1ZHJA

Crystal structure of human n-acetylgalactosaminyltransferase (gta) complexed with galactose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
272
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase (NAGAT) Includes: G
publication title Differential Recognition of the Type I and II H Antigen Acceptors by the Human ABO(H) Blood Group A and B Glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 272
sequence length 288
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2005-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zhjA00
3PNNA 4FRPA 4DE7A 1G8OA 1WSZA 2O1GA 5CMFX 5FU0A 1H7FA 4Y7UA 1JV3A 2P6WA 4G3QA 2YQSA 3LW6A 1MC3A 1NWGB 1PZTA 4YS8A 1VGZA 2PA4A 3I0JA 3O3PA 1YP2A 3Q80A 1NQIB 1HJJA 1YP3A 4KNRA 4EEGA 1H5TA 2OI6A 1H7TA 2FFVA 2Z87A 1H5SA 2FYDB 2WEEA 1MP4A 1H7LA 2VD4A 3SXDA 4FRAA 1R7YA 1FOAA 4MYBA 1LL0A 3ST8A 4KRVA 2V0IA 5C4EA 1H3MA 2RJ6A 2Y4LA 4NAIA 3SXCA 1OMXA 4HG6A 4HO2A 3V0MA 4FRDA 3K8DA 4KPXA 5IFYA 5EIYA 3FOQA 3SX3A 2O1HA 2MZBA 1LVWA 2WE9A 2AECA 1ZI4A 4CJBA 2Y7AA 4KC2A 1HM8A 3SXAA 4B2XA 1G0RA 1G9RA 1HV9A 3RMVA 1ZJOA 2BO8A 3HL3A 1NKHB 4M2AA 1R7TA 1W57A 2AM4A 3TQDA 3ZGFA 4IRPA 4DECA 2X65A 1ZIZA 3E25A 3DJ4A 2Y4MA 1TZFA 1G1LA 1H4EA 1ZDFA 2RITA 4P02A 4FRHA 3DK5A 3ZGGA 1OMZA 1TW1A 2I5EA 4B4MA 1O23B 2D7IA 2ICXA 1ZI3A 3OGZA 4G87A 2BO7A 5FU8A 4Y7TA 1INIA 1S4PA 3EE5A 3ZLKA 1VGUA 3V8YA 1GA8A 1QG8A 4D11C 1I52A 5CMHA 3CKOA 1NF5B 1VGTA 5FTSA 5C3DA 4AC3A 1LZ0A 4L41C 4KNXA 1R81A 2P73A 1LL3A 3T7NA 3V0NA 2XWMA 1FWYA 4ARWA 3SX8A 2PGYA 1H7QA 5CQPA 1G2VA 2RJ9A 3QVBA 1FR8A 3U0XA 5C8RA 1H7EA 1V82A 1WT1A 4KPZA 3I0DA 5C1LA 1GQ9A 3SX7A 4EVWA 4CJ8A 1LZIA 1W55A 1G95A 2XMHA 3CKVA 1KWSA 2RIXA 4KC1A 4FRLA 5CMJA 1FRWA 2X60A 4HOCA 1O7QA 2V0KA 3K8EA 5C48A 4Y6UA 1R7VA 1IINA 2E3DA 5C3AA 4EEOA 2YC3A 1WVCA 1FR9A 2RJ0A 3U0YA 1XHBA 5C4FA 1TVYA 1FO9A 5FYEA 4R7PA 1JYKA 4B2WA 3GUEA 4ASJA 4Y9XA 1MP5A 4EE4A 1R7XA 4NANA 3T7MA 3V0PA 4EEAA 2OI5A 2APCA 1V83A 4FCUA 3ZLLA 4M2BA 4Y62A 1O0RA 1R82A 1QWJA 4LW6A 1XZ6A 1H5RA 1G93A 3V90A 1VH1A 2YQHA 2BO4A 2FY7A 3JTJA 4B42A 3I0EA 3NGWA 2RIYA 1S4NA 2RJ8A 3OAMA 3OH4A 3V8ZA 2QH5A 2X5ZA 3OH2A 2V0JA 1ZJ3A 2RJ4A 2VSHA 2ZU7A 3BRKX 3SX5A 1R80A 4CJCA 3U2VA 5EJZA 2QGIA 2OI7A 4EE5A 1V84A 1SS9A 2ZU8A 3I0FA 2W0WA 4EEMA 5FTVA 4LW3A 5AJOA 3U2WA 4J18A 4DDZA 4JISA 1MP3A 1ZCYA 2OEFA 3OH1A 1FXOA 2V0LA 2D0JA 4NALA 3IOHA 1WT0A 3I0CA 1ZI1A 4Y7FA 2UX8A 3R3IA 4B5BA 1ZJ1A 4B3UA 4Y7GA 1QGSA 3Q4SA 5CQNX 1H7HA 2AGDA 2P72A 3JUKA 1H4CA 2RJ5A 4HO0A 4UEGA 3IOIA 2YCMA 2I7BA 1G3LA 1ZDGA 1GWWA 2DPWA 2I5KA 4G3PA 2AH9A 5L6VA 4XWIA 3CU0A 1INJA 5C3BA 2FYBA 1G23A 2FYCB 4EE3A 1FO8A 1Z90A 1WT3A 3Q7UA 5BXCA 1ZJ2A 1PZYB 2VXLA 3DUVA 1E5KA 5AJNA 5C4DA 2A8WA 4E1KA 2ZU9A 4M28A 4KQLA 4D11A 1WT2A 3I0LA 1LZJA 5I1FA 1HJLA 1JYLA 5C36A 3E26A 3T7OA 1H5SC 2AM5A 2Y4KA 4D0TA 4ASYA 2GGOA 3JUJA 1ZJ0A 1EZIA 1OQMB 3USRA 5CMIA 1R7UA 4HO3A 4AYJA 2Y4JA 5AJPA 4AYLA 1FXJA 3USQA 1EYRA 5JQQA 2YQCA 2JCLA 1ON8A 3F1YA 2RIZA 3OH3A 5C1HA 1H7GA 1NMMB 3R2WA 3CKNA 1YP4A 2OEGA 4K6RA 3V91A 1YROB 2QKXA 1ZJPA 5C47A 2YESA 2Y6PA 1FGXA 4KXOA 1H5TB 2YQJA 1H5SB 1TW5A 5DDVA 4HO6A 5HS2A 1NHEB 2AESA 3V0QA 5EJ1A 4JD0A 4FREA 4Y7VA 2WGZA 3RSBA 3U2TA 1K4VA 3PKQA 1H5RB 2RJ1A 1VGWA 3F1CA 3V0OA 4ZDQA 1LZ7A 1FGGA 4HO5A 1VM8A 4Y6NA 2JCOA 2D7RA 4HO9A 3I0HA 2O1FA 5DDTA 1H5SD 1W77A 3CKJA 4B4GA 4BQHA 4D0ZA 3SPTA 4MNDA 4IRQA 1ZI5A 1IIMA 2VS4A 5FV9A 1VPAA 4ECMA 4NAKA 3U2XA 1FZWA 4C2SA 2V0HA 3KIAA 2XMEA 4FRBA 2YC5A 5C4CA 5CQMX 3IOJA 3CGXA 2WVMA 1H4DA 1S4OA 2NXVA 2E8BA 4Y63A 3D5NA 5IDSA 3SXBA 3OC9A 