H5SC 3HL3A 4Y62A 1NKHB 1ZDFA 1QWJA 2VS4A 3SXBA 4ECMA 5CQOA 2BO8A 1IV3A 5C47A 5C3BA 4FRLA 3SX5A 1TZFA 2JCLA 3CU0A 4FRBA 3OGZA 3IEWA 2AGDA 2VD4A 4KC4A 3OH1A 2P6WA 1G0RA 1ZI5A 2FYAA 2VXLA 5CQMX 3TQDA 4DDZA 3ESJA 4M2BA 2Y4KA 4K6RA 1PZYB 2O1GA 4FRDA 1S4OA 1H5SD 1FRWA 2JCKA 2VSIA 4HCQA 4FCUA 1ZJ3A 2V0KA 1W55A 2ICYA 4FQWA 3SXDA 2V0HA 3ZGGA 4Q7CA 3R2WA 3Q4SA 3T7OA 2WAWA 2UZHA 3IKFA 2O1FA 3CKNA 2FYBA 5EIYA 3GUEA 3IKEA 1ZHJA 5CQPA 2YC5A 3ELCA 4M4KA 4M2AA 3BCVA 1KWSA 2QGIA 1OMXA 5AJPA 3EE5A 1FXOA 5AJOA 3IEQA 1LZIA 2C0NA 3MBMA 3V0QA 4MNDA 1VHAA 3TZTA 3R3IA 3U2WA 1JV3A 1LZ7A 1FR8A 4EVWA 3ERNA 3USQA 2PGVA 1LL3A 4ZDQA 3P0ZA 3ZGFA 1XZ6A 4KC1A 3RMVA 5DDTA 4J18A 5CMGX 1R82A 1IV2A 3SXGA 2YQJA 3K8EA 1H4CA 1HM9A 3F0GA 5FU8A 4C82A 2NXVA 2XMHA 3E25A 2Z87A 3OH4A 4HO3A 4KNXA 3V0OA 2V0LA 2PX7A 3RMWA 5CQLX 5C3AA 2YQHA 4B4GA 2BO4A 3N9WA 1T0AA 2E8BA 1FOAA 3KE1A 1GWWA 5JQQA 3SX3A 3V90A 3EORA 1VICA 1FXJA 4D11C 2A8UA 3SPTA 5CQNX 1ZI1A 2YESA 1VZXA 4KC2A 1HM0A 5AJNA 4JD0A 2Q4JA 4CVHA 1MP4A 1FGXA 4NANA 2WE9A 3ZF8A 3I0DA 3V0MA 1IINA 4EEAA 1VPAA 4P02A 1ZCTA 2MZBA 3K2XA 2RJ7A 2APCA 3I0IX 3SXAA 1VZUA 1H4DA 3F1YA 1ZJOA 2A8WA 1KNKA 1S4NA 5CMJA 2J0AA 1GX1A 4EE5A 4C81A 3PKQA 5L6VA 3D8VA 2FFUA 4FRAA 2PA4A 4DE7A 4D0ZA 2RIYA 4EEGA 1VH1A 2XMEA 1JVGA 1G3LA 1HM8A 1XHBA 2FYDB 3I0FA 2J0BA 1TW1A 2YQCA 2WVKA 1R7YA 1H5SB 1U3PA 3I0LA 4EE4A 2VFZA 4FIYA 3ZLKA 3IOIA 1FZWA 1ZI3A 2JCOA 1H47A 4HO4A 2RJ5A 1NWGB 4D48A 1INJA 1FO8A 4FRQA 1R7XA 1WT1A 2GGQA 4KQLA 1W77A 2AESA 1YP2A 1H7LA 3ZLLA 1G1LA 3CKJA 1ZJ0A 4C2SA 2ICXA 2XWNA 2ZU7A 4Y6UA 3Q7UA 4FCEA 1I52A 2X65A 4NAKA 2V0JA 5EJZA 2VXMA 2QH5A 4HG6A 4Y7UA 3U0YA 5IDTA 4HO0A 4BQHA 1R80A 1H5RA 1QG8A 1LL0A 3PNNA 2ZU9A 4NALA 2WVMA 1WSZA 2GGOA 3SX8A 2OEGA 1R7TA 4G3PA 1VGUA 1VGZA 2RJ1A 4Y63A 4CJCA 4AC3A 4M28A 5C1GA 2X5ZA 2RJ9A 1H4EA 2AM3A 2OI5A 5C49A 1H5TB 2AH9A 4G3SA 5C38A 5C8RA 2FY7A 5FYEA 3GHZA 5FTVA 2PGYA 1G9RA 3ST8A 2RJ8A 1E5KA 3U2UA 3LW6A 3F1CA 3F6MA 3FWWA 4KPZA 3V8ZA 3Q80A 1R7VA 5C4FA 1INIA 2AM4A 2RJ6A 3FOQA 1GX0A 2I5EA 1NHEB 4B4BA 3T80A 5B8FA 5CMHA 2RITA 2D0JA 2UX8A 1H7TA 3OAMA 3I0GA 4FROA 3JTJA 1FR9A 1NMMB 1H5SA 4UEGA 1YP3A 4LW6A 1G93A 5C1HA 1R81A 1IV1A 2E3DA 1VM8A 1U3LA 1WVCA 4HO5A 2VSHA 3JUJA 3JVHA 4MIXA 5C4CA 4GBPA 2RIZA 1PZTA 2D7RA 4NAIA 4KXOA 2AMTA 4FIXA 4FRPA 2PMPA 2QKXA 3IOHA 4G87A 3CKQA 3OH2A 4B3UA 2V0IA 2RJ4A 4KNRA 1O0RA 3Q8HA 3F0DA 1GQ9A 3P10A 1G95A 1ZDGA 4D11A 2AM5A 3D5NA 1LVWA 1EZIA 3U2XA 1G23A 1TVYA 3O3PA 3PKPA 3FPIA 4HO6A 2Y4JA 3V0PA 5J49A 4DECA 2Z86A 4ASJA 1S4PA 3IOJA 4KRVA 4Y7VA 5DDVA 3SXCA 2Y4MA 1H5TA 1VH8A 1OMZA 3KIAA 4Y9XA 3USRA 3V8YA 4EE3A 5BXCA 1JYLA 2RJ0A 2XWLA 1U40A 1HJLA 4O6MA 1O7QA 2JCJA 5FU0A 1MP5A 4KT7A 4C8EA 2AECA 5EJ1A 5FUHA 3T7NA 4ARWA 1G2VA 2DPWA 1JYKA 1ZIZA 5L6SA 1G97A 3I0JA 2P73A 1VH3A 5D92A 1H48A 4HOCA 4HO9A 3U2VA 1YP4A 2O1HA 1KNJA 1ZCVA 1WT0A 1Z90A 4EEMA 1LZ0A 1SS9A 3V0NA 2BO6A 5C3DA 4D0TA 3D98A 2AE7A 1JV1A 2FFVA 4B2WA 3V91A 1O23B 1TW5A 1FWYA 2YC3A 1JY8A 1ZI4A 5HS2A 1W57A 4FRHA 1GWVA 1V83A 5C4DA 4R7PA 4B5BA 5FV9A 1WT3A 1K4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL2 A;  3I0H A;  1O7O A;  4EEO A;  1NQI B;  1HV9 A;  1IIM A;  1IV4 A;  4CJ8 A;  5C36 A;  1VGT A;  2W0W A;  4P00 A;  4B2X A;  4AYJ A;  4C8G A;  2OI7 A;  3CGX A;  3T7M A;  1H7H A;  1WT2 A;  1H7F A;  5C4B A;  2X60 A;  2YQS A;  1ZJP A;  3DJ4 A;  1V84 A;  4CJB A;  