5C47A

Crystal structure of abbb + udp-c-gal (long soak) + di
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 288
sequence length 290
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c47A00
1G93A 5CQPA 3V91A 4FRPA 2VSHA 4B2WA 2YC5A 3R3IA 3OH0A 3CKJA 2V0HA 4EEGA 1QGSA 3I0DA 5FTSA 5CMIA 2O1FA 1VM8A 2ICYA 1H5SA 4M28A 4IRPA 1FGGA 1VGZA 3T7MA 2VXLA 2OEGA 1FXJA 5C1LA 4HO8A 1ON6A 2RJ6A 5C48A 1JVGA 4K6RA 1H5RA 1H5SC 5BXCA 3T7NA 2PGYA 3U2WA 5J49A 4KPZA 3U0YA 3PKQA 1R7UA 3BRKX 1ZJ2A 1ZI1A 3SXBA 5JQQA 2BO4A 5FTVA 1FG5N 4KT7A 5CQOA 1ZDFA 2Y6PA 3LW6A 2AH9A 1KWSA 5IDTA 1G0RA 3ZF8A 4D11A 4DECA 1G23A 5FU8A 4FCEA 2YQCA 2JCJA 2E3DA 3D8VA 2MZBA 4JD0A 1K4VA 1JYLA 3OH4A 2D0JA 2VS4A 3Q4SA 3U0XA 2AM3A 4Y62A 2XMHA 1H7QA 1INIA 1VH1A 2YC3A 4HO2A 4Y7FA 2VSIA 4ZDQA 3JUKA 3V0MA 5CMFX 3OH1A 1FGXA 2AGDA 1GQCA 1S4NA 1FO8A 1OQMB 3V8YA 3V90A 1ZCVA 2BO8A 3DUVA 1EYRA 1O7OA 2A8WA 1GA8A 2Q4JA 5C4CA 1HM8A 3GUEA 4MNDA 4EVWA 5C38A 1NWGB 4ASJA 2OI5A 3N9WA 1FO9A 5CQLX 1WVCA 1WT0A 4EE5A 2I5EA 3I0EA 1VGUA 1FOAA 1R7YA 1VPAA 1GX4A 1WSZA 4Y6UA 2D7RA 2JCKA 5C3DA 3SX8A 5C8RA 2ZU8A 3CKNA 2WAWA 3POLA 1ZDGA 2V0JA 2Z86A 3OC9A 1XZ6A 4Y6NA 1PZYB 3SX5A 1INJA 1IIMA 2O1HA 1V84A 3SXAA 1R7TA 1G3LA 4M4KA 4E1KA 1G95A 2RJ9A 5C49A 1H7GA 5IFYA 4HO9A 4FROA 4LW3A 2NXVA 2FFUA 3V0LA 5FU0A 2RITA 1HM0A 1H7LA 1ZJ1A 4B2XA 3D5NA 1I52A 1WT2A 2WVKA 3SX3A 3USQA 1HJJA 3U2UA 1QGQA 2AESA 3I0HA 2ZU9A 3SXCA 5AJPA 3ZGGA 4L41C 3ST8A 4B3UA 4J18A 3U2XA 5EJZA 3I0KA 3Q7UA 1QWJA 2X60A 1VH3A 2QKXA 2OEFA 1G2VA 1SS9A 1H4EA 1G97A 4AYLA 5IDSA 1LL3A 2A8UA 1R82A 2W0VA 3OH2A 1FZWA 1R7VA 2WVMA 3I0CA 2RJ1A 1ZCUA 2RJ8A 1GWWA 4AYJA 4XWIA 1NF5B 5AJOA 3FOQA 4HO0A 2VD4A 2WE9A 4FRBA 2GGQA 4Y7GA 3V0OA 4LW6A 4CJ8A 2W0WA 4FRDA 5C1HA 4GBPA 2Y4JA 5CQMX 1TW1A 2OI6A 1PZTA 4JISA 4IRQA 1NQIB 1ZI4A 4CVHA 1OMZA 4HO6A 2AECA 3DK5A 5DDTA 1H5SB 1O0RA 1GWVA 1V83A 4UEGA 2OI7A 2PA4A 2WEEA 1YP4A 1JVDA 4FRHA 1ZCTA 5HS2A 1H5RB 3JTJA 5CMHA 1WT1A 4R7PA 4KQLA 2YESA 5C3BA 3D98A 1JV3A 4M2BA 2XWLA 1MP5A 2Y4KA 1HM9A 3HL3A 4KXOA 1HJLA 5C36A 1GX0A 4KNRA 1MC3A 3OAMA 4G3PA 3PNNA 3IOHA 3ZLKA 4EEMA 1ZIZA 1H7EA 1G9RA 1EZIA 1ZJPA 4FRMA 2I7BA 5FYEA 4EEAA 2V0KA 2APCA 3FWWA 1FR9A 2ICXA 1NHEB 4DDZA 4ASYA 3V0QA 1FXOA 1YP2A 2P6WA 2BO7A 5C4DA 5FUHA 1ZJ3A 5C4EA 1IINA 2XWMA 3K8DA 3RMWA 3SXGA 3I0IX 4AAWA 3CKQA 2YQHA 1VZTA 2VS5A 2UX8A 2FYDB 1XHBA 4YS8A 3OGZA 4G3QA 2QGIA 3SPTA 1R81A 5CQNX 1H7HA 2FY7A 3TZTA 1VZXA 1S4PA 4HG6A 2QH5A 5CMJA 1O23B 4EEOA 3R2WA 3QVBA 1LL0A 3SXDA 1O7QA 1ZHJA 3TQDA 2FFVA 2YQJA 1S4OA 5AJNA 1V82A 3F1YA 1VGTA 2FYBA 1NKHB 1LL2A 1ON8A 1W57A 4FREA 5I1FA 4D48A 3V8ZA 1WT3A 2X5ZA 5C4BA 2XMEA 1VICA 1LVWA 2XWNA 1HV9A 1MP4A 1G1LA 2VXMA 4FCUA 4NAIA 2X5SA 1TVYA 1ZJ0A 4B4GA 4D0ZA 2Y4LA 3T7OA 4MYBA 3U2VA 4FRQA 2YQSA 1QG8A 4P02A 3ZLLA 2VS3A 1ZI3A 5C3AA 3CKOA 5C4FA 3V0PA 1OMXA 1ZCYA 4HO3A 4KC1A 1H7TA 4KNXA 2RIZA 2V0IA 4NANA 4P00A 2RJ5A 2ZU7A 1GQ9A 5DDVA 4Y64A 3KIAA 1FR8A 3V0NA 1H5TA 1E5KA 2YCMA 2RJ4A 2WGZA 1FWYA 1H4DA 3I0FA 2GGOA 1MP3A 1H3MA 1TZFA 3E26A 3PKPA 2RJ0A 3DJ4A 2FYAA 4EE4A 3O3PA 1G8OA 1LZJA 4C2SA 3RSBA 2PGVA 4B4BA 2P72A 2I5KA 1YROB 1JYKA 3CKVA 4Y7UA 4FRAA 4HO5A 2WVLA 1LZ7A 2AM4A 1R7XA 3SXEA 3I0LA 4BMAA 4B42A 5L6VA 2Y7AA 1LZ0A 3RMVA 5C1GA 1R80A 4DE7A 5FV9A 1NMMB 4D11C 1ZI5A 4NAKA 4Y7TA 1YP3A 4Y63A 1H5TB 2P73A 4FQWA 3U2TA 1TW5A 2CU2A 3CU0A 4BQHA 3I0JA 3USRA 2JCOA 5L6SA 4ECMA 4KRVA 2O1GA 4KPXA 4B4MA 3JUJA 3BCVA 3K8EA 2X65A 4NALA 2Y4MA 2VFZA 4FRLA 4B5BA 4AC3A 1H5SD 4KC4A 1VGWA 4G3SA 4HO4A 4HOCA 3ZGFA 4CJCA 4Y7VA 4ARWA 2JCLA 1FRWA 2D7IA 3OH3A 4D0TA 2DPWA 2PX7A 2Z87A 2E8BA 3IOJA 3SX7A 4EE3A 1VZUA 1W77A 1JV1A 2BO6A 3EE5A 1H4CA 1W55A 1ZJOA 5EJ1A 5CMGX 4HCQA 3NGWA 2AE7A 3IOIA 1LZIA 3F1CA 3Q80A 5C47A 4CJBA 4KC2A 2FYCB 3CGXA 1Z90A 2V0LA 2RJ7A 4G87A 2RIYA 2RIXA 1H7FA 4Y9XA 3E25A 2AM5A 3OKRA 5EIYA 3I0GA 4M2AA