5CQOA 2FYAA 3I0IX 4FRMA 3V0LA 3I0KA 1LL2A 4FCEA 1VZTA 1JV1A 4FRQA 4GBPA 3BCVA 2JCKA 4KT7A 1JVGA 2VFZA 3PKPA 2X5SA 3I0GA 2FFUA 2JCJA 4Y64A 3TZTA 2VS5A 2Q4JA 1HM0A 4HO8A 3SXGA 5CQLX 2GGQA 2RJ7A 4AAWA 3CKQA 4BMAA 1G97A 1GX0A 1ZCUA 2XWLA 2PX7A 1ZHJA 2W0VA 2VSIA 3N9WA 3ZF8A 4B4BA 3POLA 2Z86A 5L6SA 2WAWA 4HO4A 5IDTA 2CU2A 1VICA 1JVDA 4P00A 2A8UA 5C1GA 1VH3A 3D8VA 1GWVA 2AM3A 4CVHA 2WVLA 5J49A 4HCQA 1FG5N 2XWNA 1VZXA 4D48A 3D98A 4M4KA 4KC4A 2VXMA 1ON6A 1ZCTA 5C38A 2BO6A 5FUHA 1QGQA 3OKRA 2PGVA 4G3SA 3SXEA 3U2UA 2ICYA 2WVKA 5C4BA 4FQWA 1ZCVA 2VS3A 4FROA 1O7OA 3OH0A 1GX4A 1HM9A 1VZUA 5CMGX 2AE7A 3FWWA 3RMWA 5C49A 1GQCA
chains in the Genus database with same CATH superfamily
3PNNA 4FRPA 4DE7A 1G8OA 1WSZA 2O1GA 5CMFX 5FU0A 1H7FA 4Y7UA 1JV3A 2P6WA 4G3QA 2YQSA 3LW6A 1MC3A 1NWGB 1PZTA 4YS8A 1VGZA 2PA4A 3I0JA 3O3PA 1YP2A 3Q80A 1NQIB 1HJJA 1YP3A 4KNRA 4EEGA 1H5TA 2OI6A 1H7TA 2FFVA 2Z87A 1H5SA 2FYDB 2WEEA 1MP4A 1H7LA 2VD4A 3SXDA 4FRAA 1R7YA 1FOAA 4MYBA 1LL0A 3ST8A 4KRVA 2V0IA 5C4EA 1H3MA 2RJ6A 2Y4LA 4NAIA 3SXCA 1OMXA 4HG6A 4HO2A 3V0MA 4FRDA 3K8DA 4KPXA 5IFYA 5EIYA 3FOQA 3SX3A 2O1HA 2MZBA 1LVWA 2WE9A 2AECA 1ZI4A 4CJBA 2Y7AA 4KC2A 1HM8A 3SXAA 4B2XA 1G0RA 1G9RA 1HV9A 3RMVA 1ZJOA 2BO8A 3HL3A 1NKHB 4M2AA 1R7TA 1W57A 2AM4A 3TQDA 3ZGFA 4IRPA 4DECA 2X65A 1ZIZA 3E25A 3DJ4A 2Y4MA 1TZFA 1G1LA 1H4EA 1ZDFA 2RITA 4P02A 4FRHA 3DK5A 3ZGGA 1OMZA 1TW1A 2I5EA 4B4MA 1O23B 2D7IA 2ICXA 1ZI3A 3OGZA 4G87A 2BO7A 5FU8A 4Y7TA 1INIA 1S4PA 3EE5A 3ZLKA 1VGUA 3V8YA 1GA8A 1QG8A 4D11C 1I52A 5CMHA 3CKOA 1NF5B 1VGTA 5FTSA 5C3DA 4AC3A 1LZ0A 4L41C 4KNXA 1R81A 4Q7CA 2P73A 1LL3A 3T7NA 3V0NA 2XWMA 1FWYA 4ARWA 3SX8A 2PGYA 1H7QA 5CQPA 1G2VA 2RJ9A 3QVBA 1FR8A 3U0XA 5C8RA 1H7EA 1V82A 1WT1A 4KPZA 3I0DA 5C1LA 1GQ9A 3SX7A 4EVWA 4CJ8A 1LZIA 1W55A 1G95A 2XMHA 3CKVA 1KWSA 2RIXA 4KC1A 4FRLA 5CMJA 1FRWA 2X60A 4HOCA 1O7QA 2V0KA 3K8EA 5C48A 4Y6UA 1R7VA 1IINA 2E3DA 5C3AA 4FIXA 4EEOA 2YC3A 1WVCA 1FR9A 2RJ0A 4O6NA 3U0YA 1XHBA 5C4FA 1TVYA 1FO9A 5FYEA 4R7PA 1JYKA 4B2WA 3GUEA 4ASJA 4Y9XA 1MP5A 4EE4A 1R7XA 4NANA 3T7MA 3V0PA 4EEAA 2OI5A 2APCA 4FIYA 1V83A 4FCUA 3ZLLA 4M2BA 4Y62A 1O0RA 1R82A 1QWJA 4LW6A 5D91A 1XZ6A 1H5RA 1G93A 3V90A 1VH1A 2YQHA 2BO4A 2FY7A 3JTJA 4B42A 3I0EA 3NGWA 2RIYA 1S4NA 2RJ8A 3OAMA 3OH4A 3V8ZA 2QH5A 2X5ZA 3OH2A 2V0JA 1ZJ3A 2RJ4A 2VSHA 2ZU7A 3BRKX 3SX5A 1R80A 4CJCA 3U2VA 5EJZA 2QGIA 2OI7A 4EE5A 1V84A 1SS9A 2ZU8A 3I0FA 2W0WA 4EEMA 5FTVA 4LW3A 5AJOA 3U2WA 4J18A 4DDZA 4JISA 1MP3A 1ZCYA 2OEFA 3OH1A 1FXOA 2V0LA 2D0JA 4NALA 3IOHA 1WT0A 3I0CA 1ZI1A 4Y7FA 2UX8A 3R3IA 4B5BA 1ZJ1A 4B3UA 4Y7GA 1QGSA 3Q4SA 5CQNX 1H7HA 2AGDA 2P72A 3JUKA 1H4CA 2RJ5A 4HO0A 4UEGA 3IOIA 2YCMA 2I7BA 1G3LA 1ZDGA 1GWWA 2DPWA 2I5KA 4G3PA 2AH9A 5L6VA 4XWIA 3CU0A 1INJA 5C3BA 2FYBA 2J0BA 1G23A 2FYCB 4EE3A 1FO8A 1Z90A 1WT3A 3Q7UA 5BXCA 1ZJ2A 2C0NA 1PZYB 2VXLA 3DUVA 1E5KA 5AJNA 5D92A 5C4DA 2A8WA 4E1KA 2ZU9A 4M28A 4KQLA 4D11A 1WT2A 3I0LA 1LZJA 5I1FA 1HJLA 1JYLA 5C36A 3E26A 3T7OA 1H5SC 2AM5A 2Y4KA 4D0TA 4ASYA 2GGOA 3JUJA 1ZJ0A 1EZIA 1OQMB 3USRA 5CMIA 1R7UA 4HO3A 4AYJA 2Y4JA 5AJPA 4AYLA 1FXJA 3USQA 1EYRA 5JQQA 2YQCA 2JCLA 1ON8A 3F1YA 2RIZA 3OH3A 5C1HA 1H7GA 1NMMB 3R2WA 3CKNA 1YP4A 2OEGA 4K6RA 3V91A 1YROB 2QKXA 1ZJPA 5C47A 2YESA 2Y6PA 1FGXA 4KXOA 1H5TB 2YQJA 1H5SB 1TW5A 5DDVA 4HO6A 5HS2A 1NHEB 2AESA 3V0QA 5EJ1A 4JD0A 4FREA 4Y7VA 2WGZA 3RSBA 3U2TA 1K4VA 3PKQA 1H5RB 4O6MA 2RJ1A 1VGWA 3F1CA 3V0OA 4ZDQA 1LZ7A 1FGGA 4HO5A 1VM8A 4Y6NA 2JCOA 2D7RA 4HO9A 3I0HA 2O1FA 5DDTA 1H5SD 1W77A 3CKJA 4B4GA 4BQHA 4D0ZA 3SPTA 4MNDA 4IRQA 1ZI5A 