1ZJ2 A;  2RIX A;  1VGW A;  4KPX A;  1G8O A;  1FGG A;  1JVD A;  1ZCU A;  1V82 A;  2D7I A;  3JUK A;  4HO8 A;  4ASY A;  5C48 A;  3CKV A;  1H7G A;  4B4M A;  3OKR A;  1R7U A;  1OQM B;  1YQN A;  3POL A;  1GA8 A;  2X5S A;  3RE3 A;  1GQC A;  2Y7A A;  1H7E A;  4L41 C;  4AAW A;  1QGQ A;  5IDS A;  1JN1 A;  2I7B A;  1H5R B;  4FRM A;  5CMI A;  4AYL A;  2GZL A;  1YRO B;  1QGS A;  5CMF X;  3SX7 A;  2VS3 A;  3E26 A;  3I0E A;  4Y7T A;  1FG5 N;  2Y4L A;  4MYB A;  1VZT A;  3I0C A;  1NF5 B;  3F0F A;  2CU2 A;  4BMA A;  2I5K A;  3U2T A;  5C1L A;  2BO7 A;  2XWM A;  3I0K A;  1LZJ A;  2WEE A;  4XWI A;  4YS8 A;  2OEF A;  2FYC B;  2VS5 A;  2Y6P A;  5I1F A;  3DUV A;  3QHD A;  3K8D A;  2YCM A;  3OC9 A;  3OH3 A;  1ZCY A;  4IRP A;  4IRQ A;  2WVL A;  3BRK X;  4Y7F A;  1MP3 A;  1GX4 A;  3FBA A;  3CKO A;  3RSB A;  2W0V A;  3B6N A;  3F0E A;  4E1K A;  2ZU8 A;  4LW3 A;  5FTS A;  4HO2 A;  1MC3 A;  3K14 A;  2OI6 A;  4FRE A;  4B42 A;  5C4E A;  1U43 A;  4Y7G A;  3U0X A;  5IFY A;  4JIS A;  4Y6N A;  1ZJ1 A;  2P72 A;  3V0L A;  1ON8 A;  4C8I A;  3DK5 A;  1HJJ A;  3QVB A;  3NGW A;  3OH0 A;  1ON6 A;  1FO9 A;  1H7Q A;  3SXE A;  2WGZ A;  4Y64 A;  1H3M A;  1EYR A;  4G3Q A;  1H5S C;  3HL3 A;  4Y62 A;  1NKH B;  1ZDF A;  1QWJ A;  2VS4 A;  3SXB A;  4ECM A;  5CQO A;  2BO8 A;  1IV3 A;  5C47 A;  5C3B A;  4FRL A;  3SX5 A;  1TZF A;  2JCL A;  3CU0 A;  4FRB A;  3OGZ A;  3IEW A;  2AGD A;  2VD4 A;  4KC4 A;  3OH1 A;  2P6W A;  1G0R A;  1ZI5 A;  2FYA A;  2VXL A;  5CQM X;  3TQD A;  4DDZ A;  3ESJ A;  4M2B A;  2Y4K A;  4K6R A;  1PZY B;  2O1G A;  4FRD A;  1S4O A;  1H5S D;  1FRW A;  2JCK A;  2VSI A;  4HCQ A;  4FCU A;  1ZJ3 A;  2V0K A;  1W55 A;  2ICY A;  4FQW A;  3SXD A;  2V0H A;  3ZGG A;  3R2W A;  3Q4S A;  3T7O A;  2WAW A;  2UZH A;  3IKF A;  2O1F A;  3CKN A;  2FYB A;  5EIY A;  3GUE A;  3IKE A;  1ZHJ A;  5CQP A;  2YC5 A;  3ELC A;  4M4K A;  4M2A A;  3BCV A;  1KWS A;  2QGI A;  1OMX A;  5AJP A;  3EE5 A;  1FXO A;  5AJO A;  3IEQ A;  1LZI A;  3MBM A;  3V0Q A;  4MND A;  1VHA A;  3TZT A;  3R3I A;  3U2W A;  1JV3 A;  1LZ7 A;  1FR8 A;  4EVW A;  3ERN A;  3USQ A;  2PGV A;  1LL3 A;  4ZDQ A;  3P0Z A;  3ZGF A;  1XZ6 A;  4KC1 A;  3RMV A;  5DDT A;  4J18 A;  5CMG X;  1R82 A;  1IV2 A;  3SXG A;  2YQJ A;  3K8E A;  1H4C A;  1HM9 A;  3F0G A;  5FU8 A;  4C82 A;  2NXV A;  2XMH A;  3E25 A;  2Z87 A;  3OH4 A;  4HO3 A;  4KNX A;  3V0O A;  2V0L A;  2PX7 A;  3RMW A;  5CQL X;  5C3A A;  2YQH A;  4B4G A;  2BO4 A;  3N9W A;  1T0A A;  2E8B A;  1FOA A;  3KE1 A;  1GWW A;  5JQQ A;  3SX3 A;  3V90 A;  3EOR A;  1VIC A;  1FXJ A;  4D11 C;  2A8U A;  3SPT A;  5CQN X;  2YES A;  1ZI1 A;  1VZX A;  4KC2 A;  1HM0 A;  5AJN A;  4JD0 A;  2Q4J A;  4CVH A;  1MP4 A;  1FGX A;  4NAN A;  2WE9 A;  3ZF8 A;  3I0D A;  3V0M A;  1IIN A;  4EEA A;  1VPA A;  4P02 A;  1ZCT A;  2MZB A;  3K2X A;  2RJ7 A;  2APC A;  3I0I X;  3SXA A;  1VZU A;  1H4D A;  3F1Y A;  1ZJO A;  2A8W A;  1KNK A;  1S4N A;  5CMJ A;  1GX1 A;  4EE5 A;  4C81 A;  3PKQ A;  5L6V A;  3D8V A;  2FFU A;  4FRA A;  2PA4 A;  4DE7 A;  4D0Z A;  2RIY A;  4EEG A;  1VH1 A;  2XME A;  1JVG A;  1G3L A;  1HM8 A;  1XHB A;  2FYD B;  3I0F A;  1TW1 A;  2YQC A;  2WVK A;  1R7Y A;  1H5S B;  1U3P A;  3I0L A;  4EE4 A;  2VFZ A;  3ZLK A;  3IOI A;  1FZW A;  1ZI3 A;  2JCO A;  1H47 A;  4HO4 A;  2RJ5 A;  1NWG B;  4D48 A;  1INJ A;  1FO8 A;  4FRQ A;  1R7X A;  1WT1 