chains in the Genus database with same CATH superfamily
1G93A 5CQPA 3V91A 2J0BA 4FRPA 2VSHA 4B2WA 2YC5A 3R3IA 3OH0A 3CKJA 2V0HA 4EEGA 1QGSA 3I0DA 5FTSA 5CMIA 2O1FA 1VM8A 2ICYA 1H5SA 4M28A 4IRPA 1FGGA 1VGZA 3T7MA 2VXLA 2OEGA 1FXJA 5C1LA 4HO8A 1ON6A 2RJ6A 5C48A 1JVGA 4K6RA 1H5RA 1H5SC 5BXCA 3T7NA 2PGYA 3U2WA 5J49A 4KPZA 3U0YA 3PKQA 1R7UA 3BRKX 1ZJ2A 1ZI1A 3SXBA 5JQQA 2BO4A 5FTVA 1FG5N 4KT7A 5CQOA 1ZDFA 2Y6PA 3LW6A 2AH9A 1KWSA 5IDTA 1G0RA 3ZF8A 4D11A 4DECA 1G23A 5FU8A 4FCEA 2YQCA 2JCJA 2E3DA 3D8VA 2MZBA 4JD0A 1K4VA 1JYLA 3OH4A 2D0JA 2VS4A 3Q4SA 3U0XA 2AM3A 4Y62A 2XMHA 1H7QA 1INIA 1VH1A 2YC3A 4HO2A 4Y7FA 2VSIA 4ZDQA 3JUKA 3V0MA 5CMFX 3OH1A 1FGXA 2AGDA 1GQCA 1S4NA 1FO8A 1OQMB 4O6NA 3V8YA 3V90A 1ZCVA 2BO8A 3DUVA 1EYRA 1O7OA 2A8WA 1GA8A 2Q4JA 5C4CA 1HM8A 3GUEA 4MNDA 4EVWA 5C38A 1NWGB 4ASJA 2OI5A 3N9WA 1FO9A 5CQLX 1WVCA 1WT0A 4EE5A 2I5EA 3I0EA 1VGUA 1FOAA 1R7YA 1VPAA 1GX4A 1WSZA 4Y6UA 2D7RA 2JCKA 5C3DA 3SX8A 5C8RA 2ZU8A 3CKNA 2WAWA 3POLA 1ZDGA 2V0JA 2Z86A 3OC9A 1XZ6A 4Y6NA 1PZYB 3SX5A 1INJA 1IIMA 2O1HA 1V84A 3SXAA 1R7TA 1G3LA 4M4KA 4E1KA 1G95A 2RJ9A 5C49A 1H7GA 5IFYA 4HO9A 4FROA 4LW3A 2NXVA 2FFUA 3V0LA 5FU0A 2RITA 1HM0A 1H7LA 1ZJ1A 4B2XA 3D5NA 1I52A 1WT2A 2WVKA 3SX3A 3USQA 1HJJA 3U2UA 1QGQA 2AESA 4FIYA 3I0HA 2ZU9A 3SXCA 5AJPA 3ZGGA 4L41C 3ST8A 4B3UA 4J18A 3U2XA 5EJZA 3I0KA 3Q7UA 1QWJA 2X60A 1VH3A 2QKXA 2OEFA 1G2VA 1SS9A 1H4EA 1G97A 4AYLA 5IDSA 1LL3A 2A8UA 1R82A 2W0VA 3OH2A 2J0AA 1FZWA 1R7VA 2WVMA 3I0CA 2RJ1A 1ZCUA 2RJ8A 1GWWA 4AYJA 4XWIA 1NF5B 5AJOA 3FOQA 4HO0A 2VD4A 2WE9A 4FRBA 2GGQA 4Y7GA 3V0OA 4LW6A 4CJ8A 2W0WA 4FIXA 4FRDA 5C1HA 4GBPA 2Y4JA 5CQMX 1TW1A 2OI6A 1PZTA 4JISA 4IRQA 1NQIB 1ZI4A 4CVHA 1OMZA 4HO6A 2AECA 3DK5A 5DDTA 1H5SB 1O0RA 4MIXA 1GWVA 1V83A 4UEGA 2OI7A 2PA4A 2WEEA 1YP4A 1JVDA 4FRHA 1ZCTA 5HS2A 1H5RB 3JTJA 5CMHA 1WT1A 5D92A 4R7PA 4KQLA 2YESA 5C3BA 3D98A 1JV3A 4M2BA 2XWLA 1MP5A 2Y4KA 1HM9A 3HL3A 4KXOA 1HJLA 5C36A 1GX0A 4KNRA 1MC3A 3OAMA 4G3PA 3PNNA 3IOHA 3ZLKA 4EEMA 1ZIZA 1H7EA 1G9RA 1EZIA 1ZJPA 4FRMA 2I7BA 5FYEA 4EEAA 2V0KA 2APCA 3FWWA 4O6MA 1FR9A 2ICXA 1NHEB 4DDZA 4ASYA 3V0QA 1FXOA 1YP2A 2P6WA 2BO7A 5C4DA 5FUHA 1ZJ3A 5C4EA 1IINA 2XWMA 3K8DA 3RMWA 3SXGA 3I0IX 4AAWA 3CKQA 2YQHA 1VZTA 2VS5A 2UX8A 2FYDB 1XHBA 4YS8A 3OGZA 4G3QA 2QGIA 3SPTA 1R81A 5CQNX 1H7HA 2FY7A 3TZTA 1VZXA 1S4PA 4HG6A 2QH5A 5CMJA 1O23B 4EEOA 3R2WA 3QVBA 1LL0A 3SXDA 1O7QA 1ZHJA 3TQDA 2FFVA 2YQJA 1S4OA 5AJNA 1V82A 3F1YA 1VGTA 2FYBA 1NKHB 1LL2A 1ON8A 1W57A 4FREA 5D91A 5I1FA 4D48A 3V8ZA 1WT3A 2X5ZA 5C4BA 2XMEA 1VICA 1LVWA 2XWNA 1HV9A 1MP4A 1G1LA 2VXMA 4FCUA 4NAIA 2X5SA 1TVYA 1ZJ0A 4B4GA 4D0ZA 2Y4LA 3T7OA 4MYBA 3U2VA 4FRQA 2YQSA 1QG8A 4P02A 3ZLLA 2VS3A 1ZI3A 5C3AA 2C0NA 3CKOA 2VK9A 5C4FA 3V0PA 1OMXA 1ZCYA 4HO3A 4KC1A 1H7TA 4KNXA 4Q7CA 2RIZA 2V0IA 4NANA 4P00A 2RJ5A 2ZU7A 1GQ9A 5DDVA 4Y64A 3KIAA 1FR8A 3V0NA 1H5TA 1E5KA 2YCMA 2RJ4A 2WGZA 1FWYA 1H4DA 3I0FA 2GGOA 1MP3A 1H3MA 1TZFA 3E26A 3PKPA 2RJ0A 3DJ4A 2FYAA 4EE4A 3O3PA 1G8OA 1LZJA 4C2SA 3RSBA 2PGVA 4B4BA 2P72A 2I5KA 1YROB 1JYKA 3CKVA 4Y7UA 4FRAA 4HO5A 2WVLA 1LZ7A 2AM4A 1R7XA 3SXEA 3I0LA 4BMAA 4B42A 5L6VA 2Y7AA 1LZ0A 3RMVA 5C1GA 1R80A 4DE7A 5FV9A 1NMMB 4D11C 