1IIMA 2VS4A 5FV9A 1VPAA 4ECMA 4NAKA 3U2XA 1FZWA 4C2SA 2V0HA 3KIAA 2XMEA 4FRBA 2YC5A 5C4CA 5CQMX 3IOJA 3CGXA 2WVMA 1H4DA 1S4OA 2NXVA 2E8BA 4Y63A 3D5NA 5IDSA 3SXBA 3OC9A 5CQOA 2FYAA 3I0IX 4FRMA 3V0LA 3I0KA 1LL2A 4FCEA 1VZTA 1JV1A 4FRQA 4GBPA 3BCVA 2JCKA 4KT7A 1JVGA 2VFZA 3PKPA 2X5SA 3I0GA 2J0AA 2FFUA 2JCJA 4Y64A 3TZTA 2VS5A 2Q4JA 1HM0A 4HO8A 3SXGA 5CQLX 2GGQA 2RJ7A 4AAWA 3CKQA 4BMAA 1G97A 1GX0A 1ZCUA 2XWLA 2PX7A 1ZHJA 2W0VA 2VSIA 3N9WA 3ZF8A 4B4BA 3POLA 2Z86A 5L6SA 2WAWA 4HO4A 5IDTA 2CU2A 1VICA 1JVDA 4P00A 2A8UA 5C1GA 1VH3A 3D8VA 1GWVA 2AM3A 4CVHA 2WVLA 5J49A 4HCQA 1FG5N 2XWNA 1VZXA 4D48A 3D98A 4M4KA 4KC4A 2VXMA 1ON6A 1ZCTA 5C38A 2BO6A 5FUHA 1QGQA 3OKRA 2PGVA 4G3SA 3SXEA 3U2UA 4MIXA 2ICYA 2VK9A 2WVKA 5C4BA 4FQWA 1ZCVA 2VS3A 4FROA 1O7OA 3OH0A 1GX4A 1HM9A 1VZUA 5CMGX 2AE7A 3FWWA 3RMWA 5C49A 1GQCA
chains in the Genus database with same CATH topology
3PNNA 4FRPA 4DE7A 1G8OA 1WSZA 2O1GA 5CMFX 5FU0A 1H7FA 4Y7UA 1JV3A 2P6WA 4G3QA 2YQSA 3LW6A 1MC3A 1NWGB 1PZTA 4YS8A 1VGZA 2PA4A 3I0JA 3O3PA 1YP2A 3Q80A 1NQIB 1HJJA 1YP3A 4KNRA 4EEGA 1H5TA 2OI6A 1H7TA 2FFVA 2Z87A 1H5SA 2FYDB 2WEEA 1MP4A 1H7LA 2VD4A 3SXDA 4FRAA 1R7YA 1FOAA 4MYBA 1LL0A 3ST8A 4KRVA 2V0IA 5C4EA 1H3MA 2RJ6A 2Y4LA 4NAIA 3SXCA 1OMXA 4HG6A 4HO2A 3V0MA 4FRDA 3K8DA 4KPXA 5IFYA 5EIYA 3FOQA 3SX3A 2O1HA 2MZBA 1LVWA 2WE9A 2AECA 1ZI4A 4CJBA 2Y7AA 4KC2A 1HM8A 3SXAA 4B2XA 1G0RA 1G9RA 1HV9A 3RMVA 1ZJOA 2BO8A 3HL3A 1NKHB 4M2AA 1R7TA 1W57A 2AM4A 3TQDA 3ZGFA 4IRPA 4DECA 2X65A 1ZIZA 3E25A 3DJ4A 2Y4MA 1TZFA 1G1LA 1H4EA 1ZDFA 2RITA 4P02A 4FRHA 3DK5A 3ZGGA 1OMZA 1TW1A 2I5EA 4B4MA 1O23B 2D7IA 2ICXA 1ZI3A 3OGZA 4G87A 2BO7A 5FU8A 4Y7TA 1INIA 1S4PA 3EE5A 3ZLKA 1VGUA 3V8YA 1GA8A 1QG8A 4D11C 1I52A 5CMHA 3CKOA 1NF5B 1VGTA 5FTSA 5C3DA 4AC3A 1LZ0A 4L41C 4KNXA 1R81A 4Q7CA 2P73A 1LL3A 3T7NA 3V0NA 2XWMA 1FWYA 4ARWA 3SX8A 2PGYA 1H7QA 5CQPA 1G2VA 2RJ9A 3QVBA 1FR8A 3U0XA 5C8RA 1H7EA 1V82A 1WT1A 4KPZA 3I0DA 5C1LA 1GQ9A 3SX7A 4EVWA 4CJ8A 1LZIA 1W55A 1G95A 2XMHA 3CKVA 1KWSA 2RIXA 4KC1A 4FRLA 5CMJA 1FRWA 2X60A 4HOCA 1O7QA 2V0KA 3K8EA 5C48A 4Y6UA 1R7VA 1IINA 2E3DA 5C3AA 4FIXA 4EEOA 2YC3A 1WVCA 1FR9A 2RJ0A 4O6NA 3U0YA 1XHBA 5C4FA 1TVYA 1FO9A 5FYEA 4R7PA 1JYKA 4B2WA 3GUEA 4ASJA 4Y9XA 1MP5A 4EE4A 1R7XA 4NANA 3T7MA 3V0PA 4EEAA 2OI5A 2APCA 4FIYA 1V83A 4FCUA 3ZLLA 4M2BA 4Y62A 1O0RA 1R82A 1QWJA 4LW6A 5D91A 1XZ6A 1H5RA 1G93A 3V90A 1VH1A 2YQHA 2BO4A 2FY7A 3JTJA 4B42A 3I0EA 3NGWA 2RIYA 1S4NA 2RJ8A 3OAMA 3OH4A 3V8ZA 2QH5A 2X5ZA 3OH2A 2V0JA 1ZJ3A 2RJ4A 2VSHA 2ZU7A 3BRKX 3SX5A 1R80A 4CJCA 3U2VA 5EJZA 2QGIA 2OI7A 4EE5A 1V84A 1SS9A 2ZU8A 3I0FA 2W0WA 4EEMA 5FTVA 4LW3A 5AJOA 3U2WA 4J18A 4DDZA 4JISA 1MP3A 1ZCYA 2OEFA 3OH1A 1FXOA 2V0LA 2D0JA 4NALA 3IOHA 1WT0A 3I0CA 1ZI1A 4Y7FA 2UX8A 3R3IA 4B5BA 1ZJ1A 4B3UA 4Y7GA 1QGSA 3Q4SA 5CQNX 1H7HA 2AGDA 2P72A 3JUKA 1H4CA 2RJ5A 4HO0A 4UEGA 3IOIA 2YCMA 2I7BA 1G3LA 1ZDGA 1GWWA 2DPWA 2I5KA 4G3PA 2AH9A 5L6VA 4XWIA 3CU0A 1INJA 5C3BA 2FYBA 2J0BA 1G23A 2FYCB 4EE3A 1FO8A 1Z90A 1WT3A 3Q7UA 5BXCA 1ZJ2A 2C0NA 1PZYB 2VXLA 3DUVA 1E5KA 5AJNA 5D92A 5C4DA 2A8WA 4E1KA 2ZU9A 4M28A 4KQLA 4D11A 1WT2A 3I0LA 1LZJA 5I1FA 1HJLA 1JYLA 5C36A 3E26A 3T7OA 1H5SC 2AM5A 2Y4KA 4D0TA 4ASYA 2GGOA 3JUJA 1ZJ0A 1EZIA 1OQMB 3USRA 5CMIA 1R7UA 4HO3A 4AYJA 2Y4JA 5AJPA 4AYLA 1FXJA 3USQA 1EYRA 5JQQA 2YQCA 2JCLA 1ON8A 3F1YA 2RIZA 3OH3A 5C1HA 1H7GA 1NMMB 3R2WA 3CKNA 1YP4A 2OEGA 4K6RA 3V91A 1YROB 2QKXA 1ZJPA 5C47A 2YESA 2Y6PA 1FGXA 4KXOA 1H5TB 2YQJA 1H5SB 1TW5A 5DDVA 4HO6A 5HS2A 1NHEB 2AESA 3V0QA 5EJ1A 4JD0A 4FREA 4Y7VA 2WGZA 3RSBA 