A;  2GGQ A;  4KQL A;  1W77 A;  2AES A;  1YP2 A;  1H7L A;  3ZLL A;  1G1L A;  3CKJ A;  1ZJ0 A;  4C2S A;  2ICX A;  2XWN A;  2ZU7 A;  4Y6U A;  3Q7U A;  4FCE A;  1I52 A;  2X65 A;  4NAK A;  2V0J A;  5EJZ A;  2VXM A;  2QH5 A;  4HG6 A;  4Y7U A;  3U0Y A;  5IDT A;  4HO0 A;  4BQH A;  1R80 A;  1H5R A;  1QG8 A;  1LL0 A;  3PNN A;  2ZU9 A;  4NAL A;  2WVM A;  1WSZ A;  2GGO A;  3SX8 A;  2OEG A;  1R7T A;  4G3P A;  1VGU A;  1VGZ A;  2RJ1 A;  4Y63 A;  4CJC A;  4AC3 A;  4M28 A;  5C1G A;  2X5Z A;  2RJ9 A;  1H4E A;  2AM3 A;  2OI5 A;  5C49 A;  1H5T B;  2AH9 A;  4G3S A;  5C38 A;  5C8R A;  2FY7 A;  5FYE A;  3GHZ A;  5FTV A;  2PGY A;  1G9R A;  3ST8 A;  2RJ8 A;  1E5K A;  3U2U A;  3LW6 A;  3F1C A;  3F6M A;  3FWW A;  4KPZ A;  3V8Z A;  3Q80 A;  1R7V A;  5C4F A;  1INI A;  2AM4 A;  2RJ6 A;  3FOQ A;  1GX0 A;  2I5E A;  1NHE B;  4B4B A;  3T80 A;  5B8F A;  5CMH A;  2RIT A;  2D0J A;  2UX8 A;  1H7T A;  3OAM A;  3I0G A;  4FRO A;  3JTJ A;  1FR9 A;  1NMM B;  1H5S A;  4UEG A;  1YP3 A;  4LW6 A;  1G93 A;  5C1H A;  1R81 A;  1IV1 A;  2E3D A;  1VM8 A;  1U3L A;  1WVC A;  4HO5 A;  2VSH A;  3JUJ A;  3JVH A;  5C4C A;  4GBP A;  2RIZ A;  1PZT A;  2D7R A;  4NAI A;  4KXO A;  2AMT A;  4FRP A;  2PMP A;  2QKX A;  3IOH A;  4G87 A;  3CKQ A;  3OH2 A;  4B3U A;  2V0I A;  2RJ4 A;  4KNR A;  1O0R A;  3Q8H A;  3F0D A;  1GQ9 A;  3P10 A;  1G95 A;  1ZDG A;  4D11 A;  2AM5 A;  3D5N A;  1LVW A;  1EZI A;  3U2X A;  1G23 A;  1TVY A;  3O3P A;  3PKP A;  3FPI A;  4HO6 A;  2Y4J A;  3V0P A;  5J49 A;  4DEC A;  2Z86 A;  4ASJ A;  1S4P A;  3IOJ A;  4KRV A;  4Y7V A;  5DDV A;  3SXC A;  2Y4M A;  1H5T A;  1VH8 A;  1OMZ A;  3KIA A;  4Y9X A;  3USR A;  3V8Y A;  4EE3 A;  5BXC A;  1JYL A;  2RJ0 A;  2XWL A;  1U40 A;  1HJL A;  1O7Q A;  2JCJ A;  5FU0 A;  1MP5 A;  4KT7 A;  4C8E A;  2AEC A;  5EJ1 A;  5FUH A;  3T7N A;  4ARW A;  1G2V A;  2DPW A;  1JYK A;  1ZIZ A;  5L6S A;  1G97 A;  3I0J A;  2P73 A;  1VH3 A;  1H48 A;  4HOC A;  4HO9 A;  3U2V A;  1YP4 A;  2O1H A;  1KNJ A;  1ZCV A;  1WT0 A;  1Z90 A;  4EEM A;  1LZ0 A;  1SS9 A;  3V0N A;  2BO6 A;  5C3D A;  4D0T A;  3D98 A;  2AE7 A;  1JV1 A;  2FFV A;  4B2W A;  3V91 A;  1O23 B;  1TW5 A;  1FWY A;  2YC3 A;  1JY8 A;  1ZI4 A;  5HS2 A;  1W57 A;  4FRH A;  1GWV A;  1V83 A;  5C4D A;  4R7P A;  4B5B A;  5FV9 A;  1WT3 A;  1K4V A; 
#chains in the Genus database with same CATH topology
 3CCQ F;  4BT7 A;  4X20 A;  3LYB A;  5GIP C;  1LL2 A;  4FRO A;  2OHW A;  2Z1U A;  3E20 B;  2H6L A;  4O4L A;  5HXU A;  1JJ2 F;  3CPW F;  3I0H A;  1O7O A;  2RHL A;  4EEO A;  1PF5 A;  4ZI7 B;  1NQI B;  1HV9 A;  1IIM A;  1IV4 A;  4CJ8 A;  3OBY A;  1VK3 A;  3N4Y A;  3CYP B;  5C36 A;  1VGT A;  2W0W A;  4ZHW A;  4P00 A;  4B2X A;  2VXY A;  4AYJ A;  4I4T B;  2CHS A;  4C8G A;  3JAM M;  1K8A H;  2OI7 A;  4O4I B;  3CGX A;  4XCQ A;  1H7H A;  1WT2 A;  4IIJ A;  1H7F A;  3T7M A;  5C4B A;  2X60 A;  2LBX A;  3WPW A;  1ZJP A;  2YQS A;  3HKD B;  4BVS A;  3DJ4 A;  3CME F;  2HVY D;  1VQ7 F;  3WGJ A;  1E7K A;  1V84 A;  3LWQ C;  4B62 A;  4CJB A;  1ZJ2 A;  4O4H B;  4G4X A;  2RIX A;  4X1I A;  5GON A;  2HQS C;  2HX0 A;  2ZOD A;  1VGW A;  4IRQ A;  5J2T B;  1G8O A;  1FGG A;  1JVD A;  1ZCU A;  2KTU A;  4KPX A;  3C9S A;  2YYE A;  4TV8 B;  3WXM B;  1V82 A;  2D7I A;  3JUK A;  4HO8 A;  4ASY A;  5GAN K;  5C48 A;  4G4V A;  3CKV A;  3WJP A;  1H7G A;  2N48 A;  2KTV A;  3E22 A;  