1ZI5A 4NAKA 4Y7TA 1YP3A 4Y63A 1H5TB 2P73A 4FQWA 3U2TA 1TW5A 2CU2A 3CU0A 4BQHA 3I0JA 3USRA 2JCOA 5L6SA 4ECMA 4KRVA 2O1GA 4KPXA 4B4MA 3JUJA 3BCVA 3K8EA 2X65A 4NALA 2Y4MA 2VFZA 4FRLA 4B5BA 4AC3A 1H5SD 4KC4A 1VGWA 4G3SA 4HO4A 4HOCA 3ZGFA 4CJCA 4Y7VA 4ARWA 2JCLA 1FRWA 2D7IA 3OH3A 4D0TA 2DPWA 2PX7A 2Z87A 2E8BA 3IOJA 3SX7A 4EE3A 1VZUA 1W77A 1JV1A 2BO6A 3EE5A 1H4CA 1W55A 1ZJOA 5EJ1A 5CMGX 4HCQA 3NGWA 2AE7A 3IOIA 1LZIA 3F1CA 3Q80A 5C47A 4CJBA 4KC2A 2FYCB 3CGXA 1Z90A 2V0LA 2RJ7A 4G87A 2RIYA 2RIXA 1H7FA 4Y9XA 3E25A 2AM5A 3OKRA 5EIYA 3I0GA 4M2AA
chains in the Genus database with same CATH topology
1G93A 5CQPA 3V91A 2J0BA 4FRPA 2VSHA 4B2WA 2YC5A 3R3IA 3OH0A 3CKJA 2V0HA 4EEGA 1QGSA 3I0DA 5FTSA 5CMIA 2O1FA 1VM8A 2ICYA 1H5SA 4M28A 4IRPA 1FGGA 1VGZA 3T7MA 2VXLA 2OEGA 1FXJA 5C1LA 4HO8A 1ON6A 2RJ6A 5C48A 1JVGA 4K6RA 1H5RA 1H5SC 5BXCA 3T7NA 2PGYA 3U2WA 5J49A 4KPZA 3U0YA 3PKQA 1R7UA 3BRKX 1ZJ2A 1ZI1A 3SXBA 5JQQA 2BO4A 5FTVA 1FG5N 4KT7A 5CQOA 1ZDFA 2Y6PA 3LW6A 2AH9A 1KWSA 5IDTA 1G0RA 3ZF8A 4D11A 4DECA 1G23A 5FU8A 4FCEA 2YQCA 2JCJA 2E3DA 3D8VA 2MZBA 4JD0A 1K4VA 1JYLA 3OH4A 2D0JA 2VS4A 3Q4SA 3U0XA 2AM3A 4Y62A 2XMHA 1H7QA 1INIA 1VH1A 2YC3A 4HO2A 4Y7FA 2VSIA 4ZDQA 3JUKA 3V0MA 5CMFX 3OH1A 1FGXA 2AGDA 1GQCA 1S4NA 1FO8A 1OQMB 4O6NA 3V8YA 3V90A 1ZCVA 2BO8A 3DUVA 1EYRA 1O7OA 2A8WA 1GA8A 2Q4JA 5C4CA 1HM8A 3GUEA 4MNDA 4EVWA 5C38A 1NWGB 4ASJA 2OI5A 3N9WA 1FO9A 5CQLX 1WVCA 1WT0A 4EE5A 2I5EA 3I0EA 1VGUA 1FOAA 1R7YA 1VPAA 1GX4A 1WSZA 4Y6UA 2D7RA 2JCKA 5C3DA 3SX8A 5C8RA 2ZU8A 3CKNA 2WAWA 3POLA 1ZDGA 2V0JA 2Z86A 3OC9A 1XZ6A 4Y6NA 1PZYB 3SX5A 1INJA 1IIMA 2O1HA 1V84A 3SXAA 1R7TA 1G3LA 4M4KA 4E1KA 1G95A 2RJ9A 5C49A 1H7GA 5IFYA 4HO9A 4FROA 4LW3A 2NXVA 2FFUA 3V0LA 5FU0A 2RITA 1HM0A 1H7LA 1ZJ1A 4B2XA 3D5NA 1I52A 1WT2A 2WVKA 3SX3A 3USQA 1HJJA 3U2UA 1QGQA 2AESA 4FIYA 3I0HA 2ZU9A 3SXCA 5AJPA 3ZGGA 4L41C 3ST8A 4B3UA 4J18A 3U2XA 5EJZA 3I0KA 3Q7UA 1QWJA 2X60A 1VH3A 2QKXA 2OEFA 1G2VA 1SS9A 1H4EA 1G97A 4AYLA 5IDSA 1LL3A 2A8UA 1R82A 2W0VA 3OH2A 2J0AA 1FZWA 1R7VA 2WVMA 3I0CA 2RJ1A 1ZCUA 2RJ8A 1GWWA 4AYJA 4XWIA 1NF5B 5AJOA 3FOQA 4HO0A 2VD4A 2WE9A 4FRBA 2GGQA 4Y7GA 3V0OA 4LW6A 4CJ8A 2W0WA 4FIXA 4FRDA 5C1HA 4GBPA 2Y4JA 5CQMX 1TW1A 2OI6A 1PZTA 4JISA 4IRQA 1NQIB 1ZI4A 4CVHA 1OMZA 4HO6A 2AECA 3DK5A 5DDTA 1H5SB 1O0RA 4MIXA 1GWVA 1V83A 4UEGA 2OI7A 2PA4A 2WEEA 1YP4A 1JVDA 4FRHA 1ZCTA 5HS2A 1H5RB 3JTJA 5CMHA 1WT1A 5D92A 4R7PA 4KQLA 2YESA 5C3BA 3D98A 1JV3A 4M2BA 2XWLA 1MP5A 2Y4KA 1HM9A 3HL3A 4KXOA 1HJLA 5C36A 1GX0A 4KNRA 1MC3A 3OAMA 4G3PA 3PNNA 3IOHA 3ZLKA 4EEMA 1ZIZA 1H7EA 1G9RA 1EZIA 1ZJPA 4FRMA 2I7BA 5FYEA 4EEAA 2V0KA 2APCA 3FWWA 4O6MA 1FR9A 2ICXA 1NHEB 4DDZA 4ASYA 3V0QA 1FXOA 1YP2A 2P6WA 2BO7A 5C4DA 5FUHA 1ZJ3A 5C4EA 1IINA 2XWMA 3K8DA 3RMWA 3SXGA 3I0IX 4AAWA 3CKQA 2YQHA 1VZTA 2VS5A 2UX8A 2FYDB 1XHBA 4YS8A 3OGZA 4G3QA 2QGIA 3SPTA 1R81A 5CQNX 1H7HA 2FY7A 3TZTA 1VZXA 1S4PA 4HG6A 2QH5A 5CMJA 1O23B 4EEOA 3R2WA 3QVBA 1LL0A 3SXDA 1O7QA 1ZHJA 3TQDA 2FFVA 2YQJA 1S4OA 5AJNA 1V82A 3F1YA 1VGTA 2FYBA 1NKHB 1LL2A 1ON8A 1W57A 4FREA 5D91A 5I1FA 4D48A 3V8ZA 1WT3A 2X5ZA 5C4BA 2XMEA 1VICA 1LVWA 2XWNA 1HV9A 1MP4A 1G1LA 2VXMA 4FCUA 4NAIA 2X5SA 1TVYA 1ZJ0A 4B4GA 4D0ZA 2Y4LA 3T7OA 4MYBA 3U2VA 4FRQA 2YQSA 1QG8A 4P02A 3ZLLA 2VS3A 1ZI3A 5C3AA 2C0NA 3CKOA 2VK9A 5C4FA 3V0PA 1OMXA 1ZCYA 4HO3A 4KC1A 1H7TA 4KNXA 4Q7CA 2RIZA 2V0IA 4NANA 4P00A 2RJ5A 2ZU7A 1GQ9A 5DDVA 4Y64A 3KIAA 1FR8A 3V0NA 1H5TA 1E5KA 2YCMA 2RJ4A 2WGZA 1FWYA 1H4DA 3I0FA 2GGOA 1MP3A 1H3MA 1TZFA 3E26A 