3U2TA 1K4VA 3PKQA 1H5RB 4O6MA 2RJ1A 1VGWA 3F1CA 3V0OA 4ZDQA 1LZ7A 1FGGA 4HO5A 1VM8A 4Y6NA 2JCOA 2D7RA 4HO9A 3I0HA 2O1FA 5DDTA 1H5SD 1W77A 3CKJA 4B4GA 4BQHA 4D0ZA 3SPTA 4MNDA 4IRQA 1ZI5A 1IIMA 2VS4A 5FV9A 1VPAA 4ECMA 4NAKA 3U2XA 1FZWA 4C2SA 2V0HA 3KIAA 2XMEA 4FRBA 2YC5A 5C4CA 5CQMX 3IOJA 3CGXA 2WVMA 1H4DA 1S4OA 2NXVA 2E8BA 4Y63A 3D5NA 5IDSA 3SXBA 3OC9A 5CQOA 2FYAA 3I0IX 4FRMA 3V0LA 3I0KA 1LL2A 4FCEA 1VZTA 1JV1A 4FRQA 4GBPA 3BCVA 2JCKA 4KT7A 1JVGA 2VFZA 3PKPA 2X5SA 3I0GA 2J0AA 2FFUA 2JCJA 4Y64A 3TZTA 2VS5A 2Q4JA 1HM0A 4HO8A 3SXGA 5CQLX 2GGQA 2RJ7A 4AAWA 3CKQA 4BMAA 1G97A 1GX0A 1ZCUA 2XWLA 2PX7A 1ZHJA 2W0VA 2VSIA 3N9WA 3ZF8A 4B4BA 3POLA 2Z86A 5L6SA 2WAWA 4HO4A 5IDTA 2CU2A 1VICA 1JVDA 4P00A 2A8UA 5C1GA 1VH3A 3D8VA 1GWVA 2AM3A 4CVHA 2WVLA 5J49A 4HCQA 1FG5N 2XWNA 1VZXA 4D48A 3D98A 4M4KA 4KC4A 2VXMA 1ON6A 1ZCTA 5C38A 2BO6A 5FUHA 1QGQA 3OKRA 2PGVA 4G3SA 3SXEA 3U2UA 4MIXA 2ICYA 2VK9A 2WVKA 5C4BA 4FQWA 1ZCVA 2VS3A 4FROA 1O7OA 3OH0A 1GX4A 1HM9A 1VZUA 5CMGX 2AE7A 3FWWA 3RMWA 5C49A 1GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNN A;  4FRP A;  4DE7 A;  1G8O A;  1WSZ A;  2O1G A;  5CMF X;  5FU0 A;  1H7F A;  4Y7U A;  1JV3 A;  2P6W A;  4G3Q A;  2YQS A;  3LW6 A;  1MC3 A;  1NWG B;  1PZT A;  4YS8 A;  1VGZ A;  2PA4 A;  3I0J A;  3O3P A;  1YP2 A;  3Q80 A;  1NQI B;  1HJJ A;  1YP3 A;  4KNR A;  4EEG A;  1H5T A;  2OI6 A;  1H7T A;  2FFV A;  2Z87 A;  1H5S A;  2FYD B;  2WEE A;  1MP4 A;  1H7L A;  2VD4 A;  3SXD A;  4FRA A;  1R7Y A;  1FOA A;  4MYB A;  1LL0 A;  3ST8 A;  4KRV A;  2V0I A;  5C4E A;  1H3M A;  2RJ6 A;  2Y4L A;  4NAI A;  3SXC A;  1OMX A;  4HG6 A;  4HO2 A;  3V0M A;  4FRD A;  3K8D A;  4KPX A;  5IFY A;  5EIY A;  3FOQ A;  3SX3 A;  2O1H A;  2MZB A;  1LVW A;  2WE9 A;  2AEC A;  1ZI4 A;  4CJB A;  2Y7A A;  4KC2 A;  1HM8 A;  3SXA A;  4B2X A;  1G0R A;  1G9R A;  1HV9 A;  3RMV A;  1ZJO A;  2BO8 A;  3HL3 A;  1NKH B;  4M2A A;  1R7T A;  1W57 A;  2AM4 A;  3TQD A;  3ZGF A;  4IRP A;  4DEC A;  2X65 A;  1ZIZ A;  3E25 A;  3DJ4 A;  2Y4M A;  1TZF A;  1G1L A;  1H4E A;  1ZDF A;  2RIT A;  4P02 A;  4FRH A;  3DK5 A;  3ZGG A;  1OMZ A;  1TW1 A;  2I5E A;  4B4M A;  1O23 B;  2D7I A;  2ICX A;  1ZI3 A;  3OGZ A;  4G87 A;  2BO7 A;  5FU8 A;  4Y7T A;  1INI A;  1S4P A;  3EE5 A;  3ZLK A;  1VGU A;  3V8Y A;  1GA8 A;  1QG8 A;  4D11 C;  1I52 A;  5CMH A;  3CKO A;  1NF5 B;  1VGT A;  5FTS A;  5C3D A;  4AC3 A;  1LZ0 A;  4L41 C;  4KNX A;  1R81 A;  2P73 A;  1LL3 A;  3T7N A;  3V0N A;  2XWM A;  1FWY A;  4ARW A;  3SX8 A;  2PGY A;  1H7Q A;  5CQP A;  1G2V A;  2RJ9 A;  3QVB A;  1FR8 A;  3U0X A;  5C8R A;  1H7E A;  1V82 A;  1WT1 A;  4KPZ A;  3I0D A;  5C1L A;  1GQ9 A;  3SX7 A;  4EVW A;  4CJ8 A;  1LZI A;  1W55 A;  1G95 A;  2XMH A;  3CKV A;  1KWS A;  2RIX A;  4KC1 A;  4FRL A;  5CMJ A;  1FRW A;  2X60 A;  4HOC A;  1O7Q A;  2V0K A;  3K8E A;  5C48 A;  4Y6U A;  1R7V A;  1IIN A;  2E3D A;  5C3A A;  4EEO A;  2YC3 A;  1WVC A;  1FR9 A;  2RJ0 A;  3U0Y A;  1XHB A;  5C4F A;  1TVY A;  1FO9 A;  5FYE A;  4R7P A;  1JYK A;  4B2W A;  3GUE A;  4ASJ A;  4Y9X A;  1MP5 A;  4EE4 A;  1R7X A;  4NAN A;  3T7M A;  3V0P A;  4EEA A;  2OI5 A;  2APC A;  1V83 A;  4FCU A;  3ZLL A;  4M2B A;  4Y62 A;  1O0R A;  1R82 A;  1QWJ A;  4LW6 A;  1XZ6 A;  1H5R A;  1G93 A;  3V90 A;  1VH1 A;  2YQH A;  2BO4 A;  2FY7 A;  3JTJ A;  4B42 A;  3I0E A;  3NGW A;  2RIY A;  1S4N A;  2RJ8 A;  3OAM A;  3OH4 A;  3V8Z A;  2QH5 A;  2X5Z A;  3OH2 A;  2V0J A;  1ZJ3 A;  2RJ4 A;  2VSH A;  2ZU7 A;  3BRK X;  3SX5 A;  1R80 A;  4CJC A;  3U2V A;  5EJZ A;  2QGI A;  