2GVI A;  2Z1E A;  4F6R A;  4B4M A;  3PAF A;  1NQ3 A;  3HKB A;  3D01 A;  3OKR A;  5MN5 A;  1R7U A;  1RA4 A;  2OTL F;  1OQM B;  3D54 A;  1YQN A;  5C8Y B;  1GA8 A;  1Q7Y H;  2X5S A;  3POL A;  3HKE A;  3RE3 A;  3S0Y A;  4C4W C;  3N4Z A;  5FNV A;  1GQC A;  2Y7A A;  2PHN A;  1W5B A;  1H7E A;  5JQG A;  4L41 C;  4AAW A;  1QGQ A;  2I6D A;  5IDS A;  1JN1 A;  1XBI A;  2I7B A;  1H5R B;  4FRM A;  5CMI A;  4AYL A;  3TD4 A;  3MQW A;  1YGY A;  5CA0 B;  2ZAU A;  2GZL A;  3U0O A;  5FLX M;  5D91 A;  1YRO B;  1W58 1;  1QGS A;  5CMF X;  1W5F A;  2VS3 A;  3E26 A;  3I0E A;  4Y7T A;  3SX7 A;  5LYJ A;  2VK9 A;  1FG5 N;  1RLG A;  5LP6 A;  5LXT B;  3OON A;  4DXD A;  2Y4L A;  1T0K B;  4MYB A;  1VZT A;  3I0C A;  1NF5 B;  2DT4 A;  3F0F A;  2CU2 A;  5G4V C;  4BMA A;  3C9T A;  2I5K A;  1UI9 A;  3U2T A;  5IDT A;  5C1L A;  2BO7 A;  2UYN A;  2XWM A;  5EB1 B;  3I0K A;  2BTU A;  2CSL A;  1VQN F;  1LZJ A;  5JVD A;  3NMU C;  2WEE A;  4XWI A;  4BVQ A;  3N2G A;  4O2B A;  4PWT A;  2OEF A;  2FYC B;  2VS5 A;  2Y6P A;  4YS8 A;  5I1F A;  1FNJ A;  3DUV A;  1FNK A;  2HP3 A;  3QHD A;  2YCM A;  3K8D A;  1ZCY A;  3OC9 A;  3OH3 A;  2WVL A;  3BRK X;  4IRP A;  1MP3 A;  4Y7F A;  3E1Y A;  5LOV B;  1GX4 A;  2QA4 F;  3JAL A;  5G4U C;  3FBA A;  3CKO A;  4O6N A;  3RSB A;  3WGL A;  1X25 A;  3B6N A;  3F0E A;  4E6E A;  1SA0 A;  2W0V A;  4E1K A;  2ZU8 A;  5IYZ B;  4LW3 A;  2MQE A;  1VQM F;  3C8L A;  5FTS A;  3I3F A;  5HWE A;  1MC3 A;  4HO2 A;  3K14 A;  2OI6 A;  4I50 A;  4YJ2 B;  3LFO A;  4BVT A;  4FRE A;  1JFF B;  3BYQ A;  4X1Y A;  2VAP A;  3GYQ A;  4R40 B;  4B42 A;  5C4E A;  1U43 A;  4Y7G A;  3V7E A;  3HKD A;  3GTZ A;  3U0X A;  5IFY A;  4KWE A;  3RA6 A;  2I6R A;  1ZJ1 A;  2P72 A;  2HS0 A;  1COM A;  3C9U A;  4JIS A;  1ON8 A;  4Y6N A;  3V0L A;  3NK6 A;  3JAW B;  4C8I A;  3DK5 A;  4X1I B;  5GON B;  1HJJ A;  5LA6 B;  3QVB A;  5CB4 A;  3NGW A;  3OH0 A;  4X1K B;  1ON6 A;  1FO9 A;  1H7Q A;  3SXE A;  4TZZ A;  2WGZ A;  4Y64 A;  1DT9 A;  3RYH B;  2ZF8 A;  1EYR A;  1H3M A;  4G3Q A;  4FFB A;  3RYI A;  1H5S C;  3HL3 A;  2RHO A;  4BVR A;  1NKH B;  1QWJ A;  1ZDF A;  2VS4 A;  4F6R B;  3SXB A;  3JCM M;  5CQO A;  4ECM A;  3HKB B;  2BO8 A;  1IV3 A;  3G4S F;  3LWO C;  3MCQ A;  4FRL A;  1TZF A;  2HP0 A;  5C47 A;  3SX5 A;  5C3B A;  2JCL A;  3CU0 A;  3M1X A;  5C8Y A;  4X20 B;  3IEW A;  1JD1 A;  3OGZ A;  4FRB A;  2AGD A;  3UT5 A;  2VD4 A;  2LCA A;  4WBN B;  2CW4 A;  4ZHQ B;  1GO0 A;  2P6W A;  3OH1 A;  4KC4 A;  5EO3 A;  1G0R A;  1ZI5 A;  2FYA A;  1QD9 A;  4ZOL B;  2VXL A;  3VOA A;  5CQM X;  5J2U B;  3CMA F;  3TQD A;  1M1K H;  3ESJ A;  4DDZ A;  3FD6 A;  2Y4K A;  5GIO C;  2L26 A;  4M2B A;  3LWR C;  4K6R A;  3ZP7 A;  1PZY B;  2O1G A;  4FRD A;  4NUT A;  1S4O A;  4O4I A;  1YHQ F;  1DBF A;  1H5S D;  1FRW A;  1KD1 H;  1K9M H;  1KQS F;  2JCK A;  1W59 A;  2VSI A;  4U3J B;  4HCQ A;  3FD5 A;  4FCU A;  1FFX B;  1ZJ3 A;  2V0K A;  1W55 A;  1QVG F;  2ICY A;  4FQW A;  3SXD A;  5JVD B;  2V0H A;  2HRY A;  2JNB A;  3M84 A;  3ZGG A;  3HKC A;  3G71 F;  3JAT A;  3R2W A;  3WGN A;  4Q7C A;  3Q4S A;  3T7O A;  1W41 A;  2FC3 A;  2WAW A;  5JH7 A;  2UZH A;  3HTN A;  3IKF A;  2O1F A;  3CKN A;  2FYB A;  5EIY A;  3GUE A;  4Y6U A;  3IKE A;  2LBW A;  1ZHJ A;  2YC5 A;  5CQP A;  3CCV F;  3ELC A;  4M4K A;  4M2A A;  1SA0 B;  5IJ0 B;  2UYJ A;  3HKE B;  1CLI A;  1W40 A;  