3PKPA 2RJ0A 3DJ4A 2FYAA 4EE4A 3O3PA 1G8OA 1LZJA 4C2SA 3RSBA 2PGVA 4B4BA 2P72A 2I5KA 1YROB 1JYKA 3CKVA 4Y7UA 4FRAA 4HO5A 2WVLA 1LZ7A 2AM4A 1R7XA 3SXEA 3I0LA 4BMAA 4B42A 5L6VA 2Y7AA 1LZ0A 3RMVA 5C1GA 1R80A 4DE7A 5FV9A 1NMMB 4D11C 1ZI5A 4NAKA 4Y7TA 1YP3A 4Y63A 1H5TB 2P73A 4FQWA 3U2TA 1TW5A 2CU2A 3CU0A 4BQHA 3I0JA 3USRA 2JCOA 5L6SA 4ECMA 4KRVA 2O1GA 4KPXA 4B4MA 3JUJA 3BCVA 3K8EA 2X65A 4NALA 2Y4MA 2VFZA 4FRLA 4B5BA 4AC3A 1H5SD 4KC4A 1VGWA 4G3SA 4HO4A 4HOCA 3ZGFA 4CJCA 4Y7VA 4ARWA 2JCLA 1FRWA 2D7IA 3OH3A 4D0TA 2DPWA 2PX7A 2Z87A 2E8BA 3IOJA 3SX7A 4EE3A 1VZUA 1W77A 1JV1A 2BO6A 3EE5A 1H4CA 1W55A 1ZJOA 5EJ1A 5CMGX 4HCQA 3NGWA 2AE7A 3IOIA 1LZIA 3F1CA 3Q80A 5C47A 4CJBA 4KC2A 2FYCB 3CGXA 1Z90A 2V0LA 2RJ7A 4G87A 2RIYA 2RIXA 1H7FA 4Y9XA 3E25A 2AM5A 3OKRA 5EIYA 3I0GA 4M2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G93 A;  5CQP A;  3V91 A;  4FRP A;  2VSH A;  4B2W A;  2YC5 A;  3R3I A;  3OH0 A;  3CKJ A;  2V0H A;  4EEG A;  1QGS A;  3I0D A;  5FTS A;  5CMI A;  2O1F A;  1VM8 A;  2ICY A;  1H5S A;  4M28 A;  4IRP A;  1FGG A;  1VGZ A;  3T7M A;  2VXL A;  2OEG A;  1FXJ A;  5C1L A;  4HO8 A;  1ON6 A;  2RJ6 A;  5C48 A;  1JVG A;  4K6R A;  1H5R A;  1H5S C;  5BXC A;  3T7N A;  2PGY A;  3U2W A;  5J49 A;  4KPZ A;  3U0Y A;  3PKQ A;  1R7U A;  3BRK X;  1ZJ2 A;  1ZI1 A;  3SXB A;  5JQQ A;  2BO4 A;  5FTV A;  1FG5 N;  4KT7 A;  5CQO A;  1ZDF A;  2Y6P A;  3LW6 A;  2AH9 A;  1KWS A;  5IDT A;  1G0R A;  3ZF8 A;  4D11 A;  4DEC A;  1G23 A;  5FU8 A;  4FCE A;  2YQC A;  2JCJ A;  2E3D A;  3D8V A;  2MZB A;  4JD0 A;  1K4V A;  1JYL A;  3OH4 A;  2D0J A;  2VS4 A;  3Q4S A;  3U0X A;  2AM3 A;  4Y62 A;  2XMH A;  1H7Q A;  1INI A;  1VH1 A;  2YC3 A;  4HO2 A;  4Y7F A;  2VSI A;  4ZDQ A;  3JUK A;  3V0M A;  5CMF X;  3OH1 A;  1FGX A;  2AGD A;  1GQC A;  1S4N A;  1FO8 A;  1OQM B;  3V8Y A;  3V90 A;  1ZCV A;  2BO8 A;  3DUV A;  1EYR A;  1O7O A;  2A8W A;  1GA8 A;  2Q4J A;  5C4C A;  1HM8 A;  3GUE A;  4MND A;  4EVW A;  5C38 A;  1NWG B;  4ASJ A;  2OI5 A;  3N9W A;  1FO9 A;  5CQL X;  1WVC A;  1WT0 A;  4EE5 A;  2I5E A;  3I0E A;  1VGU A;  1FOA A;  1R7Y A;  1VPA A;  1GX4 A;  1WSZ A;  4Y6U A;  2D7R A;  2JCK A;  5C3D A;  3SX8 A;  5C8R A;  2ZU8 A;  3CKN A;  2WAW A;  3POL A;  1ZDG A;  2V0J A;  2Z86 A;  3OC9 A;  1XZ6 A;  4Y6N A;  1PZY B;  3SX5 A;  1INJ A;  1IIM A;  2O1H A;  1V84 A;  3SXA A;  1R7T A;  1G3L A;  4M4K A;  4E1K A;  1G95 A;  2RJ9 A;  5C49 A;  1H7G A;  5IFY A;  4HO9 A;  4FRO A;  4LW3 A;  2NXV A;  2FFU A;  3V0L A;  5FU0 A;  2RIT A;  1HM0 A;  1H7L A;  1ZJ1 A;  4B2X A;  3D5N A;  1I52 A;  1WT2 A;  2WVK A;  3SX3 A;  3USQ A;  1HJJ A;  3U2U A;  1QGQ A;  2AES A;  3I0H A;  2ZU9 A;  3SXC A;  5AJP A;  3ZGG A;  4L41 C;  3ST8 A;  4B3U A;  4J18 A;  3U2X A;  5EJZ A;  3I0K A;  3Q7U A;  1QWJ A;  2X60 A;  1VH3 A;  2QKX A;  2OEF A;  1G2V A;  1SS9 A;  1H4E A;  1G97 A;  4AYL A;  5IDS A;  1LL3 A;  2A8U A;  1R82 A;  2W0V A;  3OH2 A;  1FZW A;  1R7V A;  2WVM A;  3I0C A;  2RJ1 A;  1ZCU A;  2RJ8 A;  1GWW A;  4AYJ A;  4XWI A;  1NF5 B;  5AJO A;  3FOQ A;  4HO0 A;  2VD4 A;  2WE9 A;  4FRB A;  2GGQ A;  4Y7G A;  3V0O A;  4LW6 A;  4CJ8 A;  2W0W A;  4FRD A;  5C1H A;  4GBP A;  2Y4J A;  5CQM X;  1TW1 A;  2OI6 A;  1PZT A;  4JIS A;  4IRQ A;  1NQI B;  1ZI4 A;  4CVH A;  1OMZ A;  4HO6 A;  2AEC A;  3DK5 A;  5DDT A;  1H5S B;  1O0R A;  1GWV A;  1V83 A;  4UEG A;  2OI7 A;  2PA4 A;  2WEE A;  1YP4 A;  1JVD A;  4FRH A;  1ZCT A;  5HS2 A;  1H5R B;  3JTJ A;  5CMH A;  1WT1 A;  4R7P A;  4KQL A;  2YES