2OI7 A;  4EE5 A;  1V84 A;  1SS9 A;  2ZU8 A;  3I0F A;  2W0W A;  4EEM A;  5FTV A;  4LW3 A;  5AJO A;  3U2W A;  4J18 A;  4DDZ A;  4JIS A;  1MP3 A;  1ZCY A;  2OEF A;  3OH1 A;  1FXO A;  2V0L A;  2D0J A;  4NAL A;  3IOH A;  1WT0 A;  3I0C A;  1ZI1 A;  4Y7F A;  2UX8 A;  3R3I A;  4B5B A;  1ZJ1 A;  4B3U A;  4Y7G A;  1QGS A;  3Q4S A;  5CQN X;  1H7H A;  2AGD A;  2P72 A;  3JUK A;  1H4C A;  2RJ5 A;  4HO0 A;  4UEG A;  3IOI A;  2YCM A;  2I7B A;  1G3L A;  1ZDG A;  1GWW A;  2DPW A;  2I5K A;  4G3P A;  2AH9 A;  5L6V A;  4XWI A;  3CU0 A;  1INJ A;  5C3B A;  2FYB A;  1G23 A;  2FYC B;  4EE3 A;  1FO8 A;  1Z90 A;  1WT3 A;  3Q7U A;  5BXC A;  1ZJ2 A;  1PZY B;  2VXL A;  3DUV A;  1E5K A;  5AJN A;  5C4D A;  2A8W A;  4E1K A;  2ZU9 A;  4M28 A;  4KQL A;  4D11 A;  1WT2 A;  3I0L A;  1LZJ A;  5I1F A;  1HJL A;  1JYL A;  5C36 A;  3E26 A;  3T7O A;  1H5S C;  2AM5 A;  2Y4K A;  4D0T A;  4ASY A;  2GGO A;  3JUJ A;  1ZJ0 A;  1EZI A;  1OQM B;  3USR A;  5CMI A;  1R7U A;  4HO3 A;  4AYJ A;  2Y4J A;  5AJP A;  4AYL A;  1FXJ A;  3USQ A;  1EYR A;  5JQQ A;  2YQC A;  2JCL A;  1ON8 A;  3F1Y A;  2RIZ A;  3OH3 A;  5C1H A;  1H7G A;  1NMM B;  3R2W A;  3CKN A;  1YP4 A;  2OEG A;  4K6R A;  3V91 A;  1YRO B;  2QKX A;  1ZJP A;  5C47 A;  2YES A;  2Y6P A;  1FGX A;  4KXO A;  1H5T B;  2YQJ A;  1H5S B;  1TW5 A;  5DDV A;  4HO6 A;  5HS2 A;  1NHE B;  2AES A;  3V0Q A;  5EJ1 A;  4JD0 A;  4FRE A;  4Y7V A;  2WGZ A;  3RSB A;  3U2T A;  1K4V A;  3PKQ A;  1H5R B;  2RJ1 A;  1VGW A;  3F1C A;  3V0O A;  4ZDQ A;  1LZ7 A;  1FGG A;  4HO5 A;  1VM8 A;  4Y6N A;  2JCO A;  2D7R A;  4HO9 A;  3I0H A;  2O1F A;  5DDT A;  1H5S D;  1W77 A;  3CKJ A;  4B4G A;  4BQH A;  4D0Z A;  3SPT A;  4MND A;  4IRQ A;  1ZI5 A;  1IIM A;  2VS4 A;  5FV9 A;  1VPA A;  4ECM A;  4NAK A;  3U2X A;  1FZW A;  4C2S A;  2V0H A;  3KIA A;  2XME A;  4FRB A;  2YC5 A;  5C4C A;  5CQM X;  3IOJ A;  3CGX A;  2WVM A;  1H4D A;  1S4O A;  2NXV A;  2E8B A;  4Y63 A;  3D5N A;  5IDS A;  3SXB A;  3OC9 A;  5CQO A;  2FYA A;  3I0I X;  4FRM A;  3V0L A;  3I0K A;  1LL2 A;  4FCE A;  1VZT A;  1JV1 A;  4FRQ A;  4GBP A;  3BCV A;  2JCK A;  4KT7 A;  1JVG A;  2VFZ A;  3PKP A;  2X5S A;  3I0G A;  2FFU A;  2JCJ A;  4Y64 A;  3TZT A;  2VS5 A;  2Q4J A;  1HM0 A;  4HO8 A;  3SXG A;  5CQL X;  2GGQ A;  2RJ7 A;  4AAW A;  3CKQ A;  4BMA A;  1G97 A;  1GX0 A;  1ZCU A;  2XWL A;  2PX7 A;  1ZHJ A;  2W0V A;  2VSI A;  3N9W A;  3ZF8 A;  4B4B A;  3POL A;  2Z86 A;  5L6S A;  2WAW A;  4HO4 A;  5IDT A;  2CU2 A;  1VIC A;  1JVD A;  4P00 A;  2A8U A;  5C1G A;  1VH3 A;  3D8V A;  1GWV A;  2AM3 A;  4CVH A;  2WVL A;  5J49 A;  4HCQ A;  1FG5 N;  2XWN A;  1VZX A;  4D48 A;  3D98 A;  4M4K A;  4KC4 A;  2VXM A;  1ON6 A;  1ZCT A;  5C38 A;  2BO6 A;  5FUH A;  1QGQ A;  3OKR A;  2PGV A;  4G3S A;  3SXE A;  3U2U A;  2ICY A;  2WVK A;  5C4B A;  4FQW A;  1ZCV A;  2VS3 A;  4FRO A;  1O7O A;  3OH0 A;  1GX4 A;  1HM9 A;  1VZU A;  5CMG X;  2AE7 A;  3FWW A;  3RMW A;  5C49 A;  1GQC A; 
#chains in the Genus database with same CATH topology