1KWS A;  3BCV A;  4RQO A;  3JAS B;  3LWP C;  2QGI A;  4DRX A;  1XHO A;  5HP7 A;  1OMX A;  5AJP A;  3EE5 A;  1FXO A;  5AJO A;  3IEQ A;  5IJ9 B;  5ITZ B;  1LZI A;  2C0N A;  1TUB B;  3MBM A;  3V0Q A;  1FSZ A;  3SIV A;  4MND A;  3V3T A;  1VHA A;  3KIZ A;  3S03 A;  3TZT A;  3R3I A;  4O4J B;  3U2W A;  5DCV A;  1R1M A;  5EAZ A;  1JV3 A;  1LZ7 A;  1FR8 A;  4EVW A;  3ERN A;  3USQ A;  3JAR A;  2PGV A;  2P6Y A;  1LL3 A;  4ZDQ A;  3P0Z A;  4M8I A;  3ZGF A;  2BO1 A;  3NVK E;  1XZ6 A;  4KC1 A;  3RMV A;  5DDT A;  4G4Z A;  4J18 A;  5CMG X;  3VYS C;  1VQV A;  3OW2 F;  3RYF B;  1R82 A;  1IV2 A;  3N2G B;  3SXG A;  3RA5 A;  1UFY A;  5KX5 A;  2YQJ A;  2G9I A;  3K8E A;  1H4C A;  1HM9 A;  3F0G A;  5FU8 A;  3VI6 A;  4C82 A;  1YIJ F;  3E22 B;  2NXV A;  1ODE A;  2XMH A;  5JCO C;  3RYC B;  3K12 A;  2Z87 A;  3E25 A;  3LDT A;  3OH4 A;  3LME A;  4HO3 A;  4KNX A;  3V0O A;  2V0L A;  2PX7 A;  2AIZ P;  5CQL X;  3RMW A;  5C3A A;  4O4L B;  2YQH A;  3C9R A;  4B4G A;  2BO4 A;  1Q86 H;  3NVI B;  1T0A A;  2E8B A;  3VMF B;  2ZOV A;  1FOA A;  3N9W A;  3PLA C;  1X7O A;  2QTP A;  1GO1 A;  1RQ2 A;  4ERH A;  3KE1 A;  1GWW A;  5JQQ A;  3SX3 A;  4ZHY B;  2IAF A;  3JAK B;  3V90 A;  3EOR A;  5EIB C;  4U3J A;  1QU9 A;  3ZO8 A;  4TV9 A;  2ZVZ A;  5IT9 M;  1FXJ A;  1VIC A;  1FFX A;  2QEX F;  4IHJ A;  2Z1F A;  4D11 C;  2A8U A;  3SPT A;  5CQN X;  4B45 A;  5HP8 A;  1X52 A;  3WGM A;  4X1K A;  1ZI1 A;  2YES A;  3VO8 A;  1VZX A;  4KC2 A;  1HM0 A;  3MDO A;  4HNA A;  5BMV A;  5AJN A;  5A2Q M;  1Z5V A;  3CCS F;  4JD0 A;  2EWC A;  2Q4J A;  4CVH A;  1MP4 A;  1Q81 H;  1FGX A;  1SZQ A;  1ZWZ A;  2WE9 A;  4NAN A;  4TV8 A;  2RHJ A;  4O2B B;  1K73 H;  3ZF8 A;  5FJ4 C;  3CCE F;  3I0D A;  5CA1 B;  3V0M A;  1IIN A;  4EEA A;  3SIU A;  1VPA A;  3CCR F;  1ZCT A;  2MZB A;  3AGK A;  4NWO B;  3K2X A;  2RJ7 A;  2APC A;  2RHH A;  3I0I X;  5EYP A;  4BT5 A;  3SXA A;  1VZU A;  1H4D A;  3F1Y A;  4LNU A;  1ZJO A;  1QVF F;  2A8W A;  1KNK A;  1S4N A;  5CMJ A;  1M90 H;  2J0A A;  1GX1 A;  4EE5 A;  4C81 A;  5JQG B;  1GZ0 A;  3PKQ A;  5L6V A;  3WJQ A;  3D8V A;  2FFU A;  5KMG B;  1KC8 H;  4FRA A;  2PA4 A;  4BT4 A;  4DE7 A;  2WAL A;  4D0Z A;  4ZI7 A;  2RIY A;  5JCO A;  3D00 A;  4I55 B;  2K1S A;  3S0W A;  4BT3 A;  1VH1 A;  4EEG A;  4P02 A;  1TVK B;  2ALE A;  2W8B C;  2VGN A;  1JVG A;  2XME A;  1G3L A;  1VQL F;  1HM8 A;  1XHB A;  2FYD B;  3I0F A;  4EI7 A;  2DYY A;  2J0B A;  1TW1 A;  2YQC A;  3CYQ A;  3QTY A;  2WVK A;  1R7Y A;  2B33 A;  4B46 A;  5MN6 A;  1H5S B;  2CZW A;  1U3P A;  4TUY A;  3I0L A;  2UYN B;  4EE4 A;  2VFZ A;  4FIY A;  1W42 A;  3ZLK A;  3IOI A;  1FZW A;  1ZI3 A;  2JCO A;  1H47 A;  4HO4 A;  1OAP A;  1NWG B;  2RJ5 A;  4D48 A;  1INJ A;  3CCU F;  1FO8 A;  3IMP A;  4FRQ A;  1R7X A;  4G4Y A;  1WT1 A;  3N2K A;  2GGQ A;  4KQL A;  1W77 A;  4EB6 A;  2AES A;  1YP2 A;  2F9Z C;  1H7L A;  3ZLL A;  4ZOL A;  3VCZ A;  5EWR A;  5J2U A;  2KG4 A;  1G1L A;  3CKJ A;  1ZJ0 A;  4C2S A;  2ICX A;  2XWN A;  2HS4 A;  2ZU7 A;  3Q7U A;  4FCE A;  2Z01 A;  3WJR A;  1I52 A;  2X65 A;  4NAK A;  4TV9 B;  2V0J A;  5EJZ A;  2VXM A;  2QH5 A;  4HG6 A;  2RB9 A;  2OTJ F;  5GAP K;  4Y7U A;  4EI9 A;  3J7A R;  3VOB A;  3JAR B;  3CC7 F;  1YI2 F;  3FFM A;  4O2A B;  4HO0 A;  3U0Y A;  4BQH A;  1R80 A;  1H5R A;  1XV2 A;  3CXC F;  4HNA B;  5BMV B;  3ZP4 A;  1LL0 A;  1QG8 A;  2ZU9 