A;  5C3B A;  3D98 A;  1JV3 A;  4M2B A;  2XWL A;  1MP5 A;  2Y4K A;  1HM9 A;  3HL3 A;  4KXO A;  1HJL A;  5C36 A;  1GX0 A;  4KNR A;  1MC3 A;  3OAM A;  4G3P A;  3PNN A;  3IOH A;  3ZLK A;  4EEM A;  1ZIZ A;  1H7E A;  1G9R A;  1EZI A;  1ZJP A;  4FRM A;  2I7B A;  5FYE A;  4EEA A;  2V0K A;  2APC A;  3FWW A;  1FR9 A;  2ICX A;  1NHE B;  4DDZ A;  4ASY A;  3V0Q A;  1FXO A;  1YP2 A;  2P6W A;  2BO7 A;  5C4D A;  5FUH A;  1ZJ3 A;  5C4E A;  1IIN A;  2XWM A;  3K8D A;  3RMW A;  3SXG A;  3I0I X;  4AAW A;  3CKQ A;  2YQH A;  1VZT A;  2VS5 A;  2UX8 A;  2FYD B;  1XHB A;  4YS8 A;  3OGZ A;  4G3Q A;  2QGI A;  3SPT A;  1R81 A;  5CQN X;  1H7H A;  2FY7 A;  3TZT A;  1VZX A;  1S4P A;  4HG6 A;  2QH5 A;  5CMJ A;  1O23 B;  4EEO A;  3R2W A;  3QVB A;  1LL0 A;  3SXD A;  1O7Q A;  1ZHJ A;  3TQD A;  2FFV A;  2YQJ A;  1S4O A;  5AJN A;  1V82 A;  3F1Y A;  1VGT A;  2FYB A;  1NKH B;  1LL2 A;  1ON8 A;  1W57 A;  4FRE A;  5I1F A;  4D48 A;  3V8Z A;  1WT3 A;  2X5Z A;  5C4B A;  2XME A;  1VIC A;  1LVW A;  2XWN A;  1HV9 A;  1MP4 A;  1G1L A;  2VXM A;  4FCU A;  4NAI A;  2X5S A;  1TVY A;  1ZJ0 A;  4B4G A;  4D0Z A;  2Y4L A;  3T7O A;  4MYB A;  3U2V A;  4FRQ A;  2YQS A;  1QG8 A;  4P02 A;  3ZLL A;  2VS3 A;  1ZI3 A;  5C3A A;  3CKO A;  5C4F A;  3V0P A;  1OMX A;  1ZCY A;  4HO3 A;  4KC1 A;  1H7T A;  4KNX A;  2RIZ A;  2V0I A;  4NAN A;  4P00 A;  2RJ5 A;  2ZU7 A;  1GQ9 A;  5DDV A;  4Y64 A;  3KIA A;  1FR8 A;  3V0N A;  1H5T A;  1E5K A;  2YCM A;  2RJ4 A;  2WGZ A;  1FWY A;  1H4D A;  3I0F A;  2GGO A;  1MP3 A;  1H3M A;  1TZF A;  3E26 A;  3PKP A;  2RJ0 A;  3DJ4 A;  2FYA A;  4EE4 A;  3O3P A;  1G8O A;  1LZJ A;  4C2S A;  3RSB A;  2PGV A;  4B4B A;  2P72 A;  2I5K A;  1YRO B;  1JYK A;  3CKV A;  4Y7U A;  4FRA A;  4HO5 A;  2WVL A;  1LZ7 A;  2AM4 A;  1R7X A;  3SXE A;  3I0L A;  4BMA A;  4B42 A;  5L6V A;  2Y7A A;  1LZ0 A;  3RMV A;  5C1G A;  1R80 A;  4DE7 A;  5FV9 A;  1NMM B;  4D11 C;  1ZI5 A;  4NAK A;  4Y7T A;  1YP3 A;  4Y63 A;  1H5T B;  2P73 A;  4FQW A;  3U2T A;  1TW5 A;  2CU2 A;  3CU0 A;  4BQH A;  3I0J A;  3USR A;  2JCO A;  5L6S A;  4ECM A;  4KRV A;  2O1G A;  4KPX A;  4B4M A;  3JUJ A;  3BCV A;  3K8E A;  2X65 A;  4NAL A;  2Y4M A;  2VFZ A;  4FRL A;  4B5B A;  4AC3 A;  1H5S D;  4KC4 A;  1VGW A;  4G3S A;  4HO4 A;  4HOC A;  3ZGF A;  4CJC A;  4Y7V A;  4ARW A;  2JCL A;  1FRW A;  2D7I A;  3OH3 A;  4D0T A;  2DPW A;  2PX7 A;  2Z87 A;  2E8B A;  3IOJ A;  3SX7 A;  4EE3 A;  1VZU A;  1W77 A;  1JV1 A;  2BO6 A;  3EE5 A;  1H4C A;  1W55 A;  1ZJO A;  5EJ1 A;  5CMG X;  4HCQ A;  3NGW A;  2AE7 A;  3IOI A;  1LZI A;  3F1C A;  3Q80 A;  5C47 A;  4CJB A;  4KC2 A;  2FYC B;  3CGX A;  1Z90 A;  2V0L A;  2RJ7 A;  4G87 A;  2RIY A;  2RIX A;  1H7F A;  4Y9X A;  3E25 A;  2AM5 A;  3OKR A;  5EIY A;  3I0G A;  4M2A A; 
#chains in the Genus database with same CATH topology
 1G93 A;  5CQP A;  3V91 A;  2J0B A;  4FRP A;  2VSH A;  4B2W A;  2YC5 A;  3R3I A;  3OH0 A;  3CKJ A;  2V0H A;  4EEG A;  1QGS A;  3I0D A;  5FTS A;  5CMI A;  2O1F A;  1VM8 A;  2ICY A;  1H5S A;  4M28 A;  4IRP A;  1FGG A;  1VGZ A;  3T7M A;  2VXL A;  2OEG A;  1FXJ A;  5C1L A;  4HO8 A;  1ON6 A;  2RJ6 A;  5C48 A;  1JVG A;  4K6R A;  1H5R A;  1H5S C;  5BXC A;  3T7N A;  2PGY A;  3U2W A;  5J49 A;  4KPZ A;  3U0Y A;  3PKQ A;  1R7U A;  3BRK X;  1ZJ2 A;  1ZI1 A;  3SXB A;  5JQQ A;  2BO4 A;  5FTV A;  1FG5 N;  4KT7 A;  5CQO A;  1ZDF A;  2Y6P A;  3LW6 A;  2AH9 A;  1KWS A;  5IDT A;  1G0R A;  3ZF8 A;  4D11 A;  4DEC A;  1G23 A;  5FU8 A;  4FCE A;  2YQC