 3PNN A;  4FRP A;  4DE7 A;  1G8O A;  1WSZ A;  2O1G A;  5CMF X;  5FU0 A;  1H7F A;  4Y7U A;  1JV3 A;  2P6W A;  4G3Q A;  2YQS A;  3LW6 A;  1MC3 A;  1NWG B;  1PZT A;  4YS8 A;  1VGZ A;  2PA4 A;  3I0J A;  3O3P A;  1YP2 A;  3Q80 A;  1NQI B;  1HJJ A;  1YP3 A;  4KNR A;  4EEG A;  1H5T A;  2OI6 A;  1H7T A;  2FFV A;  2Z87 A;  1H5S A;  2FYD B;  2WEE A;  1MP4 A;  1H7L A;  2VD4 A;  3SXD A;  4FRA A;  1R7Y A;  1FOA A;  4MYB A;  1LL0 A;  3ST8 A;  4KRV A;  2V0I A;  5C4E A;  1H3M A;  2RJ6 A;  2Y4L A;  4NAI A;  3SXC A;  1OMX A;  4HG6 A;  4HO2 A;  3V0M A;  4FRD A;  3K8D A;  4KPX A;  5IFY A;  5EIY A;  3FOQ A;  3SX3 A;  2O1H A;  2MZB A;  1LVW A;  2WE9 A;  2AEC A;  1ZI4 A;  4CJB A;  2Y7A A;  4KC2 A;  1HM8 A;  3SXA A;  4B2X A;  1G0R A;  1G9R A;  1HV9 A;  3RMV A;  1ZJO A;  2BO8 A;  3HL3 A;  1NKH B;  4M2A A;  1R7T A;  1W57 A;  2AM4 A;  3TQD A;  3ZGF A;  4IRP A;  4DEC A;  2X65 A;  1ZIZ A;  3E25 A;  3DJ4 A;  2Y4M A;  1TZF A;  1G1L A;  1H4E A;  1ZDF A;  2RIT A;  4P02 A;  4FRH A;  3DK5 A;  3ZGG A;  1OMZ A;  1TW1 A;  2I5E A;  4B4M A;  1O23 B;  2D7I A;  2ICX A;  1ZI3 A;  3OGZ A;  4G87 A;  2BO7 A;  5FU8 A;  4Y7T A;  1INI A;  1S4P A;  3EE5 A;  3ZLK A;  1VGU A;  3V8Y A;  1GA8 A;  1QG8 A;  4D11 C;  1I52 A;  5CMH A;  3CKO A;  1NF5 B;  1VGT A;  5FTS A;  5C3D A;  4AC3 A;  1LZ0 A;  4L41 C;  4KNX A;  1R81 A;  4Q7C A;  2P73 A;  1LL3 A;  3T7N A;  3V0N A;  2XWM A;  1FWY A;  4ARW A;  3SX8 A;  2PGY A;  1H7Q A;  5CQP A;  1G2V A;  2RJ9 A;  3QVB A;  1FR8 A;  3U0X A;  5C8R A;  1H7E A;  1V82 A;  1WT1 A;  4KPZ A;  3I0D A;  5C1L A;  1GQ9 A;  3SX7 A;  4EVW A;  4CJ8 A;  1LZI A;  1W55 A;  1G95 A;  2XMH A;  3CKV A;  1KWS A;  2RIX A;  4KC1 A;  4FRL A;  5CMJ A;  1FRW A;  2X60 A;  4HOC A;  1O7Q A;  2V0K A;  3K8E A;  5C48 A;  4Y6U A;  1R7V A;  1IIN A;  2E3D A;  5C3A A;  4FIX A;  4EEO A;  2YC3 A;  1WVC A;  1FR9 A;  2RJ0 A;  4O6N A;  3U0Y A;  1XHB A;  5C4F A;  1TVY A;  1FO9 A;  5FYE A;  4R7P A;  1JYK A;  4B2W A;  3GUE A;  4ASJ A;  4Y9X A;  1MP5 A;  4EE4 A;  1R7X A;  4NAN A;  3T7M A;  3V0P A;  4EEA A;  2OI5 A;  2APC A;  4FIY A;  1V83 A;  4FCU A;  3ZLL A;  4M2B A;  4Y62 A;  1O0R A;  1R82 A;  1QWJ A;  4LW6 A;  5D91 A;  1XZ6 A;  1H5R A;  1G93 A;  3V90 A;  1VH1 A;  2YQH A;  2BO4 A;  2FY7 A;  3JTJ A;  4B42 A;  3I0E A;  3NGW A;  2RIY A;  1S4N A;  2RJ8 A;  3OAM A;  3OH4 A;  3V8Z A;  2QH5 A;  2X5Z A;  3OH2 A;  2V0J A;  1ZJ3 A;  2RJ4 A;  2VSH A;  2ZU7 A;  3BRK X;  3SX5 A;  1R80 A;  4CJC A;  3U2V A;  5EJZ A;  2QGI A;  2OI7 A;  4EE5 A;  1V84 A;  1SS9 A;  2ZU8 A;  3I0F A;  2W0W A;  4EEM A;  5FTV A;  4LW3 A;  5AJO A;  3U2W A;  4J18 A;  4DDZ A;  4JIS A;  1MP3 A;  1ZCY A;  2OEF A;  3OH1 A;  1FXO A;  2V0L A;  2D0J A;  4NAL A;  3IOH A;  1WT0 A;  3I0C A;  1ZI1 A;  4Y7F A;  2UX8 A;  3R3I A;  4B5B A;  1ZJ1 A;  4B3U A;  4Y7G A;  1QGS A;  3Q4S A;  5CQN X;  1H7H A;  2AGD A;  2P72 A;  3JUK A;  1H4C A;  2RJ5 A;  4HO0 A;  4UEG A;  3IOI A;  2YCM A;  2I7B A;  1G3L A;  1ZDG A;  1GWW A;  2DPW A;  2I5K A;  4G3P A;  2AH9 A;  5L6V A;  4XWI A;  3CU0 A;  1INJ A;  5C3B A;  2FYB A;  2J0B A;  1G23 A;  2FYC B;  4EE3 A;  1FO8 A;  1Z90 A;  1WT3 A;  3Q7U A;  5BXC A;  1ZJ2 A;  2C0N A;  1PZY B;  2VXL A;  3DUV A;  1E5K A;  5AJN A;  5D92 A;  5C4D A;  2A8W A;  4E1K A;  2ZU9 A;  4M28 A;  4KQL A;  4D11 A;  1WT2 A;  3I0L A;  1LZJ A;  5I1F A;  1HJL A;  1JYL A;  5C36 A;  3E26 A;  3T7O A;  1H5S C;  2AM5 A;  2Y4K A;  4D0T A;  4ASY A;  2GGO A;  3JUJ A;  1ZJ0 A;  1EZI A;  1OQM B;  3USR A;  5CMI A;  1R7U A;  4HO3 A;  4AYJ A;  2Y4J A;  5AJP A;  4AYL A;  1FXJ A;  3USQ A;  1EYR A;  5JQQ A;  2YQC A;  2JCL A;  1ON8 A;  3F1Y A;  2RIZ A;  3OH3 A;  5C1H A;  1H7G A;  1NMM B;  3R2W A;  3CKN A;  1YP4 A;  2OEG A;  4K6R A;  3V91 A;  1YRO B;  2QKX A;  1ZJP A;  5C47 A;  2YES A;  2Y6P A;  1FGX A;  4KXO A;  1H5T B;  2YQJ A;  1H5S B;  1TW5 A;  5DDV A;  4HO6 A;  5HS2 A;  1NHE B;  2AES A;  3V0Q A;  5EJ1 A;  4JD0 A;  4FRE A;  4Y7V A;  2WGZ A;  3RSB A;  3U2T A;  1K4V A;  3PKQ A;  1H5R B;  4O6M A;  2RJ1 A;  1VGW A;  3F1C A;  3V0O A;  4ZDQ A;  1LZ7 A;  