A;  3PNN A;  5CA0 A;  3I56 F;  2WVM A;  4NAL A;  3TD5 A;  2ZVY A;  1WSZ A;  1W5A A;  2VAM A;  3CB2 A;  1J7H A;  5LA6 A;  1R7T A;  2GGO A;  2OEG A;  4G3P A;  3SX8 A;  2BTQ B;  5LYJ B;  1VGU A;  1VGZ A;  1IPA A;  5AVM A;  3V7Q A;  2RJ1 A;  3ZOP A;  4Y63 A;  4CJC A;  4AC3 A;  4IIJ B;  4NQ3 A;  5JH7 B;  4M28 A;  5C1G A;  2X5Z A;  2RJ9 A;  1H4E A;  2AM3 A;  2OI5 A;  5C49 A;  3RYC A;  1H5T B;  5EYP B;  4B5C A;  2UYP A;  2AH9 A;  4G3S A;  1PXW A;  5C38 A;  4O4H A;  4U39 A;  2Q1Y A;  5C8R A;  5IJ0 A;  2VAW A;  2FY7 A;  3GHZ A;  2FGY A;  5FYE A;  1X7P A;  5FTV A;  2PGY A;  5EZY A;  2OZB A;  3KHN A;  1G9R A;  3ST8 A;  2RJ8 A;  1E5K A;  3U2U A;  1ONI A;  4DRX B;  3LW6 A;  3F1C A;  1Z5W A;  3F6M A;  3G6E F;  3FWW A;  4KPZ A;  3V8Z A;  3TD3 A;  3Q80 A;  1R7V A;  5C4F A;  5IJ9 A;  5ITZ A;  1INI A;  1TUB A;  5LOV A;  2R6R 1;  3WGK A;  2AM4 A;  3KJK A;  3JAL B;  5EB0 A;  2RJ6 A;  3FOQ A;  2KGW A;  2Q1X A;  4LCK A;  4I55 A;  1GX0 A;  1NHE B;  2I5E A;  3S02 A;  4B4B A;  4O4J A;  4G88 A;  3T80 A;  5B8F A;  3HJW C;  5CMH A;  5IYZ A;  4IHJ B;  2RIT A;  2D0J A;  2UX8 A;  1H7T A;  4I50 B;  4YJ2 A;  1VQ5 F;  3I0G A;  3CPQ A;  5GIN C;  1FR9 A;  3JTJ A;  3OAM A;  1NMM B;  3S06 A;  1H5S A;  3IR9 A;  1N8R H;  5HY0 A;  4TUY B;  3I55 F;  4UEG A;  1YP3 A;  4LW6 A;  1G93 A;  4ZHV A;  4X3M A;  4YJ3 B;  5C1H A;  4I4T A;  1R81 A;  2HRU A;  3ON1 A;  1IV1 A;  5LXT A;  2E3D A;  5CA1 A;  1U3L A;  3DC2 A;  3HWU A;  1VM8 A;  1S72 F;  1WVC A;  4HO5 A;  1VQO F;  2LBT A;  2VSH A;  3JUJ A;  1SDS A;  3JVH A;  4MIX A;  4EB6 B;  5C4C A;  4GBP A;  3RYH A;  4LNU B;  3NK7 A;  2RIZ A;  1PZT A;  2D7R A;  4NAI A;  4KXO A;  2AMT A;  3J81 M;  1OFU A;  5HY4 A;  3CCM F;  4FIX A;  3J80 M;  2PMP A;  3QUW A;  4FRP A;  2QKX A;  2BTO A;  3IOH A;  4G87 A;  2GLZ A;  1YIT F;  3CKQ A;  3OH2 A;  4B3U A;  3VYU C;  2V0I A;  3OBW A;  2RJ4 A;  3UT5 B;  4KNR A;  1O0R A;  3Q8H A;  4RHA A;  4BT2 A;  4ZHQ A;  5KMG A;  1W2B F;  3F0D A;  3CCL F;  3P10 A;  1G95 A;  1GQ9 A;  1ZDG A;  4D11 A;  1VQK F;  3JAK A;  2AM5 A;  1W3E X;  3D5N A;  3CCJ F;  1LVW A;  1EZI A;  3U2X A;  1TVK A;  1W5E A;  4ZK7 A;  1G23 A;  1TVY A;  3O3P A;  3PKP A;  1RQ7 A;  3FPI A;  3KJJ A;  4BT6 A;  2NMU A;  4HO6 A;  2Y4J A;  3V0P A;  3I7T A;  3MCA B;  3DDN A;  3P4E A;  2YXZ A;  3O85 A;  4DEC A;  5J49 A;  2Z86 A;  4X1Y B;  1VQ4 F;  4ASJ A;  1S4P A;  3IOJ A;  2QI2 A;  3VYT C;  4KRV A;  4Y7V A;  5DDV A;  3SXC A;  1NMU B;  1H5T A;  1VH8 A;  1OMZ A;  2Y4M A;  3KIA A;  4Y9X A;  3USR A;  3V8Y A;  4EE3 A;  2UYK A;  4X3L A;  3S0H A;  5BXC A;  1JYL A;  1CN7 A;  2RJ0 A;  5LP6 B;  1Q8R A;  2XWL A;  1U40 A;  5LP6 C;  3HAX D;  5EIB D;  2VGM A;  1HJL A;  4O6M A;  1H7M A;  3N2K B;  3WPX A;  1O7Q A;  3JAT B;  2JCJ A;  5FU0 A;  1QAH A;  1MP5 A;  2Z1T A;  3L7Q A;  4C8E A;  4KT7 A;  2AEC A;  5EJ1 A;  3VTI C;  5FUH A;  3T7N A;  4EI8 A;  2H8E A;  4ARW A;  5J2T A;  1G2V A;  1YJ9 F;  2DPW A;  2HP0 B;  4Y62 A;  1JYK A;  3K0T A;  1ZIZ A;  4WBN A;  5L6S A;  3JAS A;  2R75 1;  5HY1 A;  1VQ9 F;  1G97 A;  3I0J A;  3CG6 A;  2H8C A;  1VH3 A;  2P73 A;  2IQQ A;  4O2A A;  1YJW F;  5D92 A;  1H48 A;  4HOC A;  2V9Y A;  4G4W A;  1XRG A;  4HO9 A;  1RLU A;  3U2V A;  2AIF A;  2CHT A;  1YP4 A;  3CC2 F;  2O1H A;  5HY2 A;  1VQP F;  1KNJ A;  5FNV B;  1ZCV A;  1WT0 A;  1VQ6 F;  2OTM A;  4YJ3 A;  1Z90 A;  