A;  2JCJ A;  2E3D A;  3D8V A;  2MZB A;  4JD0 A;  1K4V A;  1JYL A;  3OH4 A;  2D0J A;  2VS4 A;  3Q4S A;  3U0X A;  2AM3 A;  4Y62 A;  2XMH A;  1H7Q A;  1INI A;  1VH1 A;  2YC3 A;  4HO2 A;  4Y7F A;  2VSI A;  4ZDQ A;  3JUK A;  3V0M A;  5CMF X;  3OH1 A;  1FGX A;  2AGD A;  1GQC A;  1S4N A;  1FO8 A;  1OQM B;  4O6N A;  3V8Y A;  3V90 A;  1ZCV A;  2BO8 A;  3DUV A;  1EYR A;  1O7O A;  2A8W A;  1GA8 A;  2Q4J A;  5C4C A;  1HM8 A;  3GUE A;  4MND A;  4EVW A;  5C38 A;  1NWG B;  4ASJ A;  2OI5 A;  3N9W A;  1FO9 A;  5CQL X;  1WVC A;  1WT0 A;  4EE5 A;  2I5E A;  3I0E A;  1VGU A;  1FOA A;  1R7Y A;  1VPA A;  1GX4 A;  1WSZ A;  4Y6U A;  2D7R A;  2JCK A;  5C3D A;  3SX8 A;  5C8R A;  2ZU8 A;  3CKN A;  2WAW A;  3POL A;  1ZDG A;  2V0J A;  2Z86 A;  3OC9 A;  1XZ6 A;  4Y6N A;  1PZY B;  3SX5 A;  1INJ A;  1IIM A;  2O1H A;  1V84 A;  3SXA A;  1R7T A;  1G3L A;  4M4K A;  4E1K A;  1G95 A;  2RJ9 A;  5C49 A;  1H7G A;  5IFY A;  4HO9 A;  4FRO A;  4LW3 A;  2NXV A;  2FFU A;  3V0L A;  5FU0 A;  2RIT A;  1HM0 A;  1H7L A;  1ZJ1 A;  4B2X A;  3D5N A;  1I52 A;  1WT2 A;  2WVK A;  3SX3 A;  3USQ A;  1HJJ A;  3U2U A;  1QGQ A;  2AES A;  4FIY A;  3I0H A;  2ZU9 A;  3SXC A;  5AJP A;  3ZGG A;  4L41 C;  3ST8 A;  4B3U A;  4J18 A;  3U2X A;  5EJZ A;  3I0K A;  3Q7U A;  1QWJ A;  2X60 A;  1VH3 A;  2QKX A;  2OEF A;  1G2V A;  1SS9 A;  1H4E A;  1G97 A;  4AYL A;  5IDS A;  1LL3 A;  2A8U A;  1R82 A;  2W0V A;  3OH2 A;  2J0A A;  1FZW A;  1R7V A;  2WVM A;  3I0C A;  2RJ1 A;  1ZCU A;  2RJ8 A;  1GWW A;  4AYJ A;  4XWI A;  1NF5 B;  5AJO A;  3FOQ A;  4HO0 A;  2VD4 A;  2WE9 A;  4FRB A;  2GGQ A;  4Y7G A;  3V0O A;  4LW6 A;  4CJ8 A;  2W0W A;  4FIX A;  4FRD A;  5C1H A;  4GBP A;  2Y4J A;  5CQM X;  1TW1 A;  2OI6 A;  1PZT A;  4JIS A;  4IRQ A;  1NQI B;  1ZI4 A;  4CVH A;  1OMZ A;  4HO6 A;  2AEC A;  3DK5 A;  5DDT A;  1H5S B;  1O0R A;  4MIX A;  1GWV A;  1V83 A;  4UEG A;  2OI7 A;  2PA4 A;  2WEE A;  1YP4 A;  1JVD A;  4FRH A;  1ZCT A;  5HS2 A;  1H5R B;  3JTJ A;  5CMH A;  1WT1 A;  5D92 A;  4R7P A;  4KQL A;  2YES A;  5C3B A;  3D98 A;  1JV3 A;  4M2B A;  2XWL A;  1MP5 A;  2Y4K A;  1HM9 A;  3HL3 A;  4KXO A;  1HJL A;  5C36 A;  1GX0 A;  4KNR A;  1MC3 A;  3OAM A;  4G3P A;  3PNN A;  3IOH A;  3ZLK A;  4EEM A;  1ZIZ A;  1H7E A;  1G9R A;  1EZI A;  1ZJP A;  4FRM A;  2I7B A;  5FYE A;  4EEA A;  2V0K A;  2APC A;  3FWW A;  4O6M A;  1FR9 A;  2ICX A;  1NHE B;  4DDZ A;  4ASY A;  3V0Q A;  1FXO A;  1YP2 A;  2P6W A;  2BO7 A;  5C4D A;  5FUH A;  1ZJ3 A;  5C4E A;  1IIN A;  2XWM A;  3K8D A;  3RMW A;  3SXG A;  3I0I X;  4AAW A;  3CKQ A;  2YQH A;  1VZT A;  2VS5 A;  2UX8 A;  2FYD B;  1XHB A;  4YS8 A;  3OGZ A;  4G3Q A;  2QGI A;  3SPT A;  1R81 A;  5CQN X;  1H7H A;  2FY7 A;  3TZT A;  1VZX A;  1S4P A;  4HG6 A;  2QH5 A;  5CMJ A;  1O23 B;  4EEO A;  3R2W A;  3QVB A;  1LL0 A;  3SXD A;  1O7Q A;  1ZHJ A;  3TQD A;  2FFV A;  2YQJ A;  1S4O A;  5AJN A;  1V82 A;  3F1Y A;  1VGT A;  2FYB A;  1NKH B;  1LL2 A;  1ON8 A;  1W57 A;  4FRE A;  5D91 A;  5I1F A;  4D48 A;  3V8Z A;  1WT3 A;  2X5Z A;  5C4B A;  2XME A;  1VIC A;  1LVW A;  2XWN A;  1HV9 A;  1MP4 A;  1G1L A;  2VXM A;  4FCU A;  4NAI A;  2X5S A;  1TVY A;  1ZJ0 A;  4B4G A;  4D0Z A;  2Y4L A;  3T7O A;  4MYB A;  3U2V A;  4FRQ A;  2YQS A;  1QG8 A;  4P02 A;  3ZLL A;  2VS3 A;  1ZI3 A;  5C3A A;  2C0N A;  3CKO A;  2VK9 A;  5C4F A;  3V0P A;  1OMX A;  1ZCY A;  4HO3 A;  4KC1 A;  1H7T A;  4KNX A;  4Q7C A;  2RIZ A;  2V0I A;  4NAN A;  4P00 A;  2RJ5 A;  2ZU7 A;  1GQ9 A;  5DDV A;  4Y64 A;  