1FGG A;  4HO5 A;  1VM8 A;  4Y6N A;  2JCO A;  2D7R A;  4HO9 A;  3I0H A;  2O1F A;  5DDT A;  1H5S D;  1W77 A;  3CKJ A;  4B4G A;  4BQH A;  4D0Z A;  3SPT A;  4MND A;  4IRQ A;  1ZI5 A;  1IIM A;  2VS4 A;  5FV9 A;  1VPA A;  4ECM A;  4NAK A;  3U2X A;  1FZW A;  4C2S A;  2V0H A;  3KIA A;  2XME A;  4FRB A;  2YC5 A;  5C4C A;  5CQM X;  3IOJ A;  3CGX A;  2WVM A;  1H4D A;  1S4O A;  2NXV A;  2E8B A;  4Y63 A;  3D5N A;  5IDS A;  3SXB A;  3OC9 A;  5CQO A;  2FYA A;  3I0I X;  4FRM A;  3V0L A;  3I0K A;  1LL2 A;  4FCE A;  1VZT A;  1JV1 A;  4FRQ A;  4GBP A;  3BCV A;  2JCK A;  4KT7 A;  1JVG A;  2VFZ A;  3PKP A;  2X5S A;  3I0G A;  2J0A A;  2FFU A;  2JCJ A;  4Y64 A;  3TZT A;  2VS5 A;  2Q4J A;  1HM0 A;  4HO8 A;  3SXG A;  5CQL X;  2GGQ A;  2RJ7 A;  4AAW A;  3CKQ A;  4BMA A;  1G97 A;  1GX0 A;  1ZCU A;  2XWL A;  2PX7 A;  1ZHJ A;  2W0V A;  2VSI A;  3N9W A;  3ZF8 A;  4B4B A;  3POL A;  2Z86 A;  5L6S A;  2WAW A;  4HO4 A;  5IDT A;  2CU2 A;  1VIC A;  1JVD A;  4P00 A;  2A8U A;  5C1G A;  1VH3 A;  3D8V A;  1GWV A;  2AM3 A;  4CVH A;  2WVL A;  5J49 A;  4HCQ A;  1FG5 N;  2XWN A;  1VZX A;  4D48 A;  3D98 A;  4M4K A;  4KC4 A;  2VXM A;  1ON6 A;  1ZCT A;  5C38 A;  2BO6 A;  5FUH A;  1QGQ A;  3OKR A;  2PGV A;  4G3S A;  3SXE A;  3U2U A;  4MIX A;  2ICY A;  2VK9 A;  2WVK A;  5C4B A;  4FQW A;  1ZCV A;  2VS3 A;  4FRO A;  1O7O A;  3OH0 A;  1GX4 A;  1HM9 A;  1VZU A;  5CMG X;  2AE7 A;  3FWW A;  3RMW A;  5C49 A;  1GQC A; 
#chains in the Genus database with same CATH homology
 3PNN A;  4FRP A;  4DE7 A;  1G8O A;  1WSZ A;  2O1G A;  5CMF X;  5FU0 A;  1H7F A;  4Y7U A;  1JV3 A;  2P6W A;  4G3Q A;  2YQS A;  3LW6 A;  1MC3 A;  1NWG B;  1PZT A;  4YS8 A;  1VGZ A;  2PA4 A;  3I0J A;  3O3P A;  1YP2 A;  3Q80 A;  1NQI B;  1HJJ A;  1YP3 A;  4KNR A;  4EEG A;  1H5T A;  2OI6 A;  1H7T A;  2FFV A;  2Z87 A;  1H5S A;  2FYD B;  2WEE A;  1MP4 A;  1H7L A;  2VD4 A;  3SXD A;  4FRA A;  1R7Y A;  1FOA A;  4MYB A;  1LL0 A;  3ST8 A;  4KRV A;  2V0I A;  5C4E A;  1H3M A;  2RJ6 A;  2Y4L A;  4NAI A;  3SXC A;  1OMX A;  4HG6 A;  4HO2 A;  3V0M A;  4FRD A;  3K8D A;  4KPX A;  5IFY A;  5EIY A;  3FOQ A;  3SX3 A;  2O1H A;  2MZB A;  1LVW A;  2WE9 A;  2AEC A;  1ZI4 A;  4CJB A;  2Y7A A;  4KC2 A;  1HM8 A;  3SXA A;  4B2X A;  1G0R A;  1G9R A;  1HV9 A;  3RMV A;  1ZJO A;  2BO8 A;  3HL3 A;  1NKH B;  4M2A A;  1R7T A;  1W57 A;  2AM4 A;  3TQD A;  3ZGF A;  4IRP A;  4DEC A;  2X65 A;  1ZIZ A;  3E25 A;  3DJ4 A;  2Y4M A;  1TZF A;  1G1L A;  1H4E A;  1ZDF A;  2RIT A;  4P02 A;  4FRH A;  3DK5 A;  3ZGG A;  1OMZ A;  1TW1 A;  2I5E A;  4B4M A;  1O23 B;  2D7I A;  2ICX A;  1ZI3 A;  3OGZ A;  4G87 A;  2BO7 A;  5FU8 A;  4Y7T A;  1INI A;  1S4P A;  3EE5 A;  3ZLK A;  1VGU A;  3V8Y A;  1GA8 A;  1QG8 A;  4D11 C;  1I52 A;  5CMH A;  3CKO A;  1NF5 B;  1VGT A;  5FTS A;  5C3D A;  4AC3 A;  1LZ0 A;  4L41 C;  4KNX A;  1R81 A;  4Q7C A;  2P73 A;  1LL3 A;  3T7N A;  3V0N A;  2XWM A;  1FWY A;  4ARW A;  3SX8 A;  2PGY A;  1H7Q A;  5CQP A;  1G2V A;  2RJ9 A;  3QVB A;  1FR8 A;  3U0X A;  5C8R A;  1H7E A;  1V82 A;  1WT1 A;  4KPZ A;  3I0D A;  5C1L A;  1GQ9 A;  3SX7 A;  4EVW A;  4CJ8 A;  1LZI A;  1W55 A;  1G95 A;  2XMH A;  3CKV A;  1KWS A;  2RIX A;  4KC1 A;  4FRL A;  5CMJ A;  1FRW A;  2X60 A;  4HOC A;  1O7Q A;  2V0K A;  3K8E A;  5C48 A;  4Y6U A;  1R7V A;  1IIN A;  2E3D A;  5C3A A;  4FIX A;  4EEO A;  2YC3 A;  1WVC A;  1FR9 A;  2RJ0 A;  4O6N A;  3U0Y A;  1XHB A;  5C4F A;  1TVY A;  1FO9 A;  5FYE A;  4R7P A;  1JYK A;  4B2W A;  3GUE A;  4ASJ A;  4Y9X A;  1MP5 A;  4EE4 A;  1R7X A;  