4BY9 D;  4EEM A;  1CK2 A;  1NJI H;  1LZ0 A;  1SS9 A;  3V0N A;  1JFF A;  2CWJ A;  1YJN F;  1Q82 H;  2BO6 A;  4D0T A;  3D98 A;  5C3D A;  2AE7 A;  1JV1 A;  2FFV A;  4B2W A;  3V91 A;  1VQ8 F;  5MN4 A;  4BW0 B;  3LWV C;  3V4D A;  1FWY A;  1O23 B;  1TW5 A;  2IG8 A;  2YC3 A;  1JY8 A;  3JAW A;  2HS3 A;  1ZI4 A;  3RYF A;  5HS2 A;  1W57 A;  3CC4 F;  4FRH A;  5CB4 B;  5EZY B;  3HKC B;  5KX5 B;  2CVL A;  3M4S A;  3VIU A;  3R0P A;  5HXZ A;  1GWV A;  1V83 A;  4FFB B;  3RYI B;  5C4D A;  3CD6 F;  4R7P A;  4B5B A;  5FV9 A;  1WT3 A;  1K4V A; 
#chains in the Genus database with same CATH homology
 1LL2 A;  3I0H A;  1O7O A;  4EEO A;  1NQI B;  1HV9 A;  1IIM A;  1IV4 A;  4CJ8 A;  5C36 A;  1VGT A;  2W0W A;  4P00 A;  4B2X A;  4AYJ A;  4C8G A;  2OI7 A;  3CGX A;  3T7M A;  1H7H A;  1WT2 A;  1H7F A;  5C4B A;  2X60 A;  2YQS A;  1ZJP A;  3DJ4 A;  1V84 A;  4CJB A;  1ZJ2 A;  2RIX A;  1VGW A;  4KPX A;  1G8O A;  1FGG A;  1JVD A;  1ZCU A;  1V82 A;  2D7I A;  3JUK A;  4HO8 A;  4ASY A;  5C48 A;  3CKV A;  1H7G A;  4B4M A;  3OKR A;  1R7U A;  1OQM B;  1YQN A;  3POL A;  1GA8 A;  2X5S A;  3RE3 A;  1GQC A;  2Y7A A;  1H7E A;  4L41 C;  4AAW A;  1QGQ A;  5IDS A;  1JN1 A;  2I7B A;  1H5R B;  4FRM A;  5CMI A;  4AYL A;  2GZL A;  5D91 A;  1YRO B;  1QGS A;  5CMF X;  3SX7 A;  2VS3 A;  3E26 A;  3I0E A;  4Y7T A;  2VK9 A;  1FG5 N;  2Y4L A;  4MYB A;  1VZT A;  3I0C A;  1NF5 B;  3F0F A;  2CU2 A;  4BMA A;  2I5K A;  3U2T A;  5C1L A;  2BO7 A;  2XWM A;  3I0K A;  1LZJ A;  2WEE A;  4XWI A;  4YS8 A;  2OEF A;  2FYC B;  2VS5 A;  2Y6P A;  5I1F A;  3DUV A;  3QHD A;  3K8D A;  2YCM A;  3OC9 A;  3OH3 A;  1ZCY A;  4IRP A;  4IRQ A;  2WVL A;  3BRK X;  4Y7F A;  1MP3 A;  1GX4 A;  3FBA A;  3CKO A;  4O6N A;  3RSB A;  2W0V A;  3B6N A;  3F0E A;  4E1K A;  2ZU8 A;  4LW3 A;  5FTS A;  4HO2 A;  1MC3 A;  3K14 A;  2OI6 A;  4FRE A;  4B42 A;  5C4E A;  1U43 A;  4Y7G A;  3U0X A;  5IFY A;  4JIS A;  4Y6N A;  1ZJ1 A;  2P72 A;  3V0L A;  1ON8 A;  4C8I A;  3DK5 A;  1HJJ A;  3QVB A;  3NGW A;  3OH0 A;  1ON6 A;  1FO9 A;  1H7Q A;  3SXE A;  2WGZ A;  4Y64 A;  1H3M A;  1EYR A;  4G3Q A;  1H5S C;  3HL3 A;  4Y62 A;  1NKH B;  1ZDF A;  1QWJ A;  2VS4 A;  3SXB A;  4ECM A;  5CQO A;  2BO8 A;  1IV3 A;  5C47 A;  5C3B A;  4FRL A;  3SX5 A;  1TZF A;  2JCL A;  3CU0 A;  4FRB A;  3OGZ A;  3IEW A;  2AGD A;  2VD4 A;  4KC4 A;  3OH1 A;  2P6W A;  1G0R A;  1ZI5 A;  2FYA A;  2VXL A;  5CQM X;  3TQD A;  4DDZ A;  3ESJ A;  4M2B A;  2Y4K A;  4K6R A;  1PZY B;  2O1G A;  4FRD A;  1S4O A;  1H5S D;  1FRW A;  2JCK A;  2VSI A;  4HCQ A;  4FCU A;  1ZJ3 A;  2V0K A;  1W55 A;  2ICY A;  4FQW A;  3SXD A;  2V0H A;  3ZGG A;  4Q7C A;  3R2W A;  3Q4S A;  3T7O A;  2WAW A;  2UZH A;  3IKF A;  2O1F A;  3CKN A;  2FYB A;  5EIY A;  3GUE A;  3IKE A;  1ZHJ A;  5CQP A;  2YC5 A;  3ELC A;  4M4K A;  4M2A A;  3BCV A;  1KWS A;  2QGI A;  1OMX A;  5AJP A;  3EE5 A;  1FXO A;  5AJO A;  3IEQ A;  1LZI A;  2C0N A;  3MBM A;  3V0Q A;  4MND A;  1VHA A;  3TZT A;  3R3I A;  3U2W A;  1JV3 A;  1LZ7 A;  1FR8 A;  4EVW A;  3ERN A;  3USQ A;  2PGV A;  1LL3 A;  4ZDQ A;  3P0Z A;  3ZGF A;  1XZ6 A;  4KC1 A;  3RMV A;  5DDT A;  4J18 A;  5CMG X;  1R82 A;  1IV2 A;  3SXG A;  2YQJ A;  3K8E A;  1H4C A;  1HM9 A;  3F0G A;  5FU8 A;  4C82 A;  2NXV A;  2XMH A;  3E25 A;  2Z87 A;  3OH4 A;  4HO3 A;  4KNX A;  3V0O A;  2V0L A;  2PX7 A;  3RMW A;  5CQL X;  