3KIA A;  1FR8 A;  3V0N A;  1H5T A;  1E5K A;  2YCM A;  2RJ4 A;  2WGZ A;  1FWY A;  1H4D A;  3I0F A;  2GGO A;  1MP3 A;  1H3M A;  1TZF A;  3E26 A;  3PKP A;  2RJ0 A;  3DJ4 A;  2FYA A;  4EE4 A;  3O3P A;  1G8O A;  1LZJ A;  4C2S A;  3RSB A;  2PGV A;  4B4B A;  2P72 A;  2I5K A;  1YRO B;  1JYK A;  3CKV A;  4Y7U A;  4FRA A;  4HO5 A;  2WVL A;  1LZ7 A;  2AM4 A;  1R7X A;  3SXE A;  3I0L A;  4BMA A;  4B42 A;  5L6V A;  2Y7A A;  1LZ0 A;  3RMV A;  5C1G A;  1R80 A;  4DE7 A;  5FV9 A;  1NMM B;  4D11 C;  1ZI5 A;  4NAK A;  4Y7T A;  1YP3 A;  4Y63 A;  1H5T B;  2P73 A;  4FQW A;  3U2T A;  1TW5 A;  2CU2 A;  3CU0 A;  4BQH A;  3I0J A;  3USR A;  2JCO A;  5L6S A;  4ECM A;  4KRV A;  2O1G A;  4KPX A;  4B4M A;  3JUJ A;  3BCV A;  3K8E A;  2X65 A;  4NAL A;  2Y4M A;  2VFZ A;  4FRL A;  4B5B A;  4AC3 A;  1H5S D;  4KC4 A;  1VGW A;  4G3S A;  4HO4 A;  4HOC A;  3ZGF A;  4CJC A;  4Y7V A;  4ARW A;  2JCL A;  1FRW A;  2D7I A;  3OH3 A;  4D0T A;  2DPW A;  2PX7 A;  2Z87 A;  2E8B A;  3IOJ A;  3SX7 A;  4EE3 A;  1VZU A;  1W77 A;  1JV1 A;  2BO6 A;  3EE5 A;  1H4C A;  1W55 A;  1ZJO A;  5EJ1 A;  5CMG X;  4HCQ A;  3NGW A;  2AE7 A;  3IOI A;  1LZI A;  3F1C A;  3Q80 A;  5C47 A;  4CJB A;  4KC2 A;  2FYC B;  3CGX A;  1Z90 A;  2V0L A;  2RJ7 A;  4G87 A;  2RIY A;  2RIX A;  1H7F A;  4Y9X A;  3E25 A;  2AM5 A;  3OKR A;  5EIY A;  3I0G A;  4M2A A; 
#chains in the Genus database with same CATH homology
 1G93 A;  5CQP A;  3V91 A;  2J0B A;  4FRP A;  2VSH A;  4B2W A;  2YC5 A;  3R3I A;  3OH0 A;  3CKJ A;  2V0H A;  4EEG A;  1QGS A;  3I0D A;  5FTS A;  5CMI A;  2O1F A;  1VM8 A;  2ICY A;  1H5S A;  4M28 A;  4IRP A;  1FGG A;  1VGZ A;  3T7M A;  2VXL A;  2OEG A;  1FXJ A;  5C1L A;  4HO8 A;  1ON6 A;  2RJ6 A;  5C48 A;  1JVG A;  4K6R A;  1H5R A;  1H5S C;  5BXC A;  3T7N A;  2PGY A;  3U2W A;  5J49 A;  4KPZ A;  3U0Y A;  3PKQ A;  1R7U A;  3BRK X;  1ZJ2 A;  1ZI1 A;  3SXB A;  5JQQ A;  2BO4 A;  5FTV A;  1FG5 N;  4KT7 A;  5CQO A;  1ZDF A;  2Y6P A;  3LW6 A;  2AH9 A;  1KWS A;  5IDT A;  1G0R A;  3ZF8 A;  4D11 A;  4DEC A;  1G23 A;  5FU8 A;  4FCE A;  2YQC A;  2JCJ A;  2E3D A;  3D8V A;  2MZB A;  4JD0 A;  1K4V A;  1JYL A;  3OH4 A;  2D0J A;  2VS4 A;  3Q4S A;  3U0X A;  2AM3 A;  4Y62 A;  2XMH A;  1H7Q A;  1INI A;  1VH1 A;  2YC3 A;  4HO2 A;  4Y7F A;  2VSI A;  4ZDQ A;  3JUK A;  3V0M A;  5CMF X;  3OH1 A;  1FGX A;  2AGD A;  1GQC A;  1S4N A;  1FO8 A;  1OQM B;  4O6N A;  3V8Y A;  3V90 A;  1ZCV A;  2BO8 A;  3DUV A;  1EYR A;  1O7O A;  2A8W A;  1GA8 A;  2Q4J A;  5C4C A;  1HM8 A;  3GUE A;  4MND A;  4EVW A;  5C38 A;  1NWG B;  4ASJ A;  2OI5 A;  3N9W A;  1FO9 A;  5CQL X;  1WVC A;  1WT0 A;  4EE5 A;  2I5E A;  3I0E A;  1VGU A;  1FOA A;  1R7Y A;  1VPA A;  1GX4 A;  1WSZ A;  4Y6U A;  2D7R A;  2JCK A;  5C3D A;  3SX8 A;  5C8R A;  2ZU8 A;  3CKN A;  2WAW A;  3POL A;  1ZDG A;  2V0J A;  2Z86 A;  3OC9 A;  1XZ6 A;  4Y6N A;  1PZY B;  3SX5 A;  1INJ A;  1IIM A;  2O1H A;  1V84 A;  3SXA A;  1R7T A;  1G3L A;  4M4K A;  4E1K A;  1G95 A;  2RJ9 A;  5C49 A;  1H7G A;  5IFY A;  4HO9 A;  4FRO A;  4LW3 A;  2NXV A;  2FFU A;  3V0L A;  5FU0 A;  2RIT A;  1HM0 A;  1H7L A;  1ZJ1 A;  4B2X A;  3D5N A;  1I52 A;  1WT2 A;  2WVK A;  3SX3 A;  3USQ A;  1HJJ A;  3U2U A;  1QGQ A;  2AES A;  4FIY A;  3I0H A;  2ZU9 A;  3SXC A;  5AJP A;  3ZGG A;  4L41 C;  3ST8 A;  4B3U A;  4J18 A;  3U2X A;  5EJZ A;  3I0K A;  3Q7U A;  1QWJ A;  2X60 A;  1VH3 A;  2QKX A;  2OEF A;  1G2V A;  1SS9 A;  1H4E A;  1G97 A;  4AYL A;  5IDS A;  1LL3 A;  2A8U A;  1R82 A;  