4NAN A;  3T7M A;  3V0P A;  4EEA A;  2OI5 A;  2APC A;  4FIY A;  1V83 A;  4FCU A;  3ZLL A;  4M2B A;  4Y62 A;  1O0R A;  1R82 A;  1QWJ A;  4LW6 A;  5D91 A;  1XZ6 A;  1H5R A;  1G93 A;  3V90 A;  1VH1 A;  2YQH A;  2BO4 A;  2FY7 A;  3JTJ A;  4B42 A;  3I0E A;  3NGW A;  2RIY A;  1S4N A;  2RJ8 A;  3OAM A;  3OH4 A;  3V8Z A;  2QH5 A;  2X5Z A;  3OH2 A;  2V0J A;  1ZJ3 A;  2RJ4 A;  2VSH A;  2ZU7 A;  3BRK X;  3SX5 A;  1R80 A;  4CJC A;  3U2V A;  5EJZ A;  2QGI A;  2OI7 A;  4EE5 A;  1V84 A;  1SS9 A;  2ZU8 A;  3I0F A;  2W0W A;  4EEM A;  5FTV A;  4LW3 A;  5AJO A;  3U2W A;  4J18 A;  4DDZ A;  4JIS A;  1MP3 A;  1ZCY A;  2OEF A;  3OH1 A;  1FXO A;  2V0L A;  2D0J A;  4NAL A;  3IOH A;  1WT0 A;  3I0C A;  1ZI1 A;  4Y7F A;  2UX8 A;  3R3I A;  4B5B A;  1ZJ1 A;  4B3U A;  4Y7G A;  1QGS A;  3Q4S A;  5CQN X;  1H7H A;  2AGD A;  2P72 A;  3JUK A;  1H4C A;  2RJ5 A;  4HO0 A;  4UEG A;  3IOI A;  2YCM A;  2I7B A;  1G3L A;  1ZDG A;  1GWW A;  2DPW A;  2I5K A;  4G3P A;  2AH9 A;  5L6V A;  4XWI A;  3CU0 A;  1INJ A;  5C3B A;  2FYB A;  2J0B A;  1G23 A;  2FYC B;  4EE3 A;  1FO8 A;  1Z90 A;  1WT3 A;  3Q7U A;  5BXC A;  1ZJ2 A;  2C0N A;  1PZY B;  2VXL A;  3DUV A;  1E5K A;  5AJN A;  5D92 A;  5C4D A;  2A8W A;  4E1K A;  2ZU9 A;  4M28 A;  4KQL A;  4D11 A;  1WT2 A;  3I0L A;  1LZJ A;  5I1F A;  1HJL A;  1JYL A;  5C36 A;  3E26 A;  3T7O A;  1H5S C;  2AM5 A;  2Y4K A;  4D0T A;  4ASY A;  2GGO A;  3JUJ A;  1ZJ0 A;  1EZI A;  1OQM B;  3USR A;  5CMI A;  1R7U A;  4HO3 A;  4AYJ A;  2Y4J A;  5AJP A;  4AYL A;  1FXJ A;  3USQ A;  1EYR A;  5JQQ A;  2YQC A;  2JCL A;  1ON8 A;  3F1Y A;  2RIZ A;  3OH3 A;  5C1H A;  1H7G A;  1NMM B;  3R2W A;  3CKN A;  1YP4 A;  2OEG A;  4K6R A;  3V91 A;  1YRO B;  2QKX A;  1ZJP A;  5C47 A;  2YES A;  2Y6P A;  1FGX A;  4KXO A;  1H5T B;  2YQJ A;  1H5S B;  1TW5 A;  5DDV A;  4HO6 A;  5HS2 A;  1NHE B;  2AES A;  3V0Q A;  5EJ1 A;  4JD0 A;  4FRE A;  4Y7V A;  2WGZ A;  3RSB A;  3U2T A;  1K4V A;  3PKQ A;  1H5R B;  4O6M A;  2RJ1 A;  1VGW A;  3F1C A;  3V0O A;  4ZDQ A;  1LZ7 A;  1FGG A;  4HO5 A;  1VM8 A;  4Y6N A;  2JCO A;  2D7R A;  4HO9 A;  3I0H A;  2O1F A;  5DDT A;  1H5S D;  1W77 A;  3CKJ A;  4B4G A;  4BQH A;  4D0Z A;  3SPT A;  4MND A;  4IRQ A;  1ZI5 A;  1IIM A;  2VS4 A;  5FV9 A;  1VPA A;  4ECM A;  4NAK A;  3U2X A;  1FZW A;  4C2S A;  2V0H A;  3KIA A;  2XME A;  4FRB A;  2YC5 A;  5C4C A;  5CQM X;  3IOJ A;  3CGX A;  2WVM A;  1H4D A;  1S4O A;  2NXV A;  2E8B A;  4Y63 A;  3D5N A;  5IDS A;  3SXB A;  3OC9 A;  5CQO A;  2FYA A;  3I0I X;  4FRM A;  3V0L A;  3I0K A;  1LL2 A;  4FCE A;  1VZT A;  1JV1 A;  4FRQ A;  4GBP A;  3BCV A;  2JCK A;  4KT7 A;  1JVG A;  2VFZ A;  3PKP A;  2X5S A;  3I0G A;  2J0A A;  2FFU A;  2JCJ A;  4Y64 A;  3TZT A;  2VS5 A;  2Q4J A;  1HM0 A;  4HO8 A;  3SXG A;  5CQL X;  2GGQ A;  2RJ7 A;  4AAW A;  3CKQ A;  4BMA A;  1G97 A;  1GX0 A;  1ZCU A;  2XWL A;  2PX7 A;  1ZHJ A;  2W0V A;  2VSI A;  3N9W A;  3ZF8 A;  4B4B A;  3POL A;  2Z86 A;  5L6S A;  2WAW A;  4HO4 A;  5IDT A;  2CU2 A;  1VIC A;  1JVD A;  4P00 A;  2A8U A;  5C1G A;  1VH3 A;  3D8V A;  1GWV A;  2AM3 A;  4CVH A;  2WVL A;  5J49 A;  4HCQ A;  1FG5 N;  2XWN A;  1VZX A;  4D48 A;  3D98 A;  4M4K A;  4KC4 A;  2VXM A;  1ON6 A;  1ZCT A;  5C38 A;  2BO6 A;  5FUH A;  1QGQ A;  3OKR A;  2PGV A;  4G3S A;  3SXE A;  3U2U A;  4MIX A;  2ICY A;  2VK9 A;  2WVK A;  5C4B A;  4FQW A;  1ZCV A;  2VS3 A;  4FRO A;  1O7O A;  3OH0 A;  1GX4 A;  1HM9 A;  1VZU A;  5CMG X;  2AE7 A;  3FWW A;  3RMW A;  5C49 A;  1GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...