5C3A A;  2YQH A;  4B4G A;  2BO4 A;  3N9W A;  1T0A A;  2E8B A;  1FOA A;  3KE1 A;  1GWW A;  5JQQ A;  3SX3 A;  3V90 A;  3EOR A;  1VIC A;  1FXJ A;  4D11 C;  2A8U A;  3SPT A;  5CQN X;  1ZI1 A;  2YES A;  1VZX A;  4KC2 A;  1HM0 A;  5AJN A;  4JD0 A;  2Q4J A;  4CVH A;  1MP4 A;  1FGX A;  4NAN A;  2WE9 A;  3ZF8 A;  3I0D A;  3V0M A;  1IIN A;  4EEA A;  1VPA A;  4P02 A;  1ZCT A;  2MZB A;  3K2X A;  2RJ7 A;  2APC A;  3I0I X;  3SXA A;  1VZU A;  1H4D A;  3F1Y A;  1ZJO A;  2A8W A;  1KNK A;  1S4N A;  5CMJ A;  2J0A A;  1GX1 A;  4EE5 A;  4C81 A;  3PKQ A;  5L6V A;  3D8V A;  2FFU A;  4FRA A;  2PA4 A;  4DE7 A;  4D0Z A;  2RIY A;  4EEG A;  1VH1 A;  2XME A;  1JVG A;  1G3L A;  1HM8 A;  1XHB A;  2FYD B;  3I0F A;  2J0B A;  1TW1 A;  2YQC A;  2WVK A;  1R7Y A;  1H5S B;  1U3P A;  3I0L A;  4EE4 A;  2VFZ A;  4FIY A;  3ZLK A;  3IOI A;  1FZW A;  1ZI3 A;  2JCO A;  1H47 A;  4HO4 A;  2RJ5 A;  1NWG B;  4D48 A;  1INJ A;  1FO8 A;  4FRQ A;  1R7X A;  1WT1 A;  2GGQ A;  4KQL A;  1W77 A;  2AES A;  1YP2 A;  1H7L A;  3ZLL A;  1G1L A;  3CKJ A;  1ZJ0 A;  4C2S A;  2ICX A;  2XWN A;  2ZU7 A;  4Y6U A;  3Q7U A;  4FCE A;  1I52 A;  2X65 A;  4NAK A;  2V0J A;  5EJZ A;  2VXM A;  2QH5 A;  4HG6 A;  4Y7U A;  3U0Y A;  5IDT A;  4HO0 A;  4BQH A;  1R80 A;  1H5R A;  1QG8 A;  1LL0 A;  3PNN A;  2ZU9 A;  4NAL A;  2WVM A;  1WSZ A;  2GGO A;  3SX8 A;  2OEG A;  1R7T A;  4G3P A;  1VGU A;  1VGZ A;  2RJ1 A;  4Y63 A;  4CJC A;  4AC3 A;  4M28 A;  5C1G A;  2X5Z A;  2RJ9 A;  1H4E A;  2AM3 A;  2OI5 A;  5C49 A;  1H5T B;  2AH9 A;  4G3S A;  5C38 A;  5C8R A;  2FY7 A;  5FYE A;  3GHZ A;  5FTV A;  2PGY A;  1G9R A;  3ST8 A;  2RJ8 A;  1E5K A;  3U2U A;  3LW6 A;  3F1C A;  3F6M A;  3FWW A;  4KPZ A;  3V8Z A;  3Q80 A;  1R7V A;  5C4F A;  1INI A;  2AM4 A;  2RJ6 A;  3FOQ A;  1GX0 A;  2I5E A;  1NHE B;  4B4B A;  3T80 A;  5B8F A;  5CMH A;  2RIT A;  2D0J A;  2UX8 A;  1H7T A;  3OAM A;  3I0G A;  4FRO A;  3JTJ A;  1FR9 A;  1NMM B;  1H5S A;  4UEG A;  1YP3 A;  4LW6 A;  1G93 A;  5C1H A;  1R81 A;  1IV1 A;  2E3D A;  1VM8 A;  1U3L A;  1WVC A;  4HO5 A;  2VSH A;  3JUJ A;  3JVH A;  4MIX A;  5C4C A;  4GBP A;  2RIZ A;  1PZT A;  2D7R A;  4NAI A;  4KXO A;  2AMT A;  4FIX A;  4FRP A;  2PMP A;  2QKX A;  3IOH A;  4G87 A;  3CKQ A;  3OH2 A;  4B3U A;  2V0I A;  2RJ4 A;  4KNR A;  1O0R A;  3Q8H A;  3F0D A;  1GQ9 A;  3P10 A;  1G95 A;  1ZDG A;  4D11 A;  2AM5 A;  3D5N A;  1LVW A;  1EZI A;  3U2X A;  1G23 A;  1TVY A;  3O3P A;  3PKP A;  3FPI A;  4HO6 A;  2Y4J A;  3V0P A;  5J49 A;  4DEC A;  2Z86 A;  4ASJ A;  1S4P A;  3IOJ A;  4KRV A;  4Y7V A;  5DDV A;  3SXC A;  2Y4M A;  1H5T A;  1VH8 A;  1OMZ A;  3KIA A;  4Y9X A;  3USR A;  3V8Y A;  4EE3 A;  5BXC A;  1JYL A;  2RJ0 A;  2XWL A;  1U40 A;  1HJL A;  4O6M A;  1O7Q A;  2JCJ A;  5FU0 A;  1MP5 A;  4KT7 A;  4C8E A;  2AEC A;  5EJ1 A;  5FUH A;  3T7N A;  4ARW A;  1G2V A;  2DPW A;  1JYK A;  1ZIZ A;  5L6S A;  1G97 A;  3I0J A;  2P73 A;  1VH3 A;  5D92 A;  1H48 A;  4HOC A;  4HO9 A;  3U2V A;  1YP4 A;  2O1H A;  1KNJ A;  1ZCV A;  1WT0 A;  1Z90 A;  4EEM A;  1LZ0 A;  1SS9 A;  3V0N A;  2BO6 A;  5C3D A;  4D0T A;  3D98 A;  2AE7 A;  1JV1 A;  2FFV A;  4B2W A;  3V91 A;  1O23 B;  1TW5 A;  1FWY A;  2YC3 A;  1JY8 A;  1ZI4 A;  5HS2 A;  1W57 A;  4FRH A;  1GWV A;  1V83 A;  5C4D A;  4R7P A;  4B5B A;  5FV9 A;  1WT3 A;  1K4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...