2W0V A;  3OH2 A;  2J0A A;  1FZW A;  1R7V A;  2WVM A;  3I0C A;  2RJ1 A;  1ZCU A;  2RJ8 A;  1GWW A;  4AYJ A;  4XWI A;  1NF5 B;  5AJO A;  3FOQ A;  4HO0 A;  2VD4 A;  2WE9 A;  4FRB A;  2GGQ A;  4Y7G A;  3V0O A;  4LW6 A;  4CJ8 A;  2W0W A;  4FIX A;  4FRD A;  5C1H A;  4GBP A;  2Y4J A;  5CQM X;  1TW1 A;  2OI6 A;  1PZT A;  4JIS A;  4IRQ A;  1NQI B;  1ZI4 A;  4CVH A;  1OMZ A;  4HO6 A;  2AEC A;  3DK5 A;  5DDT A;  1H5S B;  1O0R A;  4MIX A;  1GWV A;  1V83 A;  4UEG A;  2OI7 A;  2PA4 A;  2WEE A;  1YP4 A;  1JVD A;  4FRH A;  1ZCT A;  5HS2 A;  1H5R B;  3JTJ A;  5CMH A;  1WT1 A;  5D92 A;  4R7P A;  4KQL A;  2YES A;  5C3B A;  3D98 A;  1JV3 A;  4M2B A;  2XWL A;  1MP5 A;  2Y4K A;  1HM9 A;  3HL3 A;  4KXO A;  1HJL A;  5C36 A;  1GX0 A;  4KNR A;  1MC3 A;  3OAM A;  4G3P A;  3PNN A;  3IOH A;  3ZLK A;  4EEM A;  1ZIZ A;  1H7E A;  1G9R A;  1EZI A;  1ZJP A;  4FRM A;  2I7B A;  5FYE A;  4EEA A;  2V0K A;  2APC A;  3FWW A;  4O6M A;  1FR9 A;  2ICX A;  1NHE B;  4DDZ A;  4ASY A;  3V0Q A;  1FXO A;  1YP2 A;  2P6W A;  2BO7 A;  5C4D A;  5FUH A;  1ZJ3 A;  5C4E A;  1IIN A;  2XWM A;  3K8D A;  3RMW A;  3SXG A;  3I0I X;  4AAW A;  3CKQ A;  2YQH A;  1VZT A;  2VS5 A;  2UX8 A;  2FYD B;  1XHB A;  4YS8 A;  3OGZ A;  4G3Q A;  2QGI A;  3SPT A;  1R81 A;  5CQN X;  1H7H A;  2FY7 A;  3TZT A;  1VZX A;  1S4P A;  4HG6 A;  2QH5 A;  5CMJ A;  1O23 B;  4EEO A;  3R2W A;  3QVB A;  1LL0 A;  3SXD A;  1O7Q A;  1ZHJ A;  3TQD A;  2FFV A;  2YQJ A;  1S4O A;  5AJN A;  1V82 A;  3F1Y A;  1VGT A;  2FYB A;  1NKH B;  1LL2 A;  1ON8 A;  1W57 A;  4FRE A;  5D91 A;  5I1F A;  4D48 A;  3V8Z A;  1WT3 A;  2X5Z A;  5C4B A;  2XME A;  1VIC A;  1LVW A;  2XWN A;  1HV9 A;  1MP4 A;  1G1L A;  2VXM A;  4FCU A;  4NAI A;  2X5S A;  1TVY A;  1ZJ0 A;  4B4G A;  4D0Z A;  2Y4L A;  3T7O A;  4MYB A;  3U2V A;  4FRQ A;  2YQS A;  1QG8 A;  4P02 A;  3ZLL A;  2VS3 A;  1ZI3 A;  5C3A A;  2C0N A;  3CKO A;  2VK9 A;  5C4F A;  3V0P A;  1OMX A;  1ZCY A;  4HO3 A;  4KC1 A;  1H7T A;  4KNX A;  4Q7C A;  2RIZ A;  2V0I A;  4NAN A;  4P00 A;  2RJ5 A;  2ZU7 A;  1GQ9 A;  5DDV A;  4Y64 A;  3KIA A;  1FR8 A;  3V0N A;  1H5T A;  1E5K A;  2YCM A;  2RJ4 A;  2WGZ A;  1FWY A;  1H4D A;  3I0F A;  2GGO A;  1MP3 A;  1H3M A;  1TZF A;  3E26 A;  3PKP A;  2RJ0 A;  3DJ4 A;  2FYA A;  4EE4 A;  3O3P A;  1G8O A;  1LZJ A;  4C2S A;  3RSB A;  2PGV A;  4B4B A;  2P72 A;  2I5K A;  1YRO B;  1JYK A;  3CKV A;  4Y7U A;  4FRA A;  4HO5 A;  2WVL A;  1LZ7 A;  2AM4 A;  1R7X A;  3SXE A;  3I0L A;  4BMA A;  4B42 A;  5L6V A;  2Y7A A;  1LZ0 A;  3RMV A;  5C1G A;  1R80 A;  4DE7 A;  5FV9 A;  1NMM B;  4D11 C;  1ZI5 A;  4NAK A;  4Y7T A;  1YP3 A;  4Y63 A;  1H5T B;  2P73 A;  4FQW A;  3U2T A;  1TW5 A;  2CU2 A;  3CU0 A;  4BQH A;  3I0J A;  3USR A;  2JCO A;  5L6S A;  4ECM A;  4KRV A;  2O1G A;  4KPX A;  4B4M A;  3JUJ A;  3BCV A;  3K8E A;  2X65 A;  4NAL A;  2Y4M A;  2VFZ A;  4FRL A;  4B5B A;  4AC3 A;  1H5S D;  4KC4 A;  1VGW A;  4G3S A;  4HO4 A;  4HOC A;  3ZGF A;  4CJC A;  4Y7V A;  4ARW A;  2JCL A;  1FRW A;  2D7I A;  3OH3 A;  4D0T A;  2DPW A;  2PX7 A;  2Z87 A;  2E8B A;  3IOJ A;  3SX7 A;  4EE3 A;  1VZU A;  1W77 A;  1JV1 A;  2BO6 A;  3EE5 A;  1H4C A;  1W55 A;  1ZJO A;  5EJ1 A;  5CMG X;  4HCQ A;  3NGW A;  2AE7 A;  3IOI A;  1LZI A;  3F1C A;  3Q80 A;  5C47 A;  4CJB A;  4KC2 A;  2FYC B;  3CGX A;  1Z90 A;  2V0L A;  2RJ7 A;  4G87 A;  2RIY A;  2RIX A;  1H7F A;  4Y9X A;  3E25 A;  2AM5 A;  3OKR A;  